F358085

General Info

Members Datasets Scaffolds Average Seq Length
246 165 492 389

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100175365|Ga0075434_1001753652
Length 407
Sequence MTRPPFEVAGIVRTAGSRFRQRYWRSLTWPQIKVLNAIARCRTADLGGHRDQCDRCGYQAISFNSCRNRHCPKCQTNAREKWLRRRQQELLPVVYHHLVFSVPHALVPLIWQNKKILFSLLFEATAATLLEVAADPNHLGAEIGFFGILHTWGQTLQQHPHIHCVVPGGGLSPDHTRWISSRSNFFLPVKVLSRVFRGKFTAELRRAFRAKQLAFYGECLPLADEKSFRRFLRTLFQQDWVVYSKPPFGGPDHVLQYLARYTHRVAISNHRIVSVTESEVKFRWRDYANHNKKRTMTLSNEEFLRRFLQHVLPKGFPRIRYFGWLANRKRSRLLSQCRVLLHQPIPPTPSVSDPNVPAAQCPQCHQPMRLIERFTAEELNTAERKESICNDSVRPSHYRAVATLDTS

Samples

Sample ID Description Type Environment
1 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
69 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
70 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
71 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
72 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
73 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
74 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
75 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
114 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
116 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
117 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
118 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
119 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
120 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
121 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
122 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
125 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
126 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
127 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
128 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
129 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
130 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
131 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
132 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
133 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
134 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
135 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
136 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
137 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
138 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
139 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
140 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
141 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
142 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
143 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
144 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
145 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
146 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
147 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
148 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
149 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
150 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
151 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
154 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
161 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
162 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
163 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
164 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
165 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0.41
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.07
Rhizosphere 90.24
Stem 0
Stem Tuber 0
Unclassified 9.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075434_100175365 3300006871 Bacteria 2164
2 JGI24737J22298_10040736 3300001990 Bacteria 1425
3 rootH2_10058748 3300003320 Bacteria 7432
4 JGI25404J52841_10004934 3300003659 Bacteria 2740
5 Ga0065707_10010214 3300005295 Unclassified 2357
6 Ga0070683_100151352 3300005329 Bacteria 2200
7 Ga0070683_100230951 3300005329 Bacteria 1759
8 Ga0070690_100020855 3300005330 Bacteria 3996
9 Ga0070680_100036567 3300005336 Bacteria 3967
10 Ga0070680_100087234 3300005336 Bacteria 2580
11 Ga0070680_100163318 3300005336 Bacteria 1872
12 Ga0070660_100018827 3300005339 Bacteria 5053
13 Ga0070660_100094509 3300005339 Bacteria 2362
14 Ga0070689_100042571 3300005340 Bacteria 3487
15 Ga0070669_100070238 3300005353 Bacteria 2588
16 Ga0070675_100032572 3300005354 Bacteria 4219
17 Ga0070671_100094340 3300005355 Bacteria 2508
18 Ga0070688_100042434 3300005365 Bacteria 2798
19 Ga0070659_100070143 3300005366 Bacteria 2783
20 Ga0070659_100081467 3300005366 Bacteria 2585
21 Ga0070709_10016972 3300005434 Bacteria 4168
22 Ga0070709_10078736 3300005434 Bacteria 2145
23 Ga0070714_100033197 3300005435 Unclassified 4314
24 Ga0070714_100086136 3300005435 Bacteria 2745
25 Ga0070714_100203518 3300005435 Unclassified 1812
26 Ga0070713_100270352 3300005436 Bacteria 1556
27 Ga0070710_10026197 3300005437 Bacteria 3096
28 Ga0070711_100026923 3300005439 Bacteria 3771
29 Ga0070711_100043006 3300005439 Bacteria 3057
30 Ga0070711_100067275 3300005439 Bacteria 2513
31 Ga0070708_100102391 3300005445 Bacteria 2623
32 Ga0070708_100170237 3300005445 Unclassified 2033
33 Ga0070663_100170101 3300005455 Bacteria 1684
34 Ga0070681_10032070 3300005458 Bacteria 5273
35 Ga0070681_10077669 3300005458 Unclassified 3277
36 Ga0070681_10100544 3300005458 Bacteria 2838
37 Ga0070681_10190503 3300005458 Bacteria 1970
38 Ga0068867_100103243 3300005459 Bacteria 2180
39 Ga0070685_10021195 3300005466 Bacteria 3530
40 Ga0070707_100100065 3300005468 Bacteria 2809
41 Ga0070707_100225171 3300005468 Bacteria 1826
42 Ga0070698_100090721 3300005471 Bacteria 3039
43 Ga0070699_100144982 3300005518 Bacteria 2098
44 Ga0070679_100074838 3300005530 Bacteria 3377
45 Ga0070679_100079395 3300005530 Bacteria 3270
46 Ga0070679_100095185 3300005530 Bacteria 2966
47 Ga0070679_100153107 3300005530 Bacteria 2282
48 Ga0070697_100061897 3300005536 Bacteria 3053
49 Ga0070672_100084424 3300005543 Bacteria 2550
50 Ga0070695_100080924 3300005545 Bacteria 2148
51 Ga0070696_100001095 3300005546 Bacteria 17528
52 Ga0070696_100104811 3300005546 Bacteria 2031
53 Ga0070693_100069200 3300005547 Bacteria 2074
54 Ga0070665_100143940 3300005548 Bacteria 2387
55 Ga0068855_100085431 3300005563 Bacteria 3651
56 Ga0068855_100104816 3300005563 Bacteria 3252
57 Ga0070664_100110898 3300005564 Bacteria 2394
58 Ga0068857_100054381 3300005577 Bacteria 3552
59 Ga0068854_100162900 3300005578 Bacteria 1729
60 Ga0068856_100214147 3300005614 Bacteria 1942
61 Ga0068861_100099418 3300005719 Unclassified 2311
62 Ga0068860_100108365 3300005843 Unclassified 2655
63 Ga0068862_100106062 3300005844 Bacteria 2463
64 Ga0081455_10096798 3300005937 Unclassified 2379
65 Ga0070717_10059112 3300006028 Bacteria 3171
66 Ga0070716_100016585 3300006173 Unclassified 3805
67 Ga0070712_100017676 3300006175 Unclassified 4619
68 Ga0075428_100162817 3300006844 Unclassified 2421
69 Ga0075433_10001065 3300006852 Bacteria 19701
70 Ga0075433_10047540 3300006852 Bacteria 3732
71 Ga0075433_10047853 3300006852 Unclassified 3719
72 Ga0075434_100008213 3300006871 Bacteria 9687
73 Ga0075434_100095391 3300006871 Bacteria 2980
74 Ga0075434_100270517 3300006871 Unclassified 1718
75 Ga0075429_100180392 3300006880 Bacteria 1850
76 Ga0075436_100047246 3300006914 Bacteria 2969
77 Ga0075436_100164145 3300006914 Bacteria 1567
78 Ga0075435_100001625 3300007076 Bacteria 14553
79 Ga0075435_100058925 3300007076 Bacteria 3111
80 Ga0075435_100084514 3300007076 Bacteria 2611
81 Ga0075435_100113969 3300007076 Unclassified 2250
82 Ga0099794_10027818 3300007265 Bacteria 2624
83 Ga0105240_10047677 3300009093 Bacteria 5420
84 Ga0114129_10124972 3300009147 Bacteria 3538
85 Ga0114129_10163796 3300009147 Bacteria 3036
86 Ga0114129_10225083 3300009147 Bacteria 2529
87 Ga0114129_10228521 3300009147 Bacteria 2507
88 Ga0105238_10164895 3300009551 Bacteria 2191
89 Ga0099796_10010809 3300010159 Bacteria 2523
90 Ga0105239_10128087 3300010375 Bacteria 2822
91 Ga0105246_10069461 3300011119 Bacteria 2474
92 Ga0157371_10026522 3300013102 Bacteria 4211
93 Ga0157371_10048762 3300013102 Bacteria 3011
94 Ga0157370_10087521 3300013104 Bacteria 2926
95 Ga0157370_10096234 3300013104 Bacteria 2778
96 Ga0157369_10103000 3300013105 Bacteria 3040
97 Ga0157369_10107407 3300013105 Bacteria 2969
98 Ga0157369_10127646 3300013105 Bacteria 2695
99 Ga0157369_10132136 3300013105 Bacteria 2644
100 Ga0157369_10144943 3300013105 Bacteria 2511
101 Ga0157369_10222846 3300013105 Bacteria 1973
102 Ga0163162_10486565 3300013306 Unclassified 1365
103 Ga0157372_10060476 3300013307 Bacteria 4239
104 Ga0157372_10157215 3300013307 Bacteria 2626
105 Ga0157372_10160071 3300013307 Bacteria 2602
106 Ga0157375_10131686 3300013308 Unclassified 2620
107 Ga0157377_10089344 3300014745 Bacteria 1816
108 Ga0157376_10101825 3300014969 Bacteria 2511
109 Ga0157376_10451010 3300014969 Bacteria 1255
110 Ga0213873_10012104 3300021358 Bacteria 1864
111 Ga0213874_10022154 3300021377 Bacteria 1760
112 Ga0213876_10035962 3300021384 Unclassified 2612
113 Ga0213875_10008755 3300021388 Bacteria 5165
114 Ga0213875_10038335 3300021388 Bacteria 2258
115 Ga0224571_100362 3300022734 Bacteria 2427
116 Ga0224572_1004034 3300024225 Bacteria 2524
117 Ga0228598_1005489 3300024227 Bacteria 2650
118 Ga0207682_10053912 3300025893 Bacteria 1669
119 Ga0207692_10098362 3300025898 Bacteria 1601
120 Ga0207647_10030709 3300025904 Bacteria 3464
121 Ga0207685_10015519 3300025905 Bacteria 2415
122 Ga0207699_10017123 3300025906 Bacteria 3806
123 Ga0207699_10099108 3300025906 Bacteria 1845
124 Ga0207643_10135435 3300025908 Bacteria 1468
125 Ga0207707_10043726 3300025912 Bacteria 3905
126 Ga0207707_10105348 3300025912 Bacteria 2465
127 Ga0207707_10111233 3300025912 Bacteria 2394
128 Ga0207707_10170070 3300025912 Bacteria 1905
129 Ga0207695_10039518 3300025913 Bacteria 5071
130 Ga0207693_10070807 3300025915 Bacteria 2729
131 Ga0207663_10105039 3300025916 Bacteria 1905
132 Ga0207660_10052090 3300025917 Bacteria 2913
133 Ga0207660_10060590 3300025917 Bacteria 2722
134 Ga0207660_10101872 3300025917 Bacteria 2146
135 Ga0207662_10054284 3300025918 Bacteria 2389
136 Ga0207657_10061093 3300025919 Bacteria 3233
137 Ga0207652_10066238 3300025921 Bacteria 3130
138 Ga0207652_10084444 3300025921 Plasmid 2781
139 Ga0207652_10100571 3300025921 Bacteria 2552
140 Ga0207646_10088232 3300025922 Bacteria 2775
141 Ga0207646_10194070 3300025922 Bacteria 1834
142 Ga0207681_10036940 3300025923 Bacteria 3225
143 Ga0207694_10150182 3300025924 Bacteria 1877
144 Ga0207659_10034966 3300025926 Bacteria 3470
145 Ga0207700_10039975 3300025928 Bacteria 3419
146 Ga0207700_10138493 3300025928 Bacteria 1996
147 Ga0207664_10058694 3300025929 Bacteria 3062
148 Ga0207664_10066937 3300025929 Bacteria 2881
149 Ga0207664_10175821 3300025929 Bacteria 1835
150 Ga0207690_10049349 3300025932 Bacteria 2805
151 Ga0207690_10088082 3300025932 Bacteria 2186
152 Ga0207706_10042049 3300025933 Bacteria 4049
153 Ga0207665_10017367 3300025939 Unclassified 4729
154 Ga0207691_10102545 3300025940 Bacteria 2552
155 Ga0207661_10212840 3300025944 Bacteria 1704
156 Ga0207679_10015046 3300025945 Bacteria 5101
157 Ga0207667_10003293 3300025949 Bacteria 19935
158 Ga0207667_10047942 3300025949 Bacteria 4519
159 Ga0207667_10137829 3300025949 Bacteria 2512
160 Ga0207640_10140716 3300025981 Bacteria 1758
161 Ga0207703_10085584 3300026035 Bacteria 2638
162 Ga0207678_10139362 3300026067 Bacteria 2070
163 Ga0207678_10188178 3300026067 Bacteria 1764
164 Ga0207708_10060395 3300026075 Bacteria 2893
165 Ga0207702_10069248 3300026078 Bacteria 3033
166 Ga0207702_10235445 3300026078 Bacteria 1713
167 Ga0207674_10072032 3300026116 Bacteria 3472
168 Ga0207675_100095269 3300026118 Unclassified 2800
169 Ga0207698_10117635 3300026142 Bacteria 2243
170 Ga0209588_1010480 3300027671 Bacteria 2786
171 Ga0268266_10103170 3300028379 Bacteria 2516
172 Ga0268265_10111919 3300028380 Bacteria 2231
173 Ga0265338_10151071 3300028800 Bacteria 1804
174 Ga0265770_1007386 3300030878 Bacteria 1546
175 Ga0265325_10028960 3300031241 Bacteria 2980
176 Ga0265325_10045003 3300031241 Bacteria 2295
177 Ga0265340_10029472 3300031247 Bacteria 2756
178 Ga0265339_10073659 3300031249 Bacteria 1815
179 Ga0265316_10102347 3300031344 Bacteria 2176
180 Ga0265316_10164068 3300031344 Bacteria 1660
181 Ga0265313_10030334 3300031595 Bacteria 2785
182 Ga0265313_10053142 3300031595 Bacteria 1929
183 Ga0265314_10057940 3300031711 Bacteria 2656
184 Ga0265342_10053306 3300031712 Bacteria 2407
185 Ga0373933_0043415 3300035724 Bacteria 2660
186 Ga0395900_0112573 3300037418 Bacteria 2794
187 Ga0395898_0279178 3300037466 Unclassified 1593
188 Ga0436364_0187028 3300037853 Bacteria 3000
189 Ga0436364_0197988 3300037853 Bacteria 4252
190 Ga0436364_0534674 3300037853 Bacteria 2699
191 Ga0436364_1446060 3300037853 Bacteria 1624
192 Ga0395901_0122872 3300038443 Bacteria 2728
193 Ga0242420_002454 3300038996 Bacteria 2644
194 Ga0436365_1381019 3300039437 Bacteria 2530
195 Ga0436365_1388815 3300039437 Bacteria 1703
196 Ga0436365_1568332 3300039437 Unclassified 2875
197 Ga0436360_0849308 3300039438 Bacteria 1411
198 Ga0436361_0595965 3300039447 Bacteria 1679
199 Ga0436363_0353170 3300039450 Bacteria 3088
200 Ga0436363_0415468 3300039450 Bacteria 1406
201 Ga0436362_0428390 3300039453 Bacteria 2109
202 Ga0436362_0519449 3300039453 Bacteria 2178
203 Ga0436362_0609824 3300039453 Unclassified 1087
204 Ga0450893_0008244 3300042532 Unclassified 1695
205 Ga0466965_0062431 3300044683 Bacteria 1864
206 Ga0466964_0055017 3300044706 Bacteria 1642
207 Ga0495629_0151666 3300046459 Bacteria 1610
208 Ga0495580_0052416 3300046472 Bacteria 2881
209 Ga0495664_0040853 3300046477 Bacteria 2743
210 Ga0495594_0077529 3300046499 Bacteria 1854
211 Ga0495628_0056884 3300046516 Bacteria 3078
212 Ga0495628_0059727 3300046516 Bacteria 2993
213 Ga0495587_0019668 3300046536 Bacteria 4176
214 Ga0495621_0022949 3300046539 Bacteria 2073
215 Ga0495645_0071841 3300046543 Bacteria 2494
216 Ga0495635_0081638 3300046663 Bacteria 2212
217 Ga0495599_0002897 3300046678 Bacteria 9978
218 Ga0495604_0067807 3300047317 Bacteria 2710
219 Ga0495674_0014040 3300047319 Bacteria 7508
220 Ga0495674_0187107 3300047319 Bacteria 1723
221 Ga0495680_0110065 3300047322 Bacteria 2042
222 Ga0495684_0059813 3300047471 Bacteria 2901
223 Ga0495684_0062414 3300047471 Bacteria 2834
224 Ga0495602_0078090 3300048088 Bacteria 2797
225 Ga0496102_0105337 3300048905 Bacteria 2624
226 Ga0496104_0293864 3300048907 Bacteria 1537
227 Ga0496106_0146291 3300048909 Bacteria 1861
228 Ga0496106_0166402 3300048909 Bacteria 1746
229 Ga0496108_0173617 3300048911 Bacteria 1865
230 Ga0496109_0213842 3300048912 Bacteria 1813
231 Ga0496110_0222588 3300048913 Bacteria 1716
232 Ga0496111_0130860 3300048914 Bacteria 1857
233 Ga0496112_0036121 3300048915 Bacteria 4819
234 Ga0496113_0064174 3300048916 Bacteria 2776
235 nmdc:mga05p37_178370_c1 3300050507 Bacteria 2587
236 nmdc:mga0qj67_223249_c1 3300050509 Bacteria 1529
237 nmdc:mga0n895_292674_c1 3300050512 Unclassified 1651
238 nmdc:mga0n895_55219_c1 3300050512 Bacteria 3909
239 nmdc:mga0n895_7481_c1 3300050512 Bacteria 9377
240 nmdc:mga0rr50_4999_c1 3300050513 Bacteria 7853
241 nmdc:mga0rr50_73716_c1 3300050513 Bacteria 2611
242 nmdc:mga0rr50_79886_c1 3300050513 Bacteria 2520
243 nmdc:mga08x19_56583_c1 3300050514 Bacteria 2532
244 nmdc:mga0a205_113668_c1 3300050515 Bacteria 2606
245 nmdc:mga0a205_41580_c1 3300050515 Bacteria 4427
246 nmdc:mga0a205_818_c1 3300050515 Bacteria 25358
247 Ga0075434_100175365
248 JGI24737J22298_10040736
249 rootH2_10058748
250 JGI25404J52841_10004934
251 Ga0065707_10010214
252 Ga0070683_100151352
253 Ga0070683_100230951
254 Ga0070690_100020855
255 Ga0070680_100036567
256 Ga0070680_100087234
257 Ga0070680_100163318
258 Ga0070660_100018827
259 Ga0070660_100094509
260 Ga0070689_100042571
261 Ga0070669_100070238
262 Ga0070675_100032572
263 Ga0070671_100094340
264 Ga0070688_100042434
265 Ga0070659_100070143
266 Ga0070659_100081467
267 Ga0070709_10016972
268 Ga0070709_10078736
269 Ga0070714_100033197
270 Ga0070714_100086136
271 Ga0070714_100203518
272 Ga0070713_100270352
273 Ga0070710_10026197
274 Ga0070711_100026923
275 Ga0070711_100043006
276 Ga0070711_100067275
277 Ga0070708_100102391
278 Ga0070708_100170237
279 Ga0070663_100170101
280 Ga0070681_10032070
281 Ga0070681_10077669
282 Ga0070681_10100544
283 Ga0070681_10190503
284 Ga0068867_100103243
285 Ga0070685_10021195
286 Ga0070707_100100065
287 Ga0070707_100225171
288 Ga0070698_100090721
289 Ga0070699_100144982
290 Ga0070679_100074838
291 Ga0070679_100079395
292 Ga0070679_100095185
293 Ga0070679_100153107
294 Ga0070697_100061897
295 Ga0070672_100084424
296 Ga0070695_100080924
297 Ga0070696_100001095
298 Ga0070696_100104811
299 Ga0070693_100069200
300 Ga0070665_100143940
301 Ga0068855_100085431
302 Ga0068855_100104816
303 Ga0070664_100110898
304 Ga0068857_100054381
305 Ga0068854_100162900
306 Ga0068856_100214147
307 Ga0068861_100099418
308 Ga0068860_100108365
309 Ga0068862_100106062
310 Ga0081455_10096798
311 Ga0070717_10059112
312 Ga0070716_100016585
313 Ga0070712_100017676
314 Ga0075428_100162817
315 Ga0075433_10001065
316 Ga0075433_10047540
317 Ga0075433_10047853
318 Ga0075434_100008213
319 Ga0075434_100095391
320 Ga0075434_100270517
321 Ga0075429_100180392
322 Ga0075436_100047246
323 Ga0075436_100164145
324 Ga0075435_100001625
325 Ga0075435_100058925
326 Ga0075435_100084514
327 Ga0075435_100113969
328 Ga0099794_10027818
329 Ga0105240_10047677
330 Ga0114129_10124972
331 Ga0114129_10163796
332 Ga0114129_10225083
333 Ga0114129_10228521
334 Ga0105238_10164895
335 Ga0099796_10010809
336 Ga0105239_10128087
337 Ga0105246_10069461
338 Ga0157371_10026522
339 Ga0157371_10048762
340 Ga0157370_10087521
341 Ga0157370_10096234
342 Ga0157369_10103000
343 Ga0157369_10107407
344 Ga0157369_10127646
345 Ga0157369_10132136
346 Ga0157369_10144943
347 Ga0157369_10222846
348 Ga0163162_10486565
349 Ga0157372_10060476
350 Ga0157372_10157215
351 Ga0157372_10160071
352 Ga0157375_10131686
353 Ga0157377_10089344
354 Ga0157376_10101825
355 Ga0157376_10451010
356 Ga0213873_10012104
357 Ga0213874_10022154
358 Ga0213876_10035962
359 Ga0213875_10008755
360 Ga0213875_10038335
361 Ga0224571_100362
362 Ga0224572_1004034
363 Ga0228598_1005489
364 Ga0207682_10053912
365 Ga0207692_10098362
366 Ga0207647_10030709
367 Ga0207685_10015519
368 Ga0207699_10017123
369 Ga0207699_10099108
370 Ga0207643_10135435
371 Ga0207707_10043726
372 Ga0207707_10105348
373 Ga0207707_10111233
374 Ga0207707_10170070
375 Ga0207695_10039518
376 Ga0207693_10070807
377 Ga0207663_10105039
378 Ga0207660_10052090
379 Ga0207660_10060590
380 Ga0207660_10101872
381 Ga0207662_10054284
382 Ga0207657_10061093
383 Ga0207652_10066238
384 Ga0207652_10084444
385 Ga0207652_10100571
386 Ga0207646_10088232
387 Ga0207646_10194070
388 Ga0207681_10036940
389 Ga0207694_10150182
390 Ga0207659_10034966
391 Ga0207700_10039975
392 Ga0207700_10138493
393 Ga0207664_10058694
394 Ga0207664_10066937
395 Ga0207664_10175821
396 Ga0207690_10049349
397 Ga0207690_10088082
398 Ga0207706_10042049
399 Ga0207665_10017367
400 Ga0207691_10102545
401 Ga0207661_10212840
402 Ga0207679_10015046
403 Ga0207667_10003293
404 Ga0207667_10047942
405 Ga0207667_10137829
406 Ga0207640_10140716
407 Ga0207703_10085584
408 Ga0207678_10139362
409 Ga0207678_10188178
410 Ga0207708_10060395
411 Ga0207702_10069248
412 Ga0207702_10235445
413 Ga0207674_10072032
414 Ga0207675_100095269
415 Ga0207698_10117635
416 Ga0209588_1010480
417 Ga0268266_10103170
418 Ga0268265_10111919
419 Ga0265338_10151071
420 Ga0265770_1007386
421 Ga0265325_10028960
422 Ga0265325_10045003
423 Ga0265340_10029472
424 Ga0265339_10073659
425 Ga0265316_10102347
426 Ga0265316_10164068
427 Ga0265313_10030334
428 Ga0265313_10053142
429 Ga0265314_10057940
430 Ga0265342_10053306
431 Ga0373933_0043415
432 Ga0395900_0112573
433 Ga0395898_0279178
434 Ga0436364_0187028
435 Ga0436364_0197988
436 Ga0436364_0534674
437 Ga0436364_1446060
438 Ga0395901_0122872
439 Ga0242420_002454
440 Ga0436365_1381019
441 Ga0436365_1388815
442 Ga0436365_1568332
443 Ga0436360_0849308
444 Ga0436361_0595965
445 Ga0436363_0353170
446 Ga0436363_0415468
447 Ga0436362_0428390
448 Ga0436362_0519449
449 Ga0436362_0609824
450 Ga0450893_0008244
451 Ga0466965_0062431
452 Ga0466964_0055017
453 Ga0495629_0151666
454 Ga0495580_0052416
455 Ga0495664_0040853
456 Ga0495594_0077529
457 Ga0495628_0056884
458 Ga0495628_0059727
459 Ga0495587_0019668
460 Ga0495621_0022949
461 Ga0495645_0071841
462 Ga0495635_0081638
463 Ga0495599_0002897
464 Ga0495604_0067807
465 Ga0495674_0014040
466 Ga0495674_0187107
467 Ga0495680_0110065
468 Ga0495684_0059813
469 Ga0495684_0062414
470 Ga0495602_0078090
471 Ga0496102_0105337
472 Ga0496104_0293864
473 Ga0496106_0146291
474 Ga0496106_0166402
475 Ga0496108_0173617
476 Ga0496109_0213842
477 Ga0496110_0222588
478 Ga0496111_0130860
479 Ga0496112_0036121
480 Ga0496113_0064174
481 nmdc:mga05p37_178370_c1
482 nmdc:mga0qj67_223249_c1
483 nmdc:mga0n895_292674_c1
484 nmdc:mga0n895_55219_c1
485 nmdc:mga0n895_7481_c1
486 nmdc:mga0rr50_4999_c1
487 nmdc:mga0rr50_73716_c1
488 nmdc:mga0rr50_79886_c1
489 nmdc:mga08x19_56583_c1
490 nmdc:mga0a205_113668_c1
491 nmdc:mga0a205_41580_c1
492 nmdc:mga0a205_818_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04986

Y2_Tnp

Putative transposase

144

332

0.97

PF14319

Zn_Tnp_IS91

Transposase zinc-binding domain

11

102

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5yjw-assembly1.cif.gz_A-2 structure of the ndi1 protein from saccharomyces cerevisiae in complex with the competitive inhibitor, stigmatellin. 0.8122 270 299
5d74-assembly1.cif.gz_A the crystal structure of ly7917 0.7693 270 305
6b7k-assembly4.cif.gz_D gh43 endo-arabinanase from bacillus licheniformis 0.7692 271 299
5d76-assembly2.cif.gz_B the crystal structure of ly7917 with the hydrolyzing product of mdp 0.7671 270 305
2lc4-assembly1.cif.gz_A solution structure of pilp from pseudomonas aeruginosa 0.7298 268 299
ID Description Score Start End Superfamily
af_O80902_13_109_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.87 272 297 3.30.200.20
2ivwA01 Mainly Beta;Roll;SH3 type barrels.; 0.7801 270 299 2.30.30.830
af_Q9C694_2_136_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.7379 270 299 2.120.10.80
2lc4A00 Mainly Beta;Roll;SH3 type barrels.; 0.7298 268 299 2.30.30.830
af_Q08BY6_63_124_2.30.30.40 Mainly Beta;Roll;SH3 type barrels.;SH3 Domains 0.7206 270 299 2.30.30.40
ID Description Score Start End GO Terms
AF-A0A530H9H4-F1-model_v4 IS91 family transposase 0.9628 100 264 GO:0003677
GO:0004803
GO:0006313
AF-A0A5E4YGA2-F1-model_v4 Transposase 0.9589 84 257 GO:0003677
GO:0004803
GO:0006313
AF-A0A1G7XDM3-F1-model_v4 Putative transposase 0.9567 101 224 GO:0003677
GO:0004803
GO:0006313
AF-A0A1J5D6K9-F1-model_v4 Transposase 0.9566 109 202 GO:0003677
GO:0004803
GO:0006313
AF-A0A1I1SV20-F1-model_v4 Putative transposase 0.954 109 215 GO:0003677
GO:0004803
GO:0006313

Map