F357935

General Info

Members Datasets Scaffolds Average Seq Length
246 185 492 393

Family's Representative Sequence

Representative Sequence 3300005341|Ga0070691_10115201|Ga0070691_101152011
Length 417
Sequence MSEKTAEGSGRLQADEGAGARGSALGGVRVLDIATFLAAPFAGTVLADFGAEVIKIEQPRVGDPLRRFGTPTEVGDTLVWLSEARNKKSITLDLRTPKGAEIFRALVAKSDVVLENFRPGTLEKWGLGFEVLSAVNPRLVMLRISAYGQTGPMRDKPGFARIAHGFGGLSALAGEPGGTPVVPGSTSLADYMSGMWGVIGILTALRARERTGKGQYIDIALYESVFRVLDEIAPAFQKFGYVRERMGADTVNVCPHSHYQTRDGKWIAIACTSDTIFARLAEAMQQPELASAERYGPQALRLAARDEVNRIVAAWVATLDLETVLALCSKGGVPASLIFSIADIFEDPQYRARGNIQMTDSRAGAIAVPGVVPRLSDTPGEIRWLGAGLGAQNDDVYRGLLELSSAEIEELRTSGVI

Samples

Sample ID Description Type Environment
1 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
16 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
18 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
19 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
20 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
21 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
22 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
31 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
35 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
41 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
42 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
58 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
59 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
60 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
61 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
62 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
63 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
64 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
65 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
66 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
67 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
68 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
69 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
70 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
71 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
72 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
73 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
74 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
75 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
76 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
77 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
78 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
79 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
80 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
81 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
82 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
83 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
84 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
85 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
86 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
87 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
88 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
89 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
90 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
91 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
92 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
93 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
94 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
95 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
96 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
97 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
98 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
99 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
100 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
101 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
102 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
103 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
104 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
105 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
106 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
107 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
108 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
109 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
110 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
111 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
112 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
113 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
114 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
115 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
116 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
117 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
118 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
119 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
120 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
121 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
122 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
123 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
124 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
125 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
126 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
127 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
128 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
129 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
130 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
131 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
132 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
133 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
134 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
135 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
136 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
137 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
138 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
139 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
140 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
141 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
142 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
143 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
144 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
145 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
146 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
152 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
153 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
154 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
161 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
162 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
164 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
165 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
166 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
167 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
168 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
169 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
170 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
171 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
172 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
173 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
174 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
175 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
176 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
177 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
178 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
179 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
180 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
181 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
182 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
183 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
184 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
185 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.37
Metatranscriptomes 0
Isolates 1.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.91
Nodule 0.41
Rhizoplane 2.85
Rhizosphere 82.93
Stem 0
Stem Tuber 0
Unclassified 0.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070691_10115201 3300005341 Bacteria 1348
2 Ga0070683_100052173 3300005329 Bacteria 3788
3 Ga0070680_100134050 3300005336 Bacteria 2074
4 Ga0070709_10030226 3300005434 Bacteria 3249
5 Ga0070714_100112330 3300005435 Bacteria 2414
6 Ga0070713_100011632 3300005436 Bacteria 6419
7 Ga0070713_100038355 3300005436 Bacteria 3881
8 Ga0070711_100005827 3300005439 Bacteria 7395
9 Ga0070694_100082346 3300005444 Bacteria 2241
10 Ga0070663_100009999 3300005455 Bacteria 5897
11 Ga0070681_10006553 3300005458 Bacteria 11334
12 Ga0070681_10252228 3300005458 Bacteria 1677
13 Ga0070679_100011488 3300005530 Bacteria 8439
14 Ga0070679_100128766 3300005530 Bacteria 2512
15 Ga0070679_100140090 3300005530 Bacteria 2399
16 Ga0068853_100106080 3300005539 Bacteria 2490
17 Ga0070695_100016744 3300005545 Bacteria 4440
18 Ga0070665_100033438 3300005548 Bacteria 5173
19 Ga0068864_100168570 3300005618 Bacteria 1995
20 Ga0081455_10000053 3300005937 Bacteria 122071
21 Ga0081455_10045258 3300005937 Bacteria 3830
22 Ga0081540_1003716 3300005983 Bacteria 11958
23 Ga0070717_10001753 3300006028 Bacteria 15100
24 Ga0070717_10010095 3300006028 Bacteria 7110
25 Ga0075363_100062296 3300006048 Bacteria 2011
26 Ga0070715_10051082 3300006163 Bacteria 1777
27 Ga0075367_10070384 3300006178 Bacteria 2102
28 Ga0075370_10015445 3300006353 Bacteria 4089
29 Ga0075428_100025747 3300006844 Bacteria 6515
30 Ga0075428_100179107 3300006844 Bacteria 2295
31 Ga0075433_10006554 3300006852 Bacteria 9211
32 Ga0075434_100000590 3300006871 Bacteria 28022
33 Ga0075435_100036457 3300007076 Bacteria 3909
34 Ga0075435_100087991 3300007076 Bacteria 2560
35 Ga0105240_10013493 3300009093 Bacteria 11220
36 Ga0111539_10023036 3300009094 Bacteria 7648
37 Ga0114129_10071007 3300009147 Bacteria 4855
38 Ga0105241_10151976 3300009174 Bacteria 1895
39 Ga0105242_10103421 3300009176 Bacteria 2416
40 Ga0105237_10066356 3300009545 Bacteria 3603
41 Ga0105237_10204574 3300009545 Bacteria 1974
42 Ga0105237_10394789 3300009545 Bacteria 1388
43 Ga0105238_10000676 3300009551 Bacteria 35848
44 Ga0105238_10303513 3300009551 Bacteria 1580
45 Ga0105246_10170829 3300011119 Bacteria 1665
46 Ga0157370_10246525 3300013104 Bacteria 1652
47 Ga0157369_10167140 3300013105 Bacteria 2319
48 Ga0157374_10005528 3300013296 Bacteria 10628
49 Ga0163162_10009440 3300013306 Bacteria 9487
50 Ga0163163_10207601 3300014325 Bacteria 2007
51 Ga0213875_10000067 3300021388 Bacteria 127481
52 Ga0209758_1015784 3300025297 Bacteria 3885
53 Ga0207685_10054930 3300025905 Bacteria 1553
54 Ga0207705_10161425 3300025909 Bacteria 1684
55 Ga0207707_10000204 3300025912 Bacteria 63042
56 Ga0207660_10021046 3300025917 Bacteria 4383
57 Ga0207649_10142564 3300025920 Bacteria 1641
58 Ga0207652_10004144 3300025921 Bacteria 11836
59 Ga0207694_10188559 3300025924 Bacteria 1674
60 Ga0207700_10039096 3300025928 Bacteria 3450
61 Ga0207700_10060416 3300025928 Bacteria 2871
62 Ga0207664_10045203 3300025929 Bacteria 3452
63 Ga0207664_10139911 3300025929 Bacteria 2046
64 Ga0207664_10197356 3300025929 Bacteria 1735
65 Ga0207691_10094713 3300025940 Bacteria 2671
66 Ga0207661_10008410 3300025944 Bacteria 7375
67 Ga0207661_10038186 3300025944 Bacteria 3761
68 Ga0207679_10174278 3300025945 Bacteria 1774
69 Ga0207639_10091056 3300026041 Bacteria 2441
70 Ga0207676_10149510 3300026095 Bacteria 2010
71 Ga0268266_10009228 3300028379 Bacteria 8703
72 Ga0265334_10015234 3300028573 Bacteria 3197
73 Ga0307513_10040279 3300031456 Bacteria 5168
74 Ga0307513_10103630 3300031456 Bacteria 2861
75 Ga0307509_10186469 3300031507 Bacteria 1932
76 Ga0307508_10255408 3300031616 Unclassified 1348
77 Ga0307510_10022877 3300033180 Bacteria 7250
78 Ga0373926_0006867 3300035083 Bacteria 3784
79 Ga0373923_0009908 3300035111 Bacteria 3451
80 Ga0373923_0010438 3300035111 Bacteria 3378
81 Ga0373936_0003938 3300035113 Bacteria 5594
82 Ga0373936_0013788 3300035113 Bacteria 3085
83 Ga0373939_0005150 3300035114 Bacteria 3108
84 Ga0373941_0018546 3300035115 Bacteria 1924
85 Ga0373954_0010539 3300035118 Bacteria 4080
86 Ga0373960_0017440 3300035121 Bacteria 1861
87 Ga0373943_0000502 3300035170 Bacteria 16761
88 Ga0373955_0104484 3300035172 Bacteria 1630
89 Ga0373962_0004558 3300035242 Bacteria 3352
90 Ga0373931_0003835 3300035691 Bacteria 6798
91 Ga0373931_0019649 3300035691 Bacteria 3374
92 Ga0373935_0000623 3300035692 Bacteria 18571
93 Ga0373935_0065713 3300035692 Bacteria 2328
94 Ga0373927_0000713 3300035695 Bacteria 25468
95 Ga0373927_0083942 3300035695 Bacteria 2066
96 Ga0373933_0076884 3300035724 Bacteria 2040
97 Ga0373947_0001028 3300035725 Bacteria 17076
98 Ga0373947_0011620 3300035725 Bacteria 5050
99 Ga0373937_0005064 3300036401 Bacteria 11218
100 Ga0373925_0003370 3300037068 Bacteria 12396
101 Ga0373925_0008055 3300037068 Bacteria 7675
102 Ga0395899_0001231 3300037312 Bacteria 22369
103 Ga0395900_0004166 3300037418 Bacteria 15385
104 Ga0395900_0132056 3300037418 Bacteria 2558
105 Ga0395898_0160636 3300037466 Bacteria 2149
106 Ga0436364_0367201 3300037853 Bacteria 32911
107 Ga0436364_1528006 3300037853 Bacteria 2022
108 Ga0395901_0295242 3300038443 Bacteria 1681
109 Ga0436365_1185789 3300039437 Bacteria 5396
110 Ga0436365_1343038 3300039437 Bacteria 4165
111 Ga0436365_1710146 3300039437 Bacteria 2906
112 Ga0436360_0583240 3300039438 Bacteria 1334
113 Ga0436363_0048248 3300039450 Bacteria 1985
114 Ga0466966_0105259 3300044684 Bacteria 1742
115 Ga0466961_0149088 3300044693 Bacteria 1461
116 Ga0466971_0018031 3300044719 Bacteria 3127
117 Ga0466959_0063861 3300045049 Bacteria 2673
118 Ga0451576_0159058 3300045051 Bacteria 2357
119 Ga0466958_0057263 3300045836 Bacteria 2369
120 Ga0466967_0087562 3300045976 Bacteria 2824
121 Ga0495592_0003030 3300046454 Bacteria 11965
122 Ga0495603_0001039 3300046455 Bacteria 16059
123 Ga0495603_0036175 3300046455 Bacteria 2964
124 Ga0495603_0046488 3300046455 Bacteria 2586
125 Ga0495603_0125269 3300046455 Bacteria 1497
126 Ga0495590_0013573 3300046457 Bacteria 2991
127 Ga0495629_0004804 3300046459 Bacteria 10135
128 Ga0495638_0000150 3300046460 Bacteria 109804
129 Ga0495638_0004217 3300046460 Bacteria 10941
130 Ga0495638_0067320 3300046460 Bacteria 2199
131 Ga0495641_0008388 3300046461 Bacteria 6313
132 Ga0495651_0214209 3300046462 Bacteria 1338
133 Ga0495580_0005958 3300046472 Bacteria 9997
134 Ga0495580_0008032 3300046472 Bacteria 8425
135 Ga0495582_0000010 3300046473 Bacteria 118676
136 Ga0495605_0060348 3300046474 Bacteria 1818
137 Ga0495639_0000319 3300046475 Bacteria 23333
138 Ga0495639_0007664 3300046475 Bacteria 4644
139 Ga0495662_0003114 3300046476 Bacteria 8365
140 Ga0495664_0007201 3300046477 Bacteria 6169
141 Ga0495584_0066135 3300046491 Bacteria 1818
142 Ga0495594_0000713 3300046499 Bacteria 17130
143 Ga0495606_0065735 3300046507 Bacteria 2303
144 Ga0495608_0043707 3300046511 Bacteria 2993
145 Ga0495610_0038644 3300046512 Bacteria 2421
146 Ga0495618_0035244 3300046514 Bacteria 3141
147 Ga0495628_0000814 3300046516 Bacteria 28844
148 Ga0495630_0000513 3300046517 Bacteria 28631
149 Ga0495630_0076780 3300046517 Bacteria 2517
150 Ga0495632_0036099 3300046519 Bacteria 2516
151 Ga0495632_0039729 3300046519 Bacteria 2373
152 Ga0495666_0018710 3300046526 Bacteria 3443
153 Ga0495666_0051271 3300046526 Bacteria 1983
154 Ga0495652_0105413 3300046529 Bacteria 2278
155 Ga0495652_0263950 3300046529 Bacteria 1269
156 Ga0495665_0000092 3300046531 Bacteria 40990
157 Ga0495665_0020443 3300046531 Bacteria 3556
158 Ga0495640_0003549 3300046533 Bacteria 12528
159 Ga0495640_0010899 3300046533 Bacteria 7007
160 Ga0495586_0035196 3300046535 Bacteria 2690
161 Ga0495622_0001605 3300046557 Bacteria 11157
162 Ga0495622_0020212 3300046557 Bacteria 3101
163 Ga0495667_0036753 3300046559 Bacteria 3266
164 Ga0495668_0020773 3300046616 Bacteria 3773
165 Ga0495634_0001665 3300046642 Bacteria 19351
166 Ga0495634_0037105 3300046642 Bacteria 3331
167 Ga0495611_0011038 3300046648 Bacteria 3825
168 Ga0495625_0013074 3300046660 Bacteria 6689
169 Ga0495635_0000388 3300046663 Bacteria 27965
170 Ga0495635_0176767 3300046663 Bacteria 1451
171 Ga0495588_0025126 3300046674 Bacteria 2965
172 Ga0495599_0061301 3300046678 Bacteria 2351
173 Ga0495646_0018231 3300046680 Bacteria 4445
174 Ga0495647_0001271 3300046681 Bacteria 7771
175 Ga0495658_0000663 3300046683 Bacteria 18682
176 Ga0495658_0059659 3300046683 Bacteria 2185
177 Ga0495613_0002604 3300046689 Bacteria 13558
178 Ga0495613_0049882 3300046689 Bacteria 3088
179 Ga0495624_0009705 3300046690 Bacteria 6663
180 Ga0495624_0009793 3300046690 Bacteria 6627
181 Ga0495649_0011689 3300046694 Bacteria 5139
182 Ga0495589_0004076 3300046794 Bacteria 7831
183 Ga0495581_0000093 3300047315 Bacteria 36772
184 Ga0495581_0016006 3300047315 Bacteria 4358
185 Ga0495674_0000050 3300047319 Bacteria 77111
186 Ga0495674_0022499 3300047319 Bacteria 5815
187 Ga0495672_0039490 3300047320 Bacteria 2869
188 Ga0495676_0022776 3300047321 Bacteria 5445
189 Ga0495680_0186353 3300047322 Bacteria 1495
190 Ga0495683_0039880 3300047323 Bacteria 2373
191 Ga0495684_0002801 3300047471 Bacteria 13756
192 Ga0495684_0040214 3300047471 Bacteria 3585
193 Ga0495686_0000110 3300047472 Bacteria 169827
194 Ga0495686_0013781 3300047472 Bacteria 5601
195 Ga0495593_0012871 3300047673 Bacteria 4779
196 Ga0495593_0022071 3300047673 Bacteria 3552
197 Ga0495602_0080148 3300048088 Bacteria 2751
198 Ga0496102_0309906 3300048905 Bacteria 1488
199 Ga0496104_0016266 3300048907 Bacteria 6753
200 Ga0496110_0103500 3300048913 Bacteria 2554
201 Ga0496110_0143115 3300048913 Bacteria 2162
202 Ga0496112_0020100 3300048915 Bacteria 6322
203 Ga0496112_0144001 3300048915 Bacteria 2352
204 Ga0496114_0103253 3300048917 Bacteria 2436
205 Ga0496121_0000385 3300048924 Bacteria 90105
206 Ga0496121_0012357 3300048924 Bacteria 9334
207 Ga0496126_0006219 3300048929 Bacteria 13355
208 Ga0496126_0186248 3300048929 Bacteria 1760
209 Ga0501031_0004710 3300049568 Bacteria 8848
210 Ga0501033_0004977 3300049570 Bacteria 10564
211 Ga0501034_0131377 3300049571 Unclassified 2487
212 Ga0501036_0046390 3300049572 Bacteria 3680
213 Ga0501036_0245690 3300049572 Bacteria 1500
214 Ga0501043_0044947 3300049579 Bacteria 3474
215 Ga0501047_0013554 3300049581 Bacteria 7731
216 Ga0501047_0042957 3300049581 Bacteria 4367
217 Ga0501047_0232330 3300049581 Bacteria 1697
218 Ga0501070_0048036 3300049586 Bacteria 3546
219 Ga0501081_0017310 3300049743 Bacteria 4769
220 Ga0501035_0208981 3300049822 Bacteria 1671
221 Ga0501035_0282818 3300049822 Bacteria 1402
222 Ga0501035_0304049 3300049822 Bacteria 1343
223 Ga0501044_0008370 3300049823 Bacteria 11342
224 nmdc:mga03n38_47068_c1 3300050490 Bacteria 1907
225 nmdc:mga06z11_19356_c1 3300050494 Bacteria 3128
226 nmdc:mga0n895_19605_c1 3300050512 Bacteria 6289
227 nmdc:mga0rr50_67159_c1 3300050513 Bacteria 2723
228 nmdc:mga08x19_48899_c1 3300050514 Bacteria 2710
229 nmdc:mga0a205_6776_c1 3300050515 Bacteria 10361
230 Ga0500635_0002654 3300053080 Bacteria 4435
231 Ga0500650_0068477 3300053098 Bacteria 1659
232 Ga0500554_008644 3300053102 Bacteria 2403
233 Ga0500562_010835 3300053108 Bacteria 2313
234 Ga0500562_025496 3300053108 Bacteria 1547
235 Ga0500595_018226 3300053119 Bacteria 2571
236 Ga0500658_0010514 3300053134 Bacteria 3413
237 Ga0500603_013796 3300053150 Bacteria 1878
238 Ga0500622_0095932 3300053156 Bacteria 1466
239 Ga0500634_0044770 3300053161 Bacteria 2395
240 Ga0500637_0055731 3300053178 Bacteria 2258
241 Ga0466962_0039356 3300061719 Bacteria 2264
242 Ga0530510_0104534 3300061734 Bacteria 2072
243 2883581653 2883577096 Bacteria 4709178
244 2885392657 2885383462 Bacteria 9473874
245 2894774014 2894772417 Bacteria 5305674
246 8016588354 8016583857 Bacteria 10421953
247 Ga0070691_10115201
248 Ga0070683_100052173
249 Ga0070680_100134050
250 Ga0070709_10030226
251 Ga0070714_100112330
252 Ga0070713_100011632
253 Ga0070713_100038355
254 Ga0070711_100005827
255 Ga0070694_100082346
256 Ga0070663_100009999
257 Ga0070681_10006553
258 Ga0070681_10252228
259 Ga0070679_100011488
260 Ga0070679_100128766
261 Ga0070679_100140090
262 Ga0068853_100106080
263 Ga0070695_100016744
264 Ga0070665_100033438
265 Ga0068864_100168570
266 Ga0081455_10000053
267 Ga0081455_10045258
268 Ga0081540_1003716
269 Ga0070717_10001753
270 Ga0070717_10010095
271 Ga0075363_100062296
272 Ga0070715_10051082
273 Ga0075367_10070384
274 Ga0075370_10015445
275 Ga0075428_100025747
276 Ga0075428_100179107
277 Ga0075433_10006554
278 Ga0075434_100000590
279 Ga0075435_100036457
280 Ga0075435_100087991
281 Ga0105240_10013493
282 Ga0111539_10023036
283 Ga0114129_10071007
284 Ga0105241_10151976
285 Ga0105242_10103421
286 Ga0105237_10066356
287 Ga0105237_10204574
288 Ga0105237_10394789
289 Ga0105238_10000676
290 Ga0105238_10303513
291 Ga0105246_10170829
292 Ga0157370_10246525
293 Ga0157369_10167140
294 Ga0157374_10005528
295 Ga0163162_10009440
296 Ga0163163_10207601
297 Ga0213875_10000067
298 Ga0209758_1015784
299 Ga0207685_10054930
300 Ga0207705_10161425
301 Ga0207707_10000204
302 Ga0207660_10021046
303 Ga0207649_10142564
304 Ga0207652_10004144
305 Ga0207694_10188559
306 Ga0207700_10039096
307 Ga0207700_10060416
308 Ga0207664_10045203
309 Ga0207664_10139911
310 Ga0207664_10197356
311 Ga0207691_10094713
312 Ga0207661_10008410
313 Ga0207661_10038186
314 Ga0207679_10174278
315 Ga0207639_10091056
316 Ga0207676_10149510
317 Ga0268266_10009228
318 Ga0265334_10015234
319 Ga0307513_10040279
320 Ga0307513_10103630
321 Ga0307509_10186469
322 Ga0307508_10255408
323 Ga0307510_10022877
324 Ga0373926_0006867
325 Ga0373923_0009908
326 Ga0373923_0010438
327 Ga0373936_0003938
328 Ga0373936_0013788
329 Ga0373939_0005150
330 Ga0373941_0018546
331 Ga0373954_0010539
332 Ga0373960_0017440
333 Ga0373943_0000502
334 Ga0373955_0104484
335 Ga0373962_0004558
336 Ga0373931_0003835
337 Ga0373931_0019649
338 Ga0373935_0000623
339 Ga0373935_0065713
340 Ga0373927_0000713
341 Ga0373927_0083942
342 Ga0373933_0076884
343 Ga0373947_0001028
344 Ga0373947_0011620
345 Ga0373937_0005064
346 Ga0373925_0003370
347 Ga0373925_0008055
348 Ga0395899_0001231
349 Ga0395900_0004166
350 Ga0395900_0132056
351 Ga0395898_0160636
352 Ga0436364_0367201
353 Ga0436364_1528006
354 Ga0395901_0295242
355 Ga0436365_1185789
356 Ga0436365_1343038
357 Ga0436365_1710146
358 Ga0436360_0583240
359 Ga0436363_0048248
360 Ga0466966_0105259
361 Ga0466961_0149088
362 Ga0466971_0018031
363 Ga0466959_0063861
364 Ga0451576_0159058
365 Ga0466958_0057263
366 Ga0466967_0087562
367 Ga0495592_0003030
368 Ga0495603_0001039
369 Ga0495603_0036175
370 Ga0495603_0046488
371 Ga0495603_0125269
372 Ga0495590_0013573
373 Ga0495629_0004804
374 Ga0495638_0000150
375 Ga0495638_0004217
376 Ga0495638_0067320
377 Ga0495641_0008388
378 Ga0495651_0214209
379 Ga0495580_0005958
380 Ga0495580_0008032
381 Ga0495582_0000010
382 Ga0495605_0060348
383 Ga0495639_0000319
384 Ga0495639_0007664
385 Ga0495662_0003114
386 Ga0495664_0007201
387 Ga0495584_0066135
388 Ga0495594_0000713
389 Ga0495606_0065735
390 Ga0495608_0043707
391 Ga0495610_0038644
392 Ga0495618_0035244
393 Ga0495628_0000814
394 Ga0495630_0000513
395 Ga0495630_0076780
396 Ga0495632_0036099
397 Ga0495632_0039729
398 Ga0495666_0018710
399 Ga0495666_0051271
400 Ga0495652_0105413
401 Ga0495652_0263950
402 Ga0495665_0000092
403 Ga0495665_0020443
404 Ga0495640_0003549
405 Ga0495640_0010899
406 Ga0495586_0035196
407 Ga0495622_0001605
408 Ga0495622_0020212
409 Ga0495667_0036753
410 Ga0495668_0020773
411 Ga0495634_0001665
412 Ga0495634_0037105
413 Ga0495611_0011038
414 Ga0495625_0013074
415 Ga0495635_0000388
416 Ga0495635_0176767
417 Ga0495588_0025126
418 Ga0495599_0061301
419 Ga0495646_0018231
420 Ga0495647_0001271
421 Ga0495658_0000663
422 Ga0495658_0059659
423 Ga0495613_0002604
424 Ga0495613_0049882
425 Ga0495624_0009705
426 Ga0495624_0009793
427 Ga0495649_0011689
428 Ga0495589_0004076
429 Ga0495581_0000093
430 Ga0495581_0016006
431 Ga0495674_0000050
432 Ga0495674_0022499
433 Ga0495672_0039490
434 Ga0495676_0022776
435 Ga0495680_0186353
436 Ga0495683_0039880
437 Ga0495684_0002801
438 Ga0495684_0040214
439 Ga0495686_0000110
440 Ga0495686_0013781
441 Ga0495593_0012871
442 Ga0495593_0022071
443 Ga0495602_0080148
444 Ga0496102_0309906
445 Ga0496104_0016266
446 Ga0496110_0103500
447 Ga0496110_0143115
448 Ga0496112_0020100
449 Ga0496112_0144001
450 Ga0496114_0103253
451 Ga0496121_0000385
452 Ga0496121_0012357
453 Ga0496126_0006219
454 Ga0496126_0186248
455 Ga0501031_0004710
456 Ga0501033_0004977
457 Ga0501034_0131377
458 Ga0501036_0046390
459 Ga0501036_0245690
460 Ga0501043_0044947
461 Ga0501047_0013554
462 Ga0501047_0042957
463 Ga0501047_0232330
464 Ga0501070_0048036
465 Ga0501081_0017310
466 Ga0501035_0208981
467 Ga0501035_0282818
468 Ga0501035_0304049
469 Ga0501044_0008370
470 nmdc:mga03n38_47068_c1
471 nmdc:mga06z11_19356_c1
472 nmdc:mga0n895_19605_c1
473 nmdc:mga0rr50_67159_c1
474 nmdc:mga08x19_48899_c1
475 nmdc:mga0a205_6776_c1
476 Ga0500635_0002654
477 Ga0500650_0068477
478 Ga0500554_008644
479 Ga0500562_010835
480 Ga0500562_025496
481 Ga0500595_018226
482 Ga0500658_0010514
483 Ga0500603_013796
484 Ga0500622_0095932
485 Ga0500634_0044770
486 Ga0500637_0055731
487 Ga0466962_0039356
488 Ga0530510_0104534
489 2883581653
490 2885392657
491 2894774014
492 8016588354

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02515

CoA_transf_3

CoA-transferase family III

25

393

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7z98-assembly1.cif.gz_A crystal structure of f191m variant variovorax paradoxus indole monooxygenase (vpinda1) in complex with methyl phenyl sulfide 0.8147 8 35
5x6r-assembly2.cif.gz_B crystal structure of saccharomyces cerevisiae kmo in complex with ro 61-8048 0.7964 8 36
3fg2-assembly1.cif.gz_P crystal structure of ferredoxin reductase for the cyp199a2 system from rhodopseudomonas palustris 0.7958 7 39
4mih-assembly2.cif.gz_E pyranose 2-oxidase from phanerochaete chrysosporium, recombinant h158a mutant 0.7945 7 36
1vkz-assembly2.cif.gz_B crystal structure of phosphoribosylamine--glycine ligase (tm1250) from thermotoga maritima at 2.30 a resolution 0.7942 7 38
ID Description Score Start End Superfamily
4hl6E02 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.9355 222 309 3.30.1540.10
af_Q68FU4_261_348_3.30.1540.10 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.9314 222 306 3.30.1540.10
4ed9A02 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.9179 222 309 3.30.1540.10
af_Q68FU4_261_348_3.30.1540.10 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.8819 222 306 3.30.1540.10
4hl6E02 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.8782 222 309 3.30.1540.10
ID Description Score Start End GO Terms
AF-A0A484C1R8-F1-model_v4 Uncharacterized protein 0.9676 4 124 GO:0005739
GO:0047369
AF-A0A6L4Z307-F1-model_v4 L-carnitine dehydratase/bile acid-inducible protein F 0.9567 6 124 GO:0008410
AF-A0A223B2K7-F1-model_v4 Uncharacterized protein 0.9567 6 126 GO:0008410
AF-A0A2H1JPH7-F1-model_v4 CoA-transferase family III 0.9484 4 118 GO:0008410
AF-A0A4S2GVW2-F1-model_v4 CoA transferase 0.9448 8 124 GO:0016740

Map