F358119

General Info

Members Datasets Scaffolds Average Seq Length
246 166 492 410

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10185457|Ga0114129_101854573
Length 479
Sequence MTCCGGPGSFKQDAEKAWTCFDRLSTNGKSSTVLIPDPFALSLSKGERGVLQPAKEQVRGACETKVTSMERTNGAFSRSWPAGYHRIPFWVYSDPGVYEREQQRIFAGPSWCYVGLGAEIPRPGDFKRSVIGDKPVVLTRDKEGGLNVVVNRCAHRGVQFCRRDFGNTSDFMCPYHQWTYDLKGNLRGVPFRRGLKQQGGMPEDFKLEEHSLQRLWVTERHGVIFASFDPRVPSLEEYLGPSMLFYFDRVFDGRALRVLGYMRQRIRSNWKLMFENIKDPYHASLLHVFLVTFGLFRADQPSAVKMDESGRHAVLVSRRGEQKASEGTSEMKSFRANFTLNDPKLLTPVKEFPGDATVVMQTLWPNLIVQQQSNTLAMRQLVTRGPDTFDLLWTFFGYVDDSDEMTQLRLRQANLMGPSGLVSIDDSEMMELSQNGIGRYPDATGVIELGGRDARDEDHMVTEAPVRGFYKYYREVMGL

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
4 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
19 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
22 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
32 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
33 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
43 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
44 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
45 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
64 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
67 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
68 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
69 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
70 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
71 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
72 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
73 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
74 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
75 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
76 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
77 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
78 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
79 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
80 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
81 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
82 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
83 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
84 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
85 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
86 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
87 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
88 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
89 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
90 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
91 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
92 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
93 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
94 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
96 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
97 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
98 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
99 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
100 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
101 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
102 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
103 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
104 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
105 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
106 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
107 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
108 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
109 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
110 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
111 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
112 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
113 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
114 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
115 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
116 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
117 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
118 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
119 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
120 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
121 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
122 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
123 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
124 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
125 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
126 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
127 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
128 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
129 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
130 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
131 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
132 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
133 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
134 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
135 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
136 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
137 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
138 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
139 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
140 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
141 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
142 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
143 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
144 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
145 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
147 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
148 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
149 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
150 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
151 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
152 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
153 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
154 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
155 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
156 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
157 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
158 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
159 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
160 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
161 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
162 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
163 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
164 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
165 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
166 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.19
Metatranscriptomes 0
Isolates 0.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.44
Nodule 0
Rhizoplane 0.81
Rhizosphere 95.53
Stem 0
Stem Tuber 0
Unclassified 4.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10185457 3300009147 Bacteria 2828
2 JGI25406J46586_10014557 3300003203 Bacteria 3342
3 Ga0070661_100000164 3300005344 Bacteria 54634
4 Ga0070709_10024302 3300005434 Unclassified 3566
5 Ga0070709_10086095 3300005434 Unclassified 2062
6 Ga0070714_100000587 3300005435 Bacteria 26129
7 Ga0070714_100045180 3300005435 Bacteria 3732
8 Ga0070713_100000915 3300005436 Bacteria 18867
9 Ga0070713_100007778 3300005436 Bacteria 7551
10 Ga0070713_100026694 3300005436 Bacteria 4538
11 Ga0070711_100034373 3300005439 Bacteria 3381
12 Ga0070705_100054370 3300005440 Bacteria 2348
13 Ga0070705_100107960 3300005440 Bacteria 1772
14 Ga0070708_100105163 3300005445 Bacteria 2589
15 Ga0070662_100011270 3300005457 Bacteria 5894
16 Ga0070681_10019850 3300005458 Bacteria 6732
17 Ga0070698_100157313 3300005471 Bacteria 2218
18 Ga0070679_100023645 3300005530 Bacteria 6018
19 Ga0070679_100295430 3300005530 Bacteria 1571
20 Ga0070697_100163005 3300005536 Bacteria 1884
21 Ga0070704_100264970 3300005549 Bacteria 1417
22 Ga0068855_100000047 3300005563 Bacteria 145355
23 Ga0068852_100089591 3300005616 Bacteria 2750
24 Ga0068860_100133119 3300005843 Bacteria 2387
25 Ga0068860_100353684 3300005843 Bacteria 1446
26 Ga0068862_100024359 3300005844 Bacteria 5078
27 Ga0068862_100054353 3300005844 Bacteria 3429
28 Ga0081455_10004394 3300005937 Bacteria 15850
29 Ga0081455_10006358 3300005937 Bacteria 12681
30 Ga0081455_10008772 3300005937 Bacteria 10466
31 Ga0081455_10010078 3300005937 Bacteria 9643
32 Ga0081455_10213915 3300005937 Bacteria 1434
33 Ga0081538_10006333 3300005981 Bacteria 10450
34 Ga0081538_10009232 3300005981 Bacteria 8259
35 Ga0081538_10015211 3300005981 Bacteria 5970
36 Ga0081540_1019615 3300005983 Unclassified 4100
37 Ga0081539_10002310 3300005985 Bacteria 27502
38 Ga0070717_10030351 3300006028 Bacteria 4342
39 Ga0070717_10051742 3300006028 Bacteria 3381
40 Ga0070716_100047834 3300006173 Bacteria 2414
41 Ga0070712_100020051 3300006175 Bacteria 4370
42 Ga0075366_10062352 3300006195 Bacteria 2216
43 Ga0075430_100057847 3300006846 Bacteria 3260
44 Ga0075431_100036535 3300006847 Bacteria 5059
45 Ga0075434_100216534 3300006871 Bacteria 1935
46 Ga0075434_100333589 3300006871 Unclassified 1537
47 Ga0075436_100001074 3300006914 Bacteria 18389
48 Ga0075436_100099341 3300006914 Bacteria 2026
49 Ga0099794_10003469 3300007265 Bacteria 6022
50 Ga0099794_10026377 3300007265 Bacteria 2686
51 Ga0099795_10006808 3300007788 Bacteria 3142
52 Ga0105240_10000647 3300009093 Bacteria 64299
53 Ga0105240_10016811 3300009093 Bacteria 9892
54 Ga0105240_10192309 3300009093 Bacteria 2398
55 Ga0111539_10065238 3300009094 Bacteria 4304
56 Ga0114129_10180070 3300009147 Bacteria 2877
57 Ga0099796_10004420 3300010159 Bacteria 3399
58 Ga0105239_10005347 3300010375 Bacteria 15068
59 Ga0157370_10030387 3300013104 Bacteria 5294
60 Ga0157370_10074060 3300013104 Bacteria 3212
61 Ga0157369_10003090 3300013105 Bacteria 19898
62 Ga0157369_10003437 3300013105 Bacteria 18775
63 Ga0157369_10139483 3300013105 Bacteria 2566
64 Ga0157369_10142044 3300013105 Bacteria 2540
65 Ga0157374_10099020 3300013296 Bacteria 2792
66 Ga0163163_10059762 3300014325 Bacteria 3772
67 Ga0182008_10037858 3300014497 Bacteria 2413
68 Ga0213872_10044213 3300021361 Bacteria 2028
69 Ga0228598_1008489 3300024227 Bacteria 2073
70 Ga0207692_10029439 3300025898 Bacteria 2610
71 Ga0207699_10036185 3300025906 Plasmid 2813
72 Ga0207699_10063993 3300025906 Unclassified 2224
73 Ga0207707_10045511 3300025912 Bacteria 3824
74 Ga0207707_10131448 3300025912 Bacteria 2189
75 Ga0207695_10000003 3300025913 Bacteria 1368691
76 Ga0207693_10015682 3300025915 Bacteria 6074
77 Ga0207693_10145599 3300025915 Bacteria 1863
78 Ga0207649_10000053 3300025920 Bacteria 104949
79 Ga0207652_10043569 3300025921 Bacteria 3821
80 Ga0207652_10082135 3300025921 Bacteria 2819
81 Ga0207652_10246309 3300025921 Bacteria 1612
82 Ga0207646_10114333 3300025922 Bacteria 2423
83 Ga0207694_10000011 3300025924 Bacteria 417640
84 Ga0207700_10029812 3300025928 Bacteria 3854
85 Ga0207664_10002468 3300025929 Bacteria 12248
86 Ga0207664_10005311 3300025929 Bacteria 8799
87 Ga0207706_10000477 3300025933 Bacteria 42883
88 Ga0207665_10082705 3300025939 Bacteria 2213
89 Ga0207667_10000050 3300025949 Bacteria 234390
90 Ga0207641_10075096 3300026088 Bacteria 2918
91 Ga0207676_10035983 3300026095 Bacteria 3763
92 Ga0207698_10029942 3300026142 Bacteria 3907
93 Ga0209588_1003245 3300027671 Bacteria 4494
94 Ga0207428_10033499 3300027907 Unclassified 4219
95 Ga0268265_10049539 3300028380 Bacteria 3160
96 Ga0268264_10123155 3300028381 Bacteria 2288
97 Ga0265338_10048464 3300028800 Bacteria 3864
98 Ga0307511_10000019 3300030521 Bacteria 117947
99 Ga0265330_10009253 3300031235 Bacteria 4691
100 Ga0265332_10000045 3300031238 Bacteria 113783
101 Ga0265328_10006278 3300031239 Bacteria 5047
102 Ga0265320_10054028 3300031240 Bacteria 1939
103 Ga0265325_10003294 3300031241 Bacteria 10624
104 Ga0265325_10013976 3300031241 Bacteria 4553
105 Ga0265339_10001821 3300031249 Bacteria 15641
106 Ga0265331_10000020 3300031250 Bacteria 258149
107 Ga0265331_10000053 3300031250 Bacteria 180451
108 Ga0265331_10010908 3300031250 Bacteria 4997
109 Ga0265327_10000105 3300031251 Bacteria 185022
110 Ga0265316_10000498 3300031344 Bacteria 44356
111 Ga0265316_10164720 3300031344 Bacteria 1656
112 Ga0265313_10005312 3300031595 Bacteria 9523
113 Ga0265314_10000327 3300031711 Bacteria 67031
114 Ga0265314_10044538 3300031711 Bacteria 3145
115 Ga0265342_10025770 3300031712 Bacteria 3691
116 Ga0265342_10097906 3300031712 Bacteria 1675
117 Ga0373934_0000194 3300035086 Bacteria 22345
118 Ga0373934_0052259 3300035086 Bacteria 1620
119 Ga0373923_0014172 3300035111 Bacteria 2989
120 Ga0373945_0011669 3300035116 Bacteria 2908
121 Ga0373953_0005931 3300035117 Bacteria 3996
122 Ga0373954_0001596 3300035118 Bacteria 9259
123 Ga0373954_0025390 3300035118 Bacteria 2707
124 Ga0373956_0000025 3300035119 Bacteria 47682
125 Ga0373956_0013928 3300035119 Bacteria 3351
126 Ga0373956_0015279 3300035119 Bacteria 3212
127 Ga0373957_0003113 3300035120 Bacteria 4843
128 Ga0373957_0020858 3300035120 Bacteria 2320
129 Ga0373946_0048363 3300035171 Bacteria 1770
130 Ga0373955_0008140 3300035172 Bacteria 4851
131 Ga0373955_0054299 3300035172 Bacteria 2190
132 Ga0373924_0038729 3300035410 Bacteria 1946
133 Ga0373935_0036906 3300035692 Bacteria 3057
134 Ga0373927_0005912 3300035695 Bacteria 8383
135 Ga0373927_0045603 3300035695 Bacteria 2835
136 Ga0373933_0001544 3300035724 Bacteria 13471
137 Ga0373933_0002623 3300035724 Bacteria 10081
138 Ga0373933_0008133 3300035724 Bacteria 5721
139 Ga0373933_0010972 3300035724 Bacteria 4977
140 Ga0373947_0169188 3300035725 Bacteria 1417
141 Ga0373937_0000899 3300036401 Bacteria 25372
142 Ga0373937_0005785 3300036401 Bacteria 10631
143 Ga0373937_0017065 3300036401 Bacteria 6457
144 Ga0373937_0063197 3300036401 Bacteria 3404
145 Ga0373937_0064582 3300036401 Bacteria 3367
146 Ga0373937_0166462 3300036401 Bacteria 2067
147 Ga0373925_0049218 3300037068 Bacteria 3141
148 Ga0373925_0064923 3300037068 Bacteria 2749
149 Ga0373925_0082849 3300037068 Bacteria 2442
150 Ga0373925_0171530 3300037068 Bacteria 1713
151 Ga0395901_0182438 3300038443 Bacteria 2201
152 Ga0436361_0616710 3300039447 Bacteria 2854
153 Ga0436363_1219039 3300039450 Bacteria 1571
154 Ga0450893_0003085 3300042532 Bacteria 2619
155 Ga0466972_0000045 3300044658 Bacteria 129244
156 Ga0495592_0000969 3300046454 Bacteria 19899
157 Ga0495592_0007383 3300046454 Bacteria 8224
158 Ga0495592_0039890 3300046454 Bacteria 3525
159 Ga0495592_0046367 3300046454 Bacteria 3240
160 Ga0495629_0012308 3300046459 Bacteria 6195
161 Ga0495651_0000552 3300046462 Bacteria 28835
162 Ga0495651_0042255 3300046462 Bacteria 3540
163 Ga0495653_0014464 3300046463 Bacteria 6439
164 Ga0495582_0102527 3300046473 Unclassified 1603
165 Ga0495605_0000120 3300046474 Bacteria 102562
166 Ga0495662_0012198 3300046476 Bacteria 4197
167 Ga0495664_0001620 3300046477 Bacteria 11980
168 Ga0495594_0006971 3300046499 Bacteria 5808
169 Ga0495607_0000024 3300046501 Bacteria 159904
170 Ga0495628_0000997 3300046516 Bacteria 25873
171 Ga0495628_0019024 3300046516 Bacteria 5682
172 Ga0495628_0190097 3300046516 Bacteria 1550
173 Ga0495628_0197516 3300046516 Bacteria 1517
174 Ga0495630_0010699 3300046517 Bacteria 6624
175 Ga0495637_0000279 3300046520 Bacteria 40327
176 Ga0495666_0014192 3300046526 Bacteria 3969
177 Ga0495666_0053233 3300046526 Bacteria 1943
178 Ga0495640_0071248 3300046533 Bacteria 2332
179 Ga0495587_0003287 3300046536 Bacteria 10789
180 Ga0495587_0020426 3300046536 Bacteria 4089
181 Ga0495645_0001485 3300046543 Bacteria 15881
182 Ga0495645_0002819 3300046543 Bacteria 11794
183 Ga0495645_0033383 3300046543 Bacteria 3755
184 Ga0495622_0004900 3300046557 Bacteria 6201
185 Ga0495667_0003807 3300046559 Bacteria 10126
186 Ga0495667_0111958 3300046559 Bacteria 1764
187 Ga0495634_0008674 3300046642 Bacteria 7540
188 Ga0495635_0033664 3300046663 Bacteria 3554
189 Ga0495657_0003580 3300046675 Bacteria 12638
190 Ga0495657_0034387 3300046675 Bacteria 3520
191 Ga0495599_0003950 3300046678 Bacteria 8719
192 Ga0495599_0064947 3300046678 Bacteria 2280
193 Ga0495646_0005372 3300046680 Bacteria 8085
194 Ga0495647_0023570 3300046681 Bacteria 2232
195 Ga0495613_0022036 3300046689 Bacteria 4749
196 Ga0495624_0008131 3300046690 Bacteria 7342
197 Ga0495600_0000566 3300046809 Bacteria 19182
198 Ga0495660_0007021 3300046810 Bacteria 6641
199 Ga0495674_0030196 3300047319 Bacteria 4930
200 Ga0495680_0035024 3300047322 Bacteria 4047
201 Ga0495680_0096783 3300047322 Bacteria 2204
202 Ga0495675_0023863 3300047444 Bacteria 3897
203 Ga0495675_0028539 3300047444 Bacteria 3557
204 Ga0495673_0000530 3300047469 Bacteria 39656
205 Ga0495684_0027709 3300047471 Bacteria 4351
206 Ga0495684_0217223 3300047471 Bacteria 1403
207 Ga0495602_0001411 3300048088 Bacteria 23785
208 Ga0496109_0000029 3300048912 Bacteria 164675
209 Ga0496115_0031755 3300048918 Unclassified 4163
210 Ga0495678_000143 3300049459 Bacteria 86601
211 Ga0495682_0001042 3300049460 Bacteria 16326
212 Ga0501070_0072110 3300049586 Bacteria 2859
213 Ga0501072_0146398 3300049588 Bacteria 1883
214 Ga0501072_0299754 3300049588 Bacteria 1278
215 Ga0501075_0091206 3300049591 Unclassified 2313
216 Ga0501077_0025469 3300049593 Bacteria 3758
217 Ga0501080_0095772 3300049742 Bacteria 2756
218 Ga0501035_0138837 3300049822 Bacteria 2114
219 Ga0501045_0063719 3300049824 Bacteria 2706
220 nmdc:mga05p37_14579_c1 3300050507 Bacteria 9439
221 nmdc:mga05p37_225036_c1 3300050507 Bacteria 2262
222 nmdc:mga09592_11082_c1 3300050508 Bacteria 7337
223 nmdc:mga0qj67_45504_c1 3300050509 Bacteria 3464
224 nmdc:mga06r32_295900_c1 3300050510 Bacteria 1605
225 nmdc:mga06r32_46035_c1 3300050510 Bacteria 4161
226 nmdc:mga08y16_128409_c1 3300050511 Bacteria 2637
227 nmdc:mga08y16_198133_c1 3300050511 Bacteria 2081
228 nmdc:mga08x19_88054_c1 3300050514 Bacteria 2046
229 Ga0495601_0000717 3300053077 Bacteria 17792
230 Ga0495601_0019453 3300053077 Bacteria 4140
231 Ga0495601_0037913 3300053077 Unclassified 3013
232 Ga0495601_0079816 3300053077 Bacteria 2098
233 Ga0495612_0003398 3300053078 Bacteria 6596
234 Ga0495595_0024892 3300053084 Bacteria 2646
235 Ga0495595_0038938 3300053084 Bacteria 2168
236 Ga0495619_0054389 3300053085 Bacteria 2649
237 Ga0500646_0000176 3300053090 Bacteria 19079
238 Ga0500566_0033944 3300053094 Bacteria 2971
239 Ga0500655_001480 3300053133 Bacteria 4443
240 Ga0500568_0037991 3300053139 Bacteria 1951
241 Ga0500604_0000318 3300053151 Bacteria 13422
242 Ga0501084_0149389 3300054114 Bacteria 1969
243 Ga0501082_0325655 3300060353 Bacteria 1339
244 Ga0530510_0152809 3300061734 Bacteria 1705
245 2831940718 2831935698 Bacteria 5963223
246 2846542507 2846540461 Bacteria 5471451
247 Ga0114129_10185457
248 JGI25406J46586_10014557
249 Ga0070661_100000164
250 Ga0070709_10024302
251 Ga0070709_10086095
252 Ga0070714_100000587
253 Ga0070714_100045180
254 Ga0070713_100000915
255 Ga0070713_100007778
256 Ga0070713_100026694
257 Ga0070711_100034373
258 Ga0070705_100054370
259 Ga0070705_100107960
260 Ga0070708_100105163
261 Ga0070662_100011270
262 Ga0070681_10019850
263 Ga0070698_100157313
264 Ga0070679_100023645
265 Ga0070679_100295430
266 Ga0070697_100163005
267 Ga0070704_100264970
268 Ga0068855_100000047
269 Ga0068852_100089591
270 Ga0068860_100133119
271 Ga0068860_100353684
272 Ga0068862_100024359
273 Ga0068862_100054353
274 Ga0081455_10004394
275 Ga0081455_10006358
276 Ga0081455_10008772
277 Ga0081455_10010078
278 Ga0081455_10213915
279 Ga0081538_10006333
280 Ga0081538_10009232
281 Ga0081538_10015211
282 Ga0081540_1019615
283 Ga0081539_10002310
284 Ga0070717_10030351
285 Ga0070717_10051742
286 Ga0070716_100047834
287 Ga0070712_100020051
288 Ga0075366_10062352
289 Ga0075430_100057847
290 Ga0075431_100036535
291 Ga0075434_100216534
292 Ga0075434_100333589
293 Ga0075436_100001074
294 Ga0075436_100099341
295 Ga0099794_10003469
296 Ga0099794_10026377
297 Ga0099795_10006808
298 Ga0105240_10000647
299 Ga0105240_10016811
300 Ga0105240_10192309
301 Ga0111539_10065238
302 Ga0114129_10180070
303 Ga0099796_10004420
304 Ga0105239_10005347
305 Ga0157370_10030387
306 Ga0157370_10074060
307 Ga0157369_10003090
308 Ga0157369_10003437
309 Ga0157369_10139483
310 Ga0157369_10142044
311 Ga0157374_10099020
312 Ga0163163_10059762
313 Ga0182008_10037858
314 Ga0213872_10044213
315 Ga0228598_1008489
316 Ga0207692_10029439
317 Ga0207699_10036185
318 Ga0207699_10063993
319 Ga0207707_10045511
320 Ga0207707_10131448
321 Ga0207695_10000003
322 Ga0207693_10015682
323 Ga0207693_10145599
324 Ga0207649_10000053
325 Ga0207652_10043569
326 Ga0207652_10082135
327 Ga0207652_10246309
328 Ga0207646_10114333
329 Ga0207694_10000011
330 Ga0207700_10029812
331 Ga0207664_10002468
332 Ga0207664_10005311
333 Ga0207706_10000477
334 Ga0207665_10082705
335 Ga0207667_10000050
336 Ga0207641_10075096
337 Ga0207676_10035983
338 Ga0207698_10029942
339 Ga0209588_1003245
340 Ga0207428_10033499
341 Ga0268265_10049539
342 Ga0268264_10123155
343 Ga0265338_10048464
344 Ga0307511_10000019
345 Ga0265330_10009253
346 Ga0265332_10000045
347 Ga0265328_10006278
348 Ga0265320_10054028
349 Ga0265325_10003294
350 Ga0265325_10013976
351 Ga0265339_10001821
352 Ga0265331_10000020
353 Ga0265331_10000053
354 Ga0265331_10010908
355 Ga0265327_10000105
356 Ga0265316_10000498
357 Ga0265316_10164720
358 Ga0265313_10005312
359 Ga0265314_10000327
360 Ga0265314_10044538
361 Ga0265342_10025770
362 Ga0265342_10097906
363 Ga0373934_0000194
364 Ga0373934_0052259
365 Ga0373923_0014172
366 Ga0373945_0011669
367 Ga0373953_0005931
368 Ga0373954_0001596
369 Ga0373954_0025390
370 Ga0373956_0000025
371 Ga0373956_0013928
372 Ga0373956_0015279
373 Ga0373957_0003113
374 Ga0373957_0020858
375 Ga0373946_0048363
376 Ga0373955_0008140
377 Ga0373955_0054299
378 Ga0373924_0038729
379 Ga0373935_0036906
380 Ga0373927_0005912
381 Ga0373927_0045603
382 Ga0373933_0001544
383 Ga0373933_0002623
384 Ga0373933_0008133
385 Ga0373933_0010972
386 Ga0373947_0169188
387 Ga0373937_0000899
388 Ga0373937_0005785
389 Ga0373937_0017065
390 Ga0373937_0063197
391 Ga0373937_0064582
392 Ga0373937_0166462
393 Ga0373925_0049218
394 Ga0373925_0064923
395 Ga0373925_0082849
396 Ga0373925_0171530
397 Ga0395901_0182438
398 Ga0436361_0616710
399 Ga0436363_1219039
400 Ga0450893_0003085
401 Ga0466972_0000045
402 Ga0495592_0000969
403 Ga0495592_0007383
404 Ga0495592_0039890
405 Ga0495592_0046367
406 Ga0495629_0012308
407 Ga0495651_0000552
408 Ga0495651_0042255
409 Ga0495653_0014464
410 Ga0495582_0102527
411 Ga0495605_0000120
412 Ga0495662_0012198
413 Ga0495664_0001620
414 Ga0495594_0006971
415 Ga0495607_0000024
416 Ga0495628_0000997
417 Ga0495628_0019024
418 Ga0495628_0190097
419 Ga0495628_0197516
420 Ga0495630_0010699
421 Ga0495637_0000279
422 Ga0495666_0014192
423 Ga0495666_0053233
424 Ga0495640_0071248
425 Ga0495587_0003287
426 Ga0495587_0020426
427 Ga0495645_0001485
428 Ga0495645_0002819
429 Ga0495645_0033383
430 Ga0495622_0004900
431 Ga0495667_0003807
432 Ga0495667_0111958
433 Ga0495634_0008674
434 Ga0495635_0033664
435 Ga0495657_0003580
436 Ga0495657_0034387
437 Ga0495599_0003950
438 Ga0495599_0064947
439 Ga0495646_0005372
440 Ga0495647_0023570
441 Ga0495613_0022036
442 Ga0495624_0008131
443 Ga0495600_0000566
444 Ga0495660_0007021
445 Ga0495674_0030196
446 Ga0495680_0035024
447 Ga0495680_0096783
448 Ga0495675_0023863
449 Ga0495675_0028539
450 Ga0495673_0000530
451 Ga0495684_0027709
452 Ga0495684_0217223
453 Ga0495602_0001411
454 Ga0496109_0000029
455 Ga0496115_0031755
456 Ga0495678_000143
457 Ga0495682_0001042
458 Ga0501070_0072110
459 Ga0501072_0146398
460 Ga0501072_0299754
461 Ga0501075_0091206
462 Ga0501077_0025469
463 Ga0501080_0095772
464 Ga0501035_0138837
465 Ga0501045_0063719
466 nmdc:mga05p37_14579_c1
467 nmdc:mga05p37_225036_c1
468 nmdc:mga09592_11082_c1
469 nmdc:mga0qj67_45504_c1
470 nmdc:mga06r32_295900_c1
471 nmdc:mga06r32_46035_c1
472 nmdc:mga08y16_128409_c1
473 nmdc:mga08y16_198133_c1
474 nmdc:mga08x19_88054_c1
475 Ga0495601_0000717
476 Ga0495601_0019453
477 Ga0495601_0037913
478 Ga0495601_0079816
479 Ga0495612_0003398
480 Ga0495595_0024892
481 Ga0495595_0038938
482 Ga0495619_0054389
483 Ga0500646_0000176
484 Ga0500566_0033944
485 Ga0500655_001480
486 Ga0500568_0037991
487 Ga0500604_0000318
488 Ga0501084_0149389
489 Ga0501082_0325655
490 Ga0530510_0152809
491 2831940718
492 2846542507

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00355

Rieske

Rieske [2Fe-2S] domain

110

198

0.92

PF00848

Ring_hydroxyl_A

Ring hydroxylating alpha subunit (catalytic domain)

253

479

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
7c8z-assembly2.cif.gz_G crystal structure of salicylate 5-hydroxylase naggh (a rieske non-heme iron-dependent monooxgenase) 0.967 14 417
7q05-assembly1.cif.gz_D crystal structure of tpado in complex with tpa 0.9667 12 418
7q04-assembly1.cif.gz_D crystal structure of tpado in a substrate-free state 0.9633 12 419
7q06-assembly1.cif.gz_D crystal structure of tpado in complex with 2-oh-tpa 0.963 9 418
7vju-assembly1.cif.gz_E crystal structure of terephthalate dioxygenase from comamonas testosteroni kf1 0.9618 11 418
ID Description Score Start End Superfamily
2xrxU02 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9646 45 178 2.102.10.10
2xrxU02 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9568 45 178 2.102.10.10
2ckfA02 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9325 45 172 2.102.10.10
2b1xA02 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9295 45 178 2.102.10.10
af_P0ABR7_49_169_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9269 49 179 2.102.10.10
ID Description Score Start End GO Terms
AF-A0A382W5S4-F1-model_v4 Rieske domain-containing protein 0.9836 25 122 GO:0005506
GO:0016491
GO:0051537
AF-A0A2S8QRZ7-F1-model_v4 deleted 0.9715 11 228
AF-A0A7Z9U915-F1-model_v4 Aromatic ring-hydroxylating dioxygenase subunit alpha 0.9708 25 117 GO:0046872
GO:0051213
GO:0051537
AF-A0A0B5DXZ6-F1-model_v4 Aromatic-ring-hydroxylating dioxygenase, alpha subunit 0.97 39 187 GO:0046872
GO:0051213
GO:0051537
AF-A0A3B9BJF5-F1-model_v4 Benzene 1,2-dioxygenase 0.9682 25 127 GO:0005506
GO:0051213
GO:0051537

Map