F358063

General Info

Members Datasets Scaffolds Average Seq Length
246 161 492 92

Family's Representative Sequence

Representative Sequence 3300006051|Ga0075364_10062472|Ga0075364_100624723
Length 97
Sequence MHMPVRDMIVAKLSAKFAPTHLEVIDESSRHQGHAGSRPEGETHFRVRIASAALSGSRVAQHRSIMDALADEIKGGVHALAIEVLRAGSPQVDDINS

Samples

Sample ID Description Type Environment
1 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
97 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
100 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
101 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
102 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
106 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
107 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
108 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
109 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
110 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
111 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
112 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
113 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
114 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
119 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
120 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
121 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
122 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
123 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
124 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
125 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
126 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
127 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
128 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
129 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
130 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
131 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
132 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
133 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
134 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
135 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
136 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
142 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
143 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
144 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
145 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
146 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
147 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
148 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
149 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
150 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
151 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
152 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
153 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
154 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
155 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
156 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
157 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
158 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
159 2643221580 Devosia sp. Root635 Isolate Unclassified
160 2643221674 Devosia sp. Root436 Isolate Unclassified
161 2932401849 Devosia sp. 2618 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.78
Metatranscriptomes 0
Isolates 1.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.01
Nodule 0
Rhizoplane 1.22
Rhizosphere 79.67
Stem 0
Stem Tuber 0
Unclassified 17.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075364_10062472 3300006051 Bacteria 2444
2 JGI24737J22298_10054262 3300001990 Bacteria 1213
3 rootH1_10128748 3300003316 Bacteria 1126
4 Ga0065704_10399694 3300005289 Bacteria 753
5 Ga0070658_10020427 3300005327 Bacteria 5308
6 Ga0070658_10046432 3300005327 Bacteria 3514
7 Ga0070676_10222621 3300005328 Bacteria 1247
8 Ga0070676_11608929 3300005328 Unclassified 502
9 Ga0070683_100319322 3300005329 Bacteria 1478
10 Ga0068869_101276773 3300005334 Unclassified 647
11 Ga0070666_10275552 3300005335 Bacteria 1195
12 Ga0068868_100134330 3300005338 Bacteria 2027
13 Ga0070660_100016693 3300005339 Bacteria 5336
14 Ga0070660_100020328 3300005339 Bacteria 4878
15 Ga0070661_100005002 3300005344 Bacteria 9133
16 Ga0070661_100132253 3300005344 Bacteria 1875
17 Ga0070668_100005236 3300005347 Bacteria 9624
18 Ga0070675_101182105 3300005354 Bacteria 704
19 Ga0070674_100012075 3300005356 Bacteria 5292
20 Ga0070673_100538391 3300005364 Bacteria 1060
21 Ga0070659_100042556 3300005366 Bacteria 3551
22 Ga0070659_100091412 3300005366 Bacteria 2439
23 Ga0070659_100227833 3300005366 Bacteria 1540
24 Ga0070663_100155761 3300005455 Bacteria 1755
25 Ga0070663_100281857 3300005455 Bacteria 1324
26 Ga0070678_100008968 3300005456 Bacteria 6025
27 Ga0070678_100271786 3300005456 Bacteria 1430
28 Ga0070662_100322338 3300005457 Unclassified 1260
29 Ga0070681_10478500 3300005458 Bacteria 1158
30 Ga0068867_100150433 3300005459 Bacteria 1828
31 Ga0070679_100593408 3300005530 Bacteria 1051
32 Ga0070679_101215163 3300005530 Unclassified 699
33 Ga0070684_100039520 3300005535 Bacteria 4058
34 Ga0068853_100041305 3300005539 Bacteria 3938
35 Ga0068853_100466032 3300005539 Bacteria 1190
36 Ga0068853_100795133 3300005539 Bacteria 906
37 Ga0070672_100044228 3300005543 Bacteria 3438
38 Ga0070665_100280247 3300005548 Bacteria 1669
39 Ga0068855_100115194 3300005563 Bacteria 3082
40 Ga0068855_100346707 3300005563 Bacteria 1636
41 Ga0068855_101440448 3300005563 Bacteria 709
42 Ga0070664_100219517 3300005564 Bacteria 1701
43 Ga0068857_100017588 3300005577 Bacteria 6268
44 Ga0068857_100289825 3300005577 Bacteria 1507
45 Ga0068854_100110632 3300005578 Bacteria 2072
46 Ga0068854_101379093 3300005578 Unclassified 637
47 Ga0068856_100006979 3300005614 Bacteria 11034
48 Ga0068856_100046261 3300005614 Bacteria 4286
49 Ga0068856_100333829 3300005614 Unclassified 1534
50 Ga0068852_100043048 3300005616 Bacteria 3827
51 Ga0068852_100059464 3300005616 Bacteria 3314
52 Ga0068852_100113825 3300005616 Bacteria 2464
53 Ga0068861_101879413 3300005719 Unclassified 595
54 Ga0068863_101321070 3300005841 Bacteria 728
55 Ga0075365_10378166 3300006038 Unclassified 999
56 Ga0075368_10085691 3300006042 Unclassified 1285
57 Ga0075363_100002761 3300006048 Bacteria 7274
58 Ga0075363_100064294 3300006048 Bacteria 1982
59 Ga0075364_10317098 3300006051 Unclassified 1061
60 Ga0075362_10008506 3300006177 Bacteria 3927
61 Ga0075362_10116470 3300006177 Bacteria 1262
62 Ga0075367_10003385 3300006178 Bacteria 7593
63 Ga0075367_10132849 3300006178 Bacteria 1539
64 Ga0075367_10801637 3300006178 Bacteria 600
65 Ga0075369_10095979 3300006186 Bacteria 1327
66 Ga0075366_10261960 3300006195 Unclassified 1055
67 Ga0097621_100534523 3300006237 Bacteria 1066
68 Ga0075370_10012944 3300006353 Bacteria 4422
69 Ga0075370_10042924 3300006353 Bacteria 2555
70 Ga0068865_100248854 3300006881 Bacteria 1402
71 Ga0105240_10060888 3300009093 Bacteria 4705
72 Ga0105240_12332194 3300009093 Bacteria 554
73 Ga0105245_10786614 3300009098 Unclassified 989
74 Ga0105245_11188096 3300009098 Bacteria 810
75 Ga0105241_10018991 3300009174 Bacteria 5066
76 Ga0105241_10168570 3300009174 Bacteria 1807
77 Ga0105242_11361744 3300009176 Bacteria 736
78 Ga0105237_10435684 3300009545 Bacteria 1316
79 Ga0105237_10467777 3300009545 Bacteria 1267
80 Ga0105237_12536732 3300009545 Unclassified 523
81 Ga0105238_10006164 3300009551 Bacteria 11903
82 Ga0105238_10098466 3300009551 Bacteria 2908
83 Ga0105238_12123660 3300009551 Bacteria 596
84 Ga0105239_10041007 3300010375 Bacteria 5073
85 Ga0105239_10134176 3300010375 Bacteria 2755
86 Ga0105239_10506593 3300010375 Bacteria 1372
87 Ga0105239_10637949 3300010375 Bacteria 1216
88 Ga0105239_11855906 3300010375 Unclassified 699
89 Ga0105246_10715144 3300011119 Unclassified 879
90 Ga0105246_11706870 3300011119 Bacteria 599
91 Ga0157373_11052868 3300013100 Unclassified 609
92 Ga0157373_11306822 3300013100 Unclassified 549
93 Ga0157371_10004135 3300013102 Bacteria 12798
94 Ga0157371_10034124 3300013102 Bacteria 3652
95 Ga0157371_10267667 3300013102 Bacteria 1233
96 Ga0157370_10009617 3300013104 Bacteria 10290
97 Ga0157370_10032128 3300013104 Bacteria 5128
98 Ga0157369_10135355 3300013105 Bacteria 2609
99 Ga0157374_10118721 3300013296 Bacteria 2550
100 Ga0157378_11545332 3300013297 Unclassified 709
101 Ga0157372_10020384 3300013307 Bacteria 7151
102 Ga0157372_10158481 3300013307 Bacteria 2615
103 Ga0157372_10456586 3300013307 Bacteria 1489
104 Ga0157375_11674109 3300013308 Bacteria 753
105 Ga0163163_10287965 3300014325 Bacteria 1695
106 Ga0157376_10888472 3300014969 Bacteria 908
107 Ga0207656_10251957 3300025321 Bacteria 865
108 Ga0207642_10076163 3300025899 Unclassified 1614
109 Ga0207680_10360660 3300025903 Bacteria 1022
110 Ga0207645_10026516 3300025907 Bacteria 3744
111 Ga0207705_10011023 3300025909 Bacteria 6559
112 Ga0207705_10069865 3300025909 Bacteria 2544
113 Ga0207654_10224147 3300025911 Bacteria 1249
114 Ga0207695_10029474 3300025913 Bacteria 6063
115 Ga0207657_10007541 3300025919 Bacteria 11151
116 Ga0207649_10016564 3300025920 Bacteria 4160
117 Ga0207649_10139051 3300025920 Bacteria 1659
118 Ga0207694_10093542 3300025924 Bacteria 2374
119 Ga0207694_10125479 3300025924 Bacteria 2053
120 Ga0207659_10038253 3300025926 Bacteria 3336
121 Ga0207687_10227424 3300025927 Bacteria 1472
122 Ga0207690_10302814 3300025932 Unclassified 1251
123 Ga0207690_10772286 3300025932 Bacteria 793
124 Ga0207704_10202006 3300025938 Bacteria 1456
125 Ga0207691_10030775 3300025940 Bacteria 5013
126 Ga0207661_11893619 3300025944 Bacteria 542
127 Ga0207679_10518977 3300025945 Bacteria 1065
128 Ga0207667_10008034 3300025949 Bacteria 12586
129 Ga0207667_10377650 3300025949 Bacteria 1444
130 Ga0207667_10455925 3300025949 Bacteria 1299
131 Ga0207651_10371267 3300025960 Unclassified 1210
132 Ga0207668_10010438 3300025972 Bacteria 5610
133 Ga0207640_10055764 3300025981 Bacteria 2590
134 Ga0207640_10252317 3300025981 Bacteria 1370
135 Ga0207677_10275590 3300026023 Bacteria 1378
136 Ga0207639_10155072 3300026041 Bacteria 1923
137 Ga0207639_10310719 3300026041 Bacteria 1396
138 Ga0207639_10502806 3300026041 Bacteria 1108
139 Ga0207678_10035720 3300026067 Bacteria 4327
140 Ga0207678_10104092 3300026067 Bacteria 2422
141 Ga0207702_10044883 3300026078 Bacteria 3716
142 Ga0207702_10323420 3300026078 Bacteria 1469
143 Ga0207702_10398252 3300026078 Bacteria 1327
144 Ga0207641_10272803 3300026088 Bacteria 1588
145 Ga0207648_10062320 3300026089 Bacteria 3251
146 Ga0207648_11062374 3300026089 Unclassified 759
147 Ga0207674_10002066 3300026116 Bacteria 25473
148 Ga0207674_10289664 3300026116 Bacteria 1586
149 Ga0207675_100069539 3300026118 Bacteria 3290
150 Ga0207683_10037940 3300026121 Bacteria 4197
151 Ga0207683_10273778 3300026121 Bacteria 1542
152 Ga0207698_10123388 3300026142 Bacteria 2197
153 Ga0207698_10238578 3300026142 Bacteria 1655
154 Ga0209983_1006041 3300027665 Bacteria 2494
155 Ga0209813_10047726 3300027866 Unclassified 1327
156 Ga0209974_10059818 3300027876 Unclassified 1289
157 Ga0209974_10085099 3300027876 Bacteria 1092
158 Ga0268266_10346490 3300028379 Bacteria 1395
159 Ga0307405_10391194 3300031731 Bacteria 1085
160 Ga0307405_10653173 3300031731 Unclassified 865
161 Ga0307413_10595813 3300031824 Bacteria 904
162 Ga0307413_10769321 3300031824 Bacteria 806
163 Ga0307413_11288825 3300031824 Bacteria 639
164 Ga0307410_10914811 3300031852 Bacteria 752
165 Ga0307412_10368039 3300031911 Bacteria 1160
166 Ga0307412_10714991 3300031911 Bacteria 861
167 Ga0307412_10862226 3300031911 Bacteria 791
168 Ga0307409_100217573 3300031995 Bacteria 1722
169 Ga0307409_100685588 3300031995 Bacteria 1022
170 Ga0307416_101929892 3300032002 Unclassified 694
171 Ga0307416_102876319 3300032002 Bacteria 576
172 Ga0307414_10160060 3300032004 Bacteria 1787
173 Ga0307414_10336901 3300032004 Bacteria 1290
174 Ga0307414_10926855 3300032004 Bacteria 799
175 Ga0307414_11231345 3300032004 Bacteria 693
176 Ga0307411_10298958 3300032005 Bacteria 1290
177 Ga0307411_10625950 3300032005 Bacteria 928
178 Ga0307411_10970994 3300032005 Bacteria 759
179 Ga0373928_0006188 3300035084 Bacteria 2299
180 Ga0373949_0025240 3300035090 Bacteria 1386
181 Ga0373932_0067984 3300035112 Bacteria 1098
182 Ga0373939_0019085 3300035114 Bacteria 1846
183 Ga0373941_0051931 3300035115 Bacteria 1306
184 Ga0373960_0009592 3300035121 Bacteria 2349
185 Ga0373942_0012127 3300035207 Bacteria 2053
186 Ga0373925_0489907 3300037068 Bacteria 1009
187 Ga0395899_0063176 3300037312 Bacteria 2724
188 Ga0395905_1011428 3300037471 Unclassified 734
189 Ga0395901_0172428 3300038443 Bacteria 2269
190 Ga0395901_1058251 3300038443 Archaea 784
191 Ga0451789_0989073 3300041443 Unclassified 757
192 Ga0451797_0068843 3300041453 Bacteria 663
193 Ga0451797_0846574 3300041453 Bacteria 526
194 Ga0451837_0550334 3300041494 Unclassified 733
195 Ga0451837_0901530 3300041494 Bacteria 508
196 Ga0451841_1185178 3300041498 Bacteria 521
197 Ga0451849_0620230 3300041505 Bacteria 850
198 Ga0451843_1661295 3300041509 Bacteria 677
199 Ga0439445_0056327 3300042004 Bacteria 1069
200 Ga0439445_0129850 3300042004 Bacteria 727
201 Ga0466971_0529290 3300044719 Unclassified 584
202 Ga0466957_0248731 3300044842 Bacteria 1182
203 Ga0495649_0168729 3300046694 Bacteria 1146
204 Ga0495686_0014589 3300047472 Bacteria 5404
205 Ga0496117_0324103 3300048920 Bacteria 806
206 Ga0496119_0088518 3300048922 Bacteria 1765
207 Ga0496120_0295521 3300048923 Bacteria 744
208 Ga0496121_0064483 3300048924 Bacteria 2987
209 Ga0496124_0736649 3300048927 Unclassified 620
210 Ga0496125_0423039 3300048928 Bacteria 771
211 Ga0496126_0789040 3300048929 Bacteria 730
212 Ga0501031_0129411 3300049568 Bacteria 1649
213 Ga0501034_0017104 3300049571 Bacteria 7438
214 Ga0501034_0063085 3300049571 Bacteria 3719
215 Ga0501034_0068804 3300049571 Bacteria 3551
216 Ga0501034_0194294 3300049571 Bacteria 1990
217 Ga0501034_0252510 3300049571 Bacteria 1708
218 Ga0501034_0381490 3300049571 Bacteria 1334
219 Ga0501034_1133091 3300049571 Unclassified 662
220 Ga0501036_0633181 3300049572 Bacteria 886
221 Ga0501037_0110413 3300049573 Bacteria 1981
222 Ga0501039_0054514 3300049575 Bacteria 3095
223 Ga0501071_1574710 3300049587 Bacteria 507
224 Ga0501073_0228615 3300049589 Bacteria 1285
225 Ga0501079_0695340 3300049741 Unclassified 800
226 Ga0501080_0546225 3300049742 Bacteria 1032
227 nmdc:mga03683_7122_c1 3300050489 Bacteria 3867
228 nmdc:mga03n38_207450_c1 3300050490 Unclassified 1017
229 nmdc:mga03n38_22617_c1 3300050490 Bacteria 2547
230 nmdc:mga00v17_55177_c1 3300050491 Bacteria 1701
231 nmdc:mga00v17_563866_c1 3300050491 Unclassified 736
232 nmdc:mga0yw44_203372_c1 3300050492 Unclassified 1308
233 nmdc:mga0k408_62718_c1 3300050493 Bacteria 2162
234 nmdc:mga06z11_333123_c1 3300050494 Unclassified 907
235 nmdc:mga04h51_47468_c1 3300050495 Unclassified 1427
236 nmdc:mga07m45_176079_c1 3300050496 Unclassified 1244
237 nmdc:mga07m45_83453_c1 3300050496 Bacteria 1427
238 nmdc:mga0sz30_329706_c1 3300050516 Unclassified 682
239 Ga0500559_0478048 3300053136 Unclassified 574
240 Ga0500573_0332725 3300053140 Bacteria 745
241 Ga0500604_0002782 3300053151 Bacteria 4753
242 Ga0500634_0000017 3300053161 Bacteria 111983
243 Ga0501082_1205947 3300060353 Unclassified 661
244 2643911640 2643221580 Bacteria 3816678
245 2644413069 2643221674 Bacteria 3919126
246 2932406087 2932401849 Bacteria 4262978
247 Ga0075364_10062472
248 JGI24737J22298_10054262
249 rootH1_10128748
250 Ga0065704_10399694
251 Ga0070658_10020427
252 Ga0070658_10046432
253 Ga0070676_10222621
254 Ga0070676_11608929
255 Ga0070683_100319322
256 Ga0068869_101276773
257 Ga0070666_10275552
258 Ga0068868_100134330
259 Ga0070660_100016693
260 Ga0070660_100020328
261 Ga0070661_100005002
262 Ga0070661_100132253
263 Ga0070668_100005236
264 Ga0070675_101182105
265 Ga0070674_100012075
266 Ga0070673_100538391
267 Ga0070659_100042556
268 Ga0070659_100091412
269 Ga0070659_100227833
270 Ga0070663_100155761
271 Ga0070663_100281857
272 Ga0070678_100008968
273 Ga0070678_100271786
274 Ga0070662_100322338
275 Ga0070681_10478500
276 Ga0068867_100150433
277 Ga0070679_100593408
278 Ga0070679_101215163
279 Ga0070684_100039520
280 Ga0068853_100041305
281 Ga0068853_100466032
282 Ga0068853_100795133
283 Ga0070672_100044228
284 Ga0070665_100280247
285 Ga0068855_100115194
286 Ga0068855_100346707
287 Ga0068855_101440448
288 Ga0070664_100219517
289 Ga0068857_100017588
290 Ga0068857_100289825
291 Ga0068854_100110632
292 Ga0068854_101379093
293 Ga0068856_100006979
294 Ga0068856_100046261
295 Ga0068856_100333829
296 Ga0068852_100043048
297 Ga0068852_100059464
298 Ga0068852_100113825
299 Ga0068861_101879413
300 Ga0068863_101321070
301 Ga0075365_10378166
302 Ga0075368_10085691
303 Ga0075363_100002761
304 Ga0075363_100064294
305 Ga0075364_10317098
306 Ga0075362_10008506
307 Ga0075362_10116470
308 Ga0075367_10003385
309 Ga0075367_10132849
310 Ga0075367_10801637
311 Ga0075369_10095979
312 Ga0075366_10261960
313 Ga0097621_100534523
314 Ga0075370_10012944
315 Ga0075370_10042924
316 Ga0068865_100248854
317 Ga0105240_10060888
318 Ga0105240_12332194
319 Ga0105245_10786614
320 Ga0105245_11188096
321 Ga0105241_10018991
322 Ga0105241_10168570
323 Ga0105242_11361744
324 Ga0105237_10435684
325 Ga0105237_10467777
326 Ga0105237_12536732
327 Ga0105238_10006164
328 Ga0105238_10098466
329 Ga0105238_12123660
330 Ga0105239_10041007
331 Ga0105239_10134176
332 Ga0105239_10506593
333 Ga0105239_10637949
334 Ga0105239_11855906
335 Ga0105246_10715144
336 Ga0105246_11706870
337 Ga0157373_11052868
338 Ga0157373_11306822
339 Ga0157371_10004135
340 Ga0157371_10034124
341 Ga0157371_10267667
342 Ga0157370_10009617
343 Ga0157370_10032128
344 Ga0157369_10135355
345 Ga0157374_10118721
346 Ga0157378_11545332
347 Ga0157372_10020384
348 Ga0157372_10158481
349 Ga0157372_10456586
350 Ga0157375_11674109
351 Ga0163163_10287965
352 Ga0157376_10888472
353 Ga0207656_10251957
354 Ga0207642_10076163
355 Ga0207680_10360660
356 Ga0207645_10026516
357 Ga0207705_10011023
358 Ga0207705_10069865
359 Ga0207654_10224147
360 Ga0207695_10029474
361 Ga0207657_10007541
362 Ga0207649_10016564
363 Ga0207649_10139051
364 Ga0207694_10093542
365 Ga0207694_10125479
366 Ga0207659_10038253
367 Ga0207687_10227424
368 Ga0207690_10302814
369 Ga0207690_10772286
370 Ga0207704_10202006
371 Ga0207691_10030775
372 Ga0207661_11893619
373 Ga0207679_10518977
374 Ga0207667_10008034
375 Ga0207667_10377650
376 Ga0207667_10455925
377 Ga0207651_10371267
378 Ga0207668_10010438
379 Ga0207640_10055764
380 Ga0207640_10252317
381 Ga0207677_10275590
382 Ga0207639_10155072
383 Ga0207639_10310719
384 Ga0207639_10502806
385 Ga0207678_10035720
386 Ga0207678_10104092
387 Ga0207702_10044883
388 Ga0207702_10323420
389 Ga0207702_10398252
390 Ga0207641_10272803
391 Ga0207648_10062320
392 Ga0207648_11062374
393 Ga0207674_10002066
394 Ga0207674_10289664
395 Ga0207675_100069539
396 Ga0207683_10037940
397 Ga0207683_10273778
398 Ga0207698_10123388
399 Ga0207698_10238578
400 Ga0209983_1006041
401 Ga0209813_10047726
402 Ga0209974_10059818
403 Ga0209974_10085099
404 Ga0268266_10346490
405 Ga0307405_10391194
406 Ga0307405_10653173
407 Ga0307413_10595813
408 Ga0307413_10769321
409 Ga0307413_11288825
410 Ga0307410_10914811
411 Ga0307412_10368039
412 Ga0307412_10714991
413 Ga0307412_10862226
414 Ga0307409_100217573
415 Ga0307409_100685588
416 Ga0307416_101929892
417 Ga0307416_102876319
418 Ga0307414_10160060
419 Ga0307414_10336901
420 Ga0307414_10926855
421 Ga0307414_11231345
422 Ga0307411_10298958
423 Ga0307411_10625950
424 Ga0307411_10970994
425 Ga0373928_0006188
426 Ga0373949_0025240
427 Ga0373932_0067984
428 Ga0373939_0019085
429 Ga0373941_0051931
430 Ga0373960_0009592
431 Ga0373942_0012127
432 Ga0373925_0489907
433 Ga0395899_0063176
434 Ga0395905_1011428
435 Ga0395901_0172428
436 Ga0395901_1058251
437 Ga0451789_0989073
438 Ga0451797_0068843
439 Ga0451797_0846574
440 Ga0451837_0550334
441 Ga0451837_0901530
442 Ga0451841_1185178
443 Ga0451849_0620230
444 Ga0451843_1661295
445 Ga0439445_0056327
446 Ga0439445_0129850
447 Ga0466971_0529290
448 Ga0466957_0248731
449 Ga0495649_0168729
450 Ga0495686_0014589
451 Ga0496117_0324103
452 Ga0496119_0088518
453 Ga0496120_0295521
454 Ga0496121_0064483
455 Ga0496124_0736649
456 Ga0496125_0423039
457 Ga0496126_0789040
458 Ga0501031_0129411
459 Ga0501034_0017104
460 Ga0501034_0063085
461 Ga0501034_0068804
462 Ga0501034_0194294
463 Ga0501034_0252510
464 Ga0501034_0381490
465 Ga0501034_1133091
466 Ga0501036_0633181
467 Ga0501037_0110413
468 Ga0501039_0054514
469 Ga0501071_1574710
470 Ga0501073_0228615
471 Ga0501079_0695340
472 Ga0501080_0546225
473 nmdc:mga03683_7122_c1
474 nmdc:mga03n38_207450_c1
475 nmdc:mga03n38_22617_c1
476 nmdc:mga00v17_55177_c1
477 nmdc:mga00v17_563866_c1
478 nmdc:mga0yw44_203372_c1
479 nmdc:mga0k408_62718_c1
480 nmdc:mga06z11_333123_c1
481 nmdc:mga04h51_47468_c1
482 nmdc:mga07m45_176079_c1
483 nmdc:mga07m45_83453_c1
484 nmdc:mga0sz30_329706_c1
485 Ga0500559_0478048
486 Ga0500573_0332725
487 Ga0500604_0002782
488 Ga0500634_0000017
489 Ga0501082_1205947
490 2643911640
491 2644413069
492 2932406087

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01722

BolA

BolA-like protein

13

88

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pui-assembly2.cif.gz_B bola domain of sufe1 from arabidopsis thaliana 0.9179 1 86
4pug-assembly2.cif.gz_B bola1 from arabidopsis thaliana 0.9004 1 89
4pui-assembly1.cif.gz_A bola domain of sufe1 from arabidopsis thaliana 0.9 1 86
4pug-assembly2.cif.gz_B bola1 from arabidopsis thaliana 0.8806 1 89
3o2e-assembly1.cif.gz_A crystal structure of a bol-like protein from babesia bovis 0.8605 4 87
ID Description Score Start End Superfamily
af_Q54G84_40_127_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.907 2 86 3.30.300.90
af_Q8I3V0_1_83_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.9057 1 86 3.10.20.90
4puiA01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.9024 5 86 3.30.300.90
af_Q5AKW1_24_116_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.897 1 86 3.30.300.90
af_P91375_6_86_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.8899 1 84 3.30.300.90
ID Description Score Start End GO Terms
AF-A0A4Q3V2V1-F1-model_v4 BolA family transcriptional regulator 0.9498 4 84 GO:0016226
AF-A0A850KZN6-F1-model_v4 BolA family transcriptional regulator 0.9485 4 84 GO:0016226
AF-W9DXC9-F1-model_v4 deleted 0.9469 5 84
AF-A0A2S6QUL3-F1-model_v4 DNA-binding transcriptional regulator BolA 0.9447 1 86 GO:0003677
GO:0016226
AF-A0A5B8RWX7-F1-model_v4 BolA family transcriptional regulator 0.9435 4 84 GO:0016226

Map