F358010

General Info

Members Datasets Scaffolds Average Seq Length
246 156 492 302

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100181941|Ga0070697_1001819412
Length 343
Sequence MDFKDYYSTLGVAKTANAKEIKQAFRKLARKHHPDVNPGDKAAESKFKEINEAYEVLGDPEKRKKYDELGANWRAYEQAANAGGGPGFQGGFDPSQFGGGWPPHXXXSQGGFRTMTEDEMREMFGDQNPFSDFFQTFFGGAMGGQEESGRRGARSRAARGPRKGRDLEQEVELPLEDTYNGKVLRFSIKHDGHARTVDVRIPAGVGEGSRVRVPGEGEQGANGGQSGDLYLRIRQTPHGRFERKGRDLYTKVPIPLTTAVLGGEADVPTLSGKTLRLKIPPTTQMGQTFRLKGHGMPVTGKPDEHGDLYATVDVQLPRELTAEQRKHFEELQKLEKGTKHSAA

Samples

Sample ID Description Type Environment
1 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
83 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
84 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
85 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
86 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
87 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
88 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
89 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
95 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
96 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
97 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
98 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
99 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
100 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
101 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
102 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
103 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
104 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
105 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
106 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
107 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
108 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
109 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
110 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
111 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
112 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
113 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
114 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
115 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
116 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
117 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
118 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
119 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
120 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
121 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
122 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
123 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
124 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
125 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
126 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
129 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
130 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
131 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
136 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
137 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
138 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
139 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
140 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
141 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
142 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
143 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
144 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
145 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
146 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
147 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
148 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
149 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
150 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
151 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
152 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
153 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
154 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
155 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
156 2786546548 Spartobacteria bacterium LR76 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.19
Metatranscriptomes 0.41
Isolates 0.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.22
Nodule 0
Rhizoplane 4.47
Rhizosphere 93.5
Stem 0
Stem Tuber 0
Unclassified 3.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070697_100181941 3300005536 Bacteria 1782
2 JGI24751J29686_10002530 3300002459 Bacteria 3679
3 rootL2_10025890 3300003322 Bacteria 2515
4 Ga0065712_10167083 3300005290 Bacteria 1266
5 Ga0070676_10000683 3300005328 Bacteria 16617
6 Ga0070670_100060758 3300005331 Bacteria 3245
7 Ga0070680_100265421 3300005336 Unclassified 1453
8 Ga0070689_100109156 3300005340 Bacteria 2199
9 Ga0070691_10004376 3300005341 Bacteria 6417
10 Ga0070661_100283405 3300005344 Bacteria 1286
11 Ga0070668_100030527 3300005347 Bacteria 4097
12 Ga0070668_100313875 3300005347 Bacteria 1318
13 Ga0070669_100023605 3300005353 Bacteria 4404
14 Ga0070669_100098931 3300005353 Bacteria 2198
15 Ga0070669_100223068 3300005353 Bacteria 1491
16 Ga0070675_100159162 3300005354 Bacteria 1941
17 Ga0070675_100179943 3300005354 Bacteria 1828
18 Ga0070671_100015703 3300005355 Bacteria 6120
19 Ga0070674_100001009 3300005356 Bacteria 14705
20 Ga0070674_100016179 3300005356 Bacteria 4675
21 Ga0070674_100228906 3300005356 Bacteria 1450
22 Ga0070673_100178047 3300005364 Bacteria 1819
23 Ga0070659_100085632 3300005366 Bacteria 2521
24 Ga0070705_100002181 3300005440 Bacteria 9944
25 Ga0070700_100009714 3300005441 Bacteria 5287
26 Ga0070700_100171750 3300005441 Bacteria 1502
27 Ga0070708_100115737 3300005445 Bacteria 2468
28 Ga0070681_10024979 3300005458 Bacteria 6011
29 Ga0070681_10025701 3300005458 Bacteria 5921
30 Ga0068867_100001764 3300005459 Bacteria 15044
31 Ga0070706_100173409 3300005467 Bacteria 2014
32 Ga0070706_100289704 3300005467 Bacteria 1528
33 Ga0070707_100131043 3300005468 Bacteria 2438
34 Ga0070707_100256782 3300005468 Bacteria 1701
35 Ga0070698_100438708 3300005471 Unclassified 1241
36 Ga0070699_100232580 3300005518 Bacteria 1644
37 Ga0070699_100264756 3300005518 Bacteria 1538
38 Ga0070699_100320091 3300005518 Bacteria 1394
39 Ga0070699_100380188 3300005518 Bacteria 1275
40 Ga0070679_100035194 3300005530 Bacteria 4968
41 Ga0070679_100075349 3300005530 Bacteria 3364
42 Ga0070679_100293815 3300005530 Bacteria 1576
43 Ga0070697_100189331 3300005536 Bacteria 1746
44 Ga0070686_100122886 3300005544 Bacteria 1785
45 Ga0070696_100009026 3300005546 Bacteria 6676
46 Ga0070704_100016447 3300005549 Bacteria 4674
47 Ga0068855_100178183 3300005563 Bacteria 2404
48 Ga0070664_100049802 3300005564 Bacteria 3543
49 Ga0070664_100278228 3300005564 Bacteria 1509
50 Ga0068854_100108232 3300005578 Bacteria 2093
51 Ga0068859_100036543 3300005617 Bacteria 4931
52 Ga0068861_100000345 3300005719 Bacteria 26438
53 Ga0068861_100365502 3300005719 Bacteria 1270
54 Ga0068870_10020700 3300005840 Bacteria 3208
55 Ga0068863_100041281 3300005841 Unclassified 4386
56 Ga0068863_100424620 3300005841 Bacteria 1303
57 Ga0068862_100027307 3300005844 Bacteria 4804
58 Ga0068862_100256714 3300005844 Bacteria 1594
59 Ga0081455_10003865 3300005937 Bacteria 17074
60 Ga0081455_10019003 3300005937 Bacteria 6516
61 Ga0081455_10125445 3300005937 Unclassified 2016
62 Ga0081539_10000056 3300005985 Bacteria 256522
63 Ga0081539_10001024 3300005985 Bacteria 51459
64 Ga0097621_100045639 3300006237 Bacteria 3540
65 Ga0068871_100003858 3300006358 Bacteria 10334
66 Ga0075428_100017235 3300006844 Bacteria 7982
67 Ga0075428_100390983 3300006844 Bacteria 1491
68 Ga0075433_10002971 3300006852 Bacteria 13022
69 Ga0075433_10030422 3300006852 Bacteria 4607
70 Ga0075433_10053067 3300006852 Bacteria 3533
71 Ga0075433_10200251 3300006852 Bacteria 1775
72 Ga0075434_100001157 3300006871 Bacteria 21808
73 Ga0075434_100010107 3300006871 Bacteria 8838
74 Ga0075434_100011141 3300006871 Bacteria 8460
75 Ga0075434_100013519 3300006871 Bacteria 7774
76 Ga0075434_100087473 3300006871 Bacteria 3117
77 Ga0075434_100095177 3300006871 Bacteria 2984
78 Ga0075434_100183378 3300006871 Bacteria 2114
79 Ga0075434_100327887 3300006871 Bacteria 1551
80 Ga0097620_100036543 3300006931 Bacteria 4931
81 Ga0075435_100000028 3300007076 Bacteria 82360
82 Ga0075435_100008416 3300007076 Bacteria 7400
83 Ga0075435_100057637 3300007076 Bacteria 3143
84 Ga0105240_10066174 3300009093 Bacteria 4484
85 Ga0111539_10044001 3300009094 Bacteria 5351
86 Ga0111539_10051646 3300009094 Bacteria 4896
87 Ga0111539_10073322 3300009094 Bacteria 4036
88 Ga0111539_10125880 3300009094 Bacteria 3002
89 Ga0114129_10001269 3300009147 Bacteria 33716
90 Ga0114129_10002226 3300009147 Bacteria 26749
91 Ga0114129_10006081 3300009147 Bacteria 17110
92 Ga0114129_10024965 3300009147 Bacteria 8473
93 Ga0114129_10027676 3300009147 Bacteria 8027
94 Ga0114129_10048603 3300009147 Bacteria 5961
95 Ga0114129_10054910 3300009147 Bacteria 5583
96 Ga0114129_10056475 3300009147 Bacteria 5498
97 Ga0114129_10270555 3300009147 Bacteria 2273
98 Ga0105242_10059270 3300009176 Bacteria 3140
99 Ga0105248_10337917 3300009177 Bacteria 1696
100 Ga0105249_10332172 3300009553 Bacteria 1534
101 Ga0163163_10090945 3300014325 Bacteria 3065
102 Ga0157376_10192591 3300014969 Bacteria 1871
103 Ga0206356_10369277 3300020070 Bacteria 2228
104 Ga0207643_10101863 3300025908 Bacteria 1684
105 Ga0207707_10248811 3300025912 Unclassified 1544
106 Ga0207649_10254332 3300025920 Bacteria 1267
107 Ga0207652_10030039 3300025921 Bacteria 4549
108 Ga0207652_10107229 3300025921 Bacteria 2474
109 Ga0207652_10241646 3300025921 Bacteria 1628
110 Ga0207646_10105751 3300025922 Bacteria 2524
111 Ga0207681_10062199 3300025923 Bacteria 2569
112 Ga0207659_10281300 3300025926 Bacteria 1360
113 Ga0207644_10037476 3300025931 Bacteria 3411
114 Ga0207690_10059989 3300025932 Bacteria 2579
115 Ga0207706_10105258 3300025933 Bacteria 2483
116 Ga0207686_10025648 3300025934 Bacteria 3431
117 Ga0207709_10123101 3300025935 Bacteria 1755
118 Ga0207669_10105673 3300025937 Bacteria 1873
119 Ga0207665_10073530 3300025939 Bacteria 2338
120 Ga0207691_10269056 3300025940 Bacteria 1468
121 Ga0207711_10060062 3300025941 Bacteria 3275
122 Ga0207679_10031964 3300025945 Bacteria 3689
123 Ga0207679_10258151 3300025945 Bacteria 1485
124 Ga0207712_10103905 3300025961 Bacteria 2118
125 Ga0207668_10045140 3300025972 Bacteria 3003
126 Ga0207668_10062308 3300025972 Bacteria 2626
127 Ga0207640_10018157 3300025981 Bacteria 4128
128 Ga0207708_10001501 3300026075 Bacteria 17390
129 Ga0207708_10111966 3300026075 Bacteria 2120
130 Ga0207708_10179825 3300026075 Bacteria 1679
131 Ga0207641_10256395 3300026088 Unclassified 1636
132 Ga0207641_10400290 3300026088 Bacteria 1318
133 Ga0207674_10272319 3300026116 Bacteria 1641
134 Ga0207674_10368629 3300026116 Bacteria 1388
135 Ga0207675_100001076 3300026118 Bacteria 27124
136 Ga0207675_100084202 3300026118 Bacteria 2984
137 Ga0207675_100286000 3300026118 Bacteria 1603
138 Ga0268265_10008017 3300028380 Bacteria 7131
139 Ga0268265_10037229 3300028380 Bacteria 3569
140 Ga0268265_10065793 3300028380 Bacteria 2799
141 Ga0265314_10110262 3300031711 Bacteria 1750
142 Ga0373955_0041805 3300035172 Bacteria 2459
143 Ga0373924_0043155 3300035410 Bacteria 1852
144 Ga0373935_0235961 3300035692 Bacteria 1275
145 Ga0373947_0013431 3300035725 Bacteria 4692
146 Ga0373937_0056174 3300036401 Bacteria 3615
147 Ga0373937_0428416 3300036401 Bacteria 1256
148 Ga0316584_0004972 3300036712 Bacteria 8851
149 Ga0373925_0217598 3300037068 Bacteria 1524
150 Ga0395900_0005281 3300037418 Bacteria 13540
151 Ga0395898_0059724 3300037466 Bacteria 3708
152 Ga0395898_0379948 3300037466 Bacteria 1347
153 Ga0316581_0042564 3300037588 Bacteria 1386
154 Ga0395901_0002456 3300038443 Bacteria 18794
155 Ga0450896_008949 3300042133 Bacteria 1391
156 Ga0439435_0009587 3300042436 Bacteria 2275
157 Ga0451577_0064236 3300042876 Bacteria 3274
158 Ga0453683_0001861 3300044673 Bacteria 17294
159 Ga0453684_0105130 3300044712 Bacteria 3444
160 Ga0451576_0630401 3300045051 Bacteria 1126
161 Ga0495651_0107678 3300046462 Bacteria 2065
162 Ga0495580_0084915 3300046472 Bacteria 2205
163 Ga0495584_0011020 3300046491 Bacteria 4636
164 Ga0495594_0155942 3300046499 Bacteria 1297
165 Ga0495608_0005914 3300046511 Bacteria 8702
166 Ga0495628_0053996 3300046516 Bacteria 3168
167 Ga0495630_0027188 3300046517 Bacteria 4241
168 Ga0495642_0002776 3300046528 Bacteria 7018
169 Ga0495652_0061520 3300046529 Bacteria 3169
170 Ga0495587_0098093 3300046536 Bacteria 1689
171 Ga0495667_0004501 3300046559 Bacteria 9407
172 Ga0495659_0116560 3300046664 Bacteria 1047
173 Ga0495623_0117712 3300046679 Bacteria 1604
174 Ga0495658_0019926 3300046683 Bacteria 3509
175 Ga0495658_0120596 3300046683 Bacteria 1586
176 Ga0495613_0028116 3300046689 Bacteria 4183
177 Ga0495604_0003320 3300047317 Bacteria 12821
178 Ga0495636_0004986 3300047318 Bacteria 5208
179 Ga0495674_0040806 3300047319 Bacteria 4149
180 Ga0495680_0151755 3300047322 Bacteria 1689
181 Ga0495675_0052655 3300047444 Bacteria 2584
182 Ga0495685_010702 3300047447 Bacteria 3082
183 Ga0495684_0041799 3300047471 Bacteria 3512
184 Ga0495602_0057119 3300048088 Bacteria 3427
185 Ga0496101_0001832 3300048904 Bacteria 12817
186 Ga0496102_0101518 3300048905 Bacteria 2673
187 Ga0496102_0418514 3300048905 Bacteria 1259
188 Ga0496104_0274043 3300048907 Bacteria 1600
189 Ga0496111_0076312 3300048914 Bacteria 2443
190 Ga0496112_0050022 3300048915 Bacteria 4097
191 Ga0496112_0406251 3300048915 Bacteria 1301
192 Ga0496112_0525397 3300048915 Unclassified 1118
193 Ga0496113_0452016 3300048916 Bacteria 1032
194 Ga0496114_0003662 3300048917 Bacteria 11824
195 Ga0496115_0051076 3300048918 Bacteria 3315
196 Ga0501039_0335522 3300049575 Bacteria 1188
197 Ga0501040_0069685 3300049576 Bacteria 2426
198 Ga0501041_0022029 3300049577 Bacteria 3815
199 Ga0501042_0007559 3300049578 Bacteria 7131
200 Ga0501070_0206194 3300049586 Bacteria 1614
201 Ga0501071_0013068 3300049587 Bacteria 5651
202 Ga0501072_0061811 3300049588 Bacteria 2954
203 Ga0501080_0225099 3300049742 Bacteria 1715
204 nmdc:mga05p37_121434_c1 3300050507 Bacteria 3209
205 nmdc:mga05p37_137311_c1 3300050507 Bacteria 2997
206 nmdc:mga05p37_186776_c1 3300050507 Bacteria 2519
207 nmdc:mga05p37_2670_c1 3300050507 Bacteria 20778
208 nmdc:mga05p37_26951_c1 3300050507 Bacteria 6992
209 nmdc:mga05p37_2949_c1 3300050507 Bacteria 19750
210 nmdc:mga05p37_50212_c1 3300050507 Bacteria 5130
211 nmdc:mga05p37_6102_c1 3300050507 Bacteria 14190
212 nmdc:mga09592_38062_c1 3300050508 Bacteria 4036
213 nmdc:mga08y16_52707_c1 3300050511 Bacteria 4256
214 nmdc:mga08y16_87147_c1 3300050511 Bacteria 3253
215 nmdc:mga0n895_138624_c1 3300050512 Bacteria 2460
216 nmdc:mga0n895_146986_c1 3300050512 Bacteria 2387
217 nmdc:mga0n895_1959_c1 3300050512 Bacteria 15800
218 nmdc:mga0n895_24022_c1 3300050512 Bacteria 5738
219 nmdc:mga0n895_288007_c1 3300050512 Bacteria 1665
220 nmdc:mga0n895_295284_c1 3300050512 Bacteria 1643
221 nmdc:mga0n895_73449_c1 3300050512 Bacteria 3396
222 nmdc:mga0n895_93855_c1 3300050512 Bacteria 3004
223 nmdc:mga0rr50_1072_c1 3300050513 Bacteria 14885
224 nmdc:mga0rr50_43063_c1 3300050513 Bacteria 3301
225 nmdc:mga0rr50_47811_c1 3300050513 Bacteria 3159
226 nmdc:mga0rr50_8_c1 3300050513 Bacteria 271775
227 nmdc:mga08x19_2366_c1 3300050514 Bacteria 11427
228 nmdc:mga08x19_37774_c1 3300050514 Bacteria 3066
229 nmdc:mga08x19_4407_c1 3300050514 Bacteria 8345
230 nmdc:mga0a205_167257_c1 3300050515 Bacteria 2095
231 nmdc:mga0a205_210036_c1 3300050515 Bacteria 1835
232 nmdc:mga0a205_80107_c1 3300050515 Bacteria 3156
233 Ga0495601_0002617 3300053077 Bacteria 10210
234 Ga0495601_0195141 3300053077 Bacteria 1323
235 Ga0495619_0067807 3300053085 Bacteria 2383
236 Ga0495619_0068358 3300053085 Bacteria 2373
237 Ga0500643_017700 3300053087 Bacteria 2380
238 Ga0500651_0228201 3300053093 Unclassified 1090
239 Ga0500645_051982 3300053730 Bacteria 1194
240 Ga0501084_0031353 3300054114 Bacteria 4445
241 Ga0590071_000209 3300059421 Bacteria 17299
242 Ga0590074_002914 3300059423 Bacteria 2819
243 Ga0590077_001311 3300059426 Bacteria 5894
244 Ga0501082_0240276 3300060353 Bacteria 1576
245 Ga0501082_0461366 3300060353 Unclassified 1110
246 2787509515 2786546548 Bacteria 4745694
247 Ga0070697_100181941
248 JGI24751J29686_10002530
249 rootL2_10025890
250 Ga0065712_10167083
251 Ga0070676_10000683
252 Ga0070670_100060758
253 Ga0070680_100265421
254 Ga0070689_100109156
255 Ga0070691_10004376
256 Ga0070661_100283405
257 Ga0070668_100030527
258 Ga0070668_100313875
259 Ga0070669_100023605
260 Ga0070669_100098931
261 Ga0070669_100223068
262 Ga0070675_100159162
263 Ga0070675_100179943
264 Ga0070671_100015703
265 Ga0070674_100001009
266 Ga0070674_100016179
267 Ga0070674_100228906
268 Ga0070673_100178047
269 Ga0070659_100085632
270 Ga0070705_100002181
271 Ga0070700_100009714
272 Ga0070700_100171750
273 Ga0070708_100115737
274 Ga0070681_10024979
275 Ga0070681_10025701
276 Ga0068867_100001764
277 Ga0070706_100173409
278 Ga0070706_100289704
279 Ga0070707_100131043
280 Ga0070707_100256782
281 Ga0070698_100438708
282 Ga0070699_100232580
283 Ga0070699_100264756
284 Ga0070699_100320091
285 Ga0070699_100380188
286 Ga0070679_100035194
287 Ga0070679_100075349
288 Ga0070679_100293815
289 Ga0070697_100189331
290 Ga0070686_100122886
291 Ga0070696_100009026
292 Ga0070704_100016447
293 Ga0068855_100178183
294 Ga0070664_100049802
295 Ga0070664_100278228
296 Ga0068854_100108232
297 Ga0068859_100036543
298 Ga0068861_100000345
299 Ga0068861_100365502
300 Ga0068870_10020700
301 Ga0068863_100041281
302 Ga0068863_100424620
303 Ga0068862_100027307
304 Ga0068862_100256714
305 Ga0081455_10003865
306 Ga0081455_10019003
307 Ga0081455_10125445
308 Ga0081539_10000056
309 Ga0081539_10001024
310 Ga0097621_100045639
311 Ga0068871_100003858
312 Ga0075428_100017235
313 Ga0075428_100390983
314 Ga0075433_10002971
315 Ga0075433_10030422
316 Ga0075433_10053067
317 Ga0075433_10200251
318 Ga0075434_100001157
319 Ga0075434_100010107
320 Ga0075434_100011141
321 Ga0075434_100013519
322 Ga0075434_100087473
323 Ga0075434_100095177
324 Ga0075434_100183378
325 Ga0075434_100327887
326 Ga0097620_100036543
327 Ga0075435_100000028
328 Ga0075435_100008416
329 Ga0075435_100057637
330 Ga0105240_10066174
331 Ga0111539_10044001
332 Ga0111539_10051646
333 Ga0111539_10073322
334 Ga0111539_10125880
335 Ga0114129_10001269
336 Ga0114129_10002226
337 Ga0114129_10006081
338 Ga0114129_10024965
339 Ga0114129_10027676
340 Ga0114129_10048603
341 Ga0114129_10054910
342 Ga0114129_10056475
343 Ga0114129_10270555
344 Ga0105242_10059270
345 Ga0105248_10337917
346 Ga0105249_10332172
347 Ga0163163_10090945
348 Ga0157376_10192591
349 Ga0206356_10369277
350 Ga0207643_10101863
351 Ga0207707_10248811
352 Ga0207649_10254332
353 Ga0207652_10030039
354 Ga0207652_10107229
355 Ga0207652_10241646
356 Ga0207646_10105751
357 Ga0207681_10062199
358 Ga0207659_10281300
359 Ga0207644_10037476
360 Ga0207690_10059989
361 Ga0207706_10105258
362 Ga0207686_10025648
363 Ga0207709_10123101
364 Ga0207669_10105673
365 Ga0207665_10073530
366 Ga0207691_10269056
367 Ga0207711_10060062
368 Ga0207679_10031964
369 Ga0207679_10258151
370 Ga0207712_10103905
371 Ga0207668_10045140
372 Ga0207668_10062308
373 Ga0207640_10018157
374 Ga0207708_10001501
375 Ga0207708_10111966
376 Ga0207708_10179825
377 Ga0207641_10256395
378 Ga0207641_10400290
379 Ga0207674_10272319
380 Ga0207674_10368629
381 Ga0207675_100001076
382 Ga0207675_100084202
383 Ga0207675_100286000
384 Ga0268265_10008017
385 Ga0268265_10037229
386 Ga0268265_10065793
387 Ga0265314_10110262
388 Ga0373955_0041805
389 Ga0373924_0043155
390 Ga0373935_0235961
391 Ga0373947_0013431
392 Ga0373937_0056174
393 Ga0373937_0428416
394 Ga0316584_0004972
395 Ga0373925_0217598
396 Ga0395900_0005281
397 Ga0395898_0059724
398 Ga0395898_0379948
399 Ga0316581_0042564
400 Ga0395901_0002456
401 Ga0450896_008949
402 Ga0439435_0009587
403 Ga0451577_0064236
404 Ga0453683_0001861
405 Ga0453684_0105130
406 Ga0451576_0630401
407 Ga0495651_0107678
408 Ga0495580_0084915
409 Ga0495584_0011020
410 Ga0495594_0155942
411 Ga0495608_0005914
412 Ga0495628_0053996
413 Ga0495630_0027188
414 Ga0495642_0002776
415 Ga0495652_0061520
416 Ga0495587_0098093
417 Ga0495667_0004501
418 Ga0495659_0116560
419 Ga0495623_0117712
420 Ga0495658_0019926
421 Ga0495658_0120596
422 Ga0495613_0028116
423 Ga0495604_0003320
424 Ga0495636_0004986
425 Ga0495674_0040806
426 Ga0495680_0151755
427 Ga0495675_0052655
428 Ga0495685_010702
429 Ga0495684_0041799
430 Ga0495602_0057119
431 Ga0496101_0001832
432 Ga0496102_0101518
433 Ga0496102_0418514
434 Ga0496104_0274043
435 Ga0496111_0076312
436 Ga0496112_0050022
437 Ga0496112_0406251
438 Ga0496112_0525397
439 Ga0496113_0452016
440 Ga0496114_0003662
441 Ga0496115_0051076
442 Ga0501039_0335522
443 Ga0501040_0069685
444 Ga0501041_0022029
445 Ga0501042_0007559
446 Ga0501070_0206194
447 Ga0501071_0013068
448 Ga0501072_0061811
449 Ga0501080_0225099
450 nmdc:mga05p37_121434_c1
451 nmdc:mga05p37_137311_c1
452 nmdc:mga05p37_186776_c1
453 nmdc:mga05p37_2670_c1
454 nmdc:mga05p37_26951_c1
455 nmdc:mga05p37_2949_c1
456 nmdc:mga05p37_50212_c1
457 nmdc:mga05p37_6102_c1
458 nmdc:mga09592_38062_c1
459 nmdc:mga08y16_52707_c1
460 nmdc:mga08y16_87147_c1
461 nmdc:mga0n895_138624_c1
462 nmdc:mga0n895_146986_c1
463 nmdc:mga0n895_1959_c1
464 nmdc:mga0n895_24022_c1
465 nmdc:mga0n895_288007_c1
466 nmdc:mga0n895_295284_c1
467 nmdc:mga0n895_73449_c1
468 nmdc:mga0n895_93855_c1
469 nmdc:mga0rr50_1072_c1
470 nmdc:mga0rr50_43063_c1
471 nmdc:mga0rr50_47811_c1
472 nmdc:mga0rr50_8_c1
473 nmdc:mga08x19_2366_c1
474 nmdc:mga08x19_37774_c1
475 nmdc:mga08x19_4407_c1
476 nmdc:mga0a205_167257_c1
477 nmdc:mga0a205_210036_c1
478 nmdc:mga0a205_80107_c1
479 Ga0495601_0002617
480 Ga0495601_0195141
481 Ga0495619_0067807
482 Ga0495619_0068358
483 Ga0500643_017700
484 Ga0500651_0228201
485 Ga0500645_051982
486 Ga0501084_0031353
487 Ga0590071_000209
488 Ga0590074_002914
489 Ga0590077_001311
490 Ga0501082_0240276
491 Ga0501082_0461366
492 2787509515

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00226

DnaJ

DnaJ domain

5

67

0.99

PF01556

DnaJ_C

DnaJ C terminal domain

167

317

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7jtk-assembly1.cif.gz_y radial spoke 1 isolated from chlamydomonas reinhardtii 0.9635 5 67
8glv-assembly1.cif.gz_KA 96-nm repeat unit of doublet microtubules from chlamydomonas reinhardtii flagella 0.9534 5 67
3ucs-assembly1.cif.gz_D crystal structure of the complex between cbpa j-domain and cbpm 0.9515 3 71
3i38-assembly7.cif.gz_B structure of a putative chaperone protein dnaj from klebsiella pneumoniae subsp. pneumoniae mgh 78578 0.9421 180 276
8bqs-assembly1.cif.gz_A2 cryo-em structure of the i-ii-iii2-iv2 respiratory supercomplex from tetrahymena thermophila 0.9389 2 69
ID Description Score Start End Superfamily
af_Q4DS80_4_96_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9739 5 68 1.10.287.110
af_Q8TA83_290_396_2.60.260.20 Mainly Beta;Sandwich;HSP40/DNAj peptide-binding domain;Urease metallochaperone UreE, N-terminal domain 0.965 178 276 2.60.260.20
af_Q55D57_37_119_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9597 4 72 1.10.287.110
af_Q8CHS2_271_339_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9551 6 60 1.10.287.110
af_A0A0G2K5E4_335_441_2.60.260.20 Mainly Beta;Sandwich;HSP40/DNAj peptide-binding domain;Urease metallochaperone UreE, N-terminal domain 0.9547 179 276 2.60.260.20
ID Description Score Start End GO Terms
AF-A0A4Q4CSA3-F1-model_v4 Molecular chaperone DnaJ 0.9663 183 276 GO:0005737
GO:0042026
GO:0051082
GO:0051085
AF-A0A7C0U482-F1-model_v4 J domain-containing protein 0.9547 175 278 GO:0005737
GO:0042026
GO:0051082
GO:0051085
AF-A0A6F9ZI00-F1-model_v4 Chaperone protein DnaJ 0.9528 137 276 GO:0005737
GO:0031072
GO:0042026
GO:0051082
GO:0051085
AF-F8WLU2-F1-model_v4 Chaperone protein Hsp40 0.9492 137 243 GO:0005737
GO:0031072
GO:0042026
GO:0046872
GO:0051082
GO:0051085
AF-X0UV11-F1-model_v4 Chaperone DnaJ C-terminal domain-containing protein 0.9483 143 278 GO:0005737
GO:0042026
GO:0051082
GO:0051085

Map