F357606

General Info

Members Datasets Scaffolds Average Seq Length
245 175 490 328

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0179407|Ga0466967_0179407_861_1922
Length 353
Sequence MRQRHLGSDGLVTSALGMGCMGLSQGYGPADDDESIRAIRRAAELGVTMFDTAMSYGQGHNERLIGRALAGLPWPVLIATKFGIVRDATGVHLDGRPEHVRGYCEASLARLGVEVIDLYYLHRVDPQVPIADTVGAMAQLVTEGKVRHLGVSEVTSAQLGQAAAVHPISAVQFEWSLLWREPEDDIIPAARRLGVGIVPYSPLGRGMLTATLTRADIDASDFRRGDPRFTGGDLDQNLARVAALRRVAGRLGLTPAQLALAWLLAQGPDVVPIPGTRRPGRIEQNAAAAGVDLTAADLRDLDDAVPRAGWAGDRQSFAAVATARRAGSDMPAGRQAGGPTGVSPGRGQDPAPG

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
50 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
51 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
73 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
75 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
76 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
77 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
78 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
79 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
80 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
81 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
82 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
83 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
84 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
85 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
88 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
89 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
90 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
91 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
92 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
93 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
94 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
95 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
96 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
97 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
98 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
99 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
100 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
101 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
102 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
103 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
104 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
105 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
106 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
107 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
108 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
109 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
110 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
111 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
112 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
113 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
114 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
115 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
116 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
117 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
118 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
119 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
120 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
121 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
122 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
123 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
124 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
125 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
126 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
127 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
128 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
129 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
130 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
131 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
132 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
133 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
134 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
143 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
144 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
145 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
146 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
153 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
154 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
155 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
156 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
157 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
158 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
159 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
160 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
161 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
162 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
163 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
164 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
165 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
166 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
167 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
168 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
169 2671180195 Frankia sp. CcI49 Isolate Nodule
170 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
171 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
172 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
173 2773857922 Frankia sp. CcI49 Isolate Nodule
174 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
175 8002775197 Frankia nepalensis CN7 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.14
Metatranscriptomes 0
Isolates 2.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.82
Nodule 2.04
Rhizoplane 6.12
Rhizosphere 87.35
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0179407 3300045976 Bacteria 1997
2 rootH2_10017588 3300003320 Bacteria 8270
3 JGI25160J50197_1015250 3300003354 Bacteria 2531
4 JGI25407J50210_10000566 3300003373 Bacteria 7448
5 JGI25407J50210_10001725 3300003373 Bacteria 5013
6 Ga0070658_10006452 3300005327 Bacteria 9507
7 Ga0070658_10082087 3300005327 Bacteria 2649
8 Ga0070676_10152107 3300005328 Bacteria 1482
9 Ga0070683_100139665 3300005329 Bacteria 2295
10 Ga0070680_100000507 3300005336 Bacteria 26782
11 Ga0070682_100215622 3300005337 Bacteria 1363
12 Ga0070674_100035212 3300005356 Bacteria 3352
13 Ga0070709_10025960 3300005434 Bacteria 3466
14 Ga0070714_100008472 3300005435 Bacteria 8032
15 Ga0070713_100196308 3300005436 Bacteria 1821
16 Ga0070713_100238702 3300005436 Bacteria 1655
17 Ga0070710_10008067 3300005437 Bacteria 5119
18 Ga0070711_100003937 3300005439 Bacteria 8727
19 Ga0070681_10009769 3300005458 Bacteria 9440
20 Ga0070706_100000901 3300005467 Bacteria 32562
21 Ga0070706_100054228 3300005467 Bacteria 3700
22 Ga0070706_100226416 3300005467 Bacteria 1745
23 Ga0070706_100258007 3300005467 Bacteria 1627
24 Ga0070707_100030055 3300005468 Bacteria 5169
25 Ga0070698_100017428 3300005471 Bacteria 7571
26 Ga0070698_100071251 3300005471 Bacteria 3486
27 Ga0070698_100135311 3300005471 Bacteria 2419
28 Ga0070698_100402178 3300005471 Bacteria 1303
29 Ga0070679_100000045 3300005530 Bacteria 93900
30 Ga0070679_100055541 3300005530 Bacteria 3943
31 Ga0070697_100019888 3300005536 Bacteria 5306
32 Ga0070697_100291091 3300005536 Bacteria 1403
33 Ga0068859_100000044 3300005617 Bacteria 144391
34 Ga0068861_100029497 3300005719 Bacteria 4013
35 Ga0068858_100000024 3300005842 Bacteria 166473
36 Ga0068862_100001101 3300005844 Bacteria 25645
37 Ga0081455_10001481 3300005937 Bacteria 29042
38 Ga0081455_10034212 3300005937 Bacteria 4555
39 Ga0081538_10000762 3300005981 Bacteria 35170
40 Ga0081538_10001474 3300005981 Bacteria 24181
41 Ga0081538_10005870 3300005981 Bacteria 10941
42 Ga0070717_10057976 3300006028 Bacteria 3201
43 Ga0070717_10123971 3300006028 Bacteria 2216
44 Ga0070712_100001252 3300006175 Bacteria 15346
45 Ga0070712_100046930 3300006175 Bacteria 2987
46 Ga0070712_100147418 3300006175 Bacteria 1803
47 Ga0075428_100015465 3300006844 Bacteria 8461
48 Ga0075431_100000494 3300006847 Bacteria 32786
49 Ga0075433_10049561 3300006852 Bacteria 3654
50 Ga0075433_10366634 3300006852 Bacteria 1272
51 Ga0075434_100015691 3300006871 Bacteria 7269
52 Ga0075434_100267498 3300006871 Bacteria 1729
53 Ga0075429_100087310 3300006880 Bacteria 2718
54 Ga0075436_100022661 3300006914 Bacteria 4315
55 Ga0097620_100000044 3300006931 Bacteria 144391
56 Ga0075435_100021974 3300007076 Bacteria 4917
57 Ga0111539_10001516 3300009094 Bacteria 30988
58 Ga0105245_10282275 3300009098 Bacteria 1623
59 Ga0114129_10000317 3300009147 Bacteria 56389
60 Ga0114129_10039767 3300009147 Bacteria 6633
61 Ga0105243_10071297 3300009148 Bacteria 2809
62 Ga0105239_10041391 3300010375 Bacteria 5050
63 Ga0163162_10215402 3300013306 Bacteria 2051
64 Ga0157372_10036703 3300013307 Bacteria 5403
65 Ga0157375_10446344 3300013308 Bacteria 1459
66 Ga0157380_10327575 3300014326 Bacteria 1423
67 Ga0157379_10001677 3300014968 Bacteria 18316
68 Ga0163161_10148797 3300017792 Bacteria 1778
69 Ga0213876_10004561 3300021384 Bacteria 7727
70 Ga0213875_10000381 3300021388 Bacteria 40170
71 Ga0207653_10008287 3300025885 Bacteria 3240
72 Ga0207692_10017776 3300025898 Bacteria 3177
73 Ga0207699_10043364 3300025906 Bacteria 2612
74 Ga0207705_10008302 3300025909 Bacteria 7584
75 Ga0207705_10067583 3300025909 Bacteria 2587
76 Ga0207684_10000298 3300025910 Bacteria 71028
77 Ga0207684_10002551 3300025910 Bacteria 18292
78 Ga0207684_10042851 3300025910 Bacteria 3838
79 Ga0207707_10000114 3300025912 Bacteria 81766
80 Ga0207693_10001109 3300025915 Bacteria 24225
81 Ga0207693_10021545 3300025915 Bacteria 5121
82 Ga0207693_10030076 3300025915 Bacteria 4288
83 Ga0207663_10053341 3300025916 Bacteria 2525
84 Ga0207660_10000460 3300025917 Bacteria 26861
85 Ga0207652_10017845 3300025921 Bacteria 5813
86 Ga0207652_10050193 3300025921 Bacteria 3574
87 Ga0207646_10059329 3300025922 Bacteria 3417
88 Ga0207646_10172970 3300025922 Bacteria 1950
89 Ga0207646_10395543 3300025922 Bacteria 1248
90 Ga0207700_10034196 3300025928 Bacteria 3646
91 Ga0207700_10134537 3300025928 Bacteria 2023
92 Ga0207664_10007356 3300025929 Bacteria 7631
93 Ga0207664_10405378 3300025929 Bacteria 1213
94 Ga0207709_10113114 3300025935 Bacteria 1819
95 Ga0207665_10003046 3300025939 Bacteria 11249
96 Ga0207661_10020335 3300025944 Bacteria 4961
97 Ga0207668_10033265 3300025972 Bacteria 3414
98 Ga0207703_10000005 3300026035 Bacteria 506356
99 Ga0207678_10051737 3300026067 Bacteria 3545
100 Ga0207675_100015703 3300026118 Bacteria 7062
101 Ga0207698_10161535 3300026142 Bacteria 1960
102 Ga0207428_10007404 3300027907 Bacteria 10008
103 Ga0268265_10000205 3300028380 Bacteria 68729
104 Ga0307409_100239252 3300031995 Bacteria 1651
105 Ga0307416_100320241 3300032002 Bacteria 1552
106 Ga0307416_100349575 3300032002 Bacteria 1495
107 Ga0307414_10227263 3300032004 Bacteria 1536
108 Ga0307415_100111432 3300032126 Bacteria 2031
109 Ga0373934_0059661 3300035086 Bacteria 1518
110 Ga0373953_0052270 3300035117 Bacteria 1653
111 Ga0373955_0056056 3300035172 Bacteria 2161
112 Ga0373924_0005852 3300035410 Bacteria 4378
113 Ga0373931_0253201 3300035691 Bacteria 1071
114 Ga0373935_0019439 3300035692 Bacteria 4142
115 Ga0373935_0028942 3300035692 Bacteria 3426
116 Ga0373935_0151235 3300035692 Bacteria 1575
117 Ga0373933_0054514 3300035724 Bacteria 2396
118 Ga0373933_0182186 3300035724 Bacteria 1340
119 Ga0373937_0282846 3300036401 Bacteria 1566
120 Ga0373925_0003231 3300037068 Bacteria 12729
121 Ga0373925_0153300 3300037068 Bacteria 1811
122 Ga0395900_0121368 3300037418 Bacteria 2681
123 Ga0436364_1564923 3300037853 Bacteria 76166
124 Ga0400483_200631 3300039062 Bacteria 18493
125 Ga0436365_1235482 3300039437 Bacteria 54275
126 Ga0466969_0044766 3300044656 Bacteria 2199
127 Ga0466966_0042166 3300044684 Bacteria 2931
128 Ga0466961_0125647 3300044693 Bacteria 1609
129 Ga0466963_0139432 3300044694 Bacteria 1679
130 Ga0466964_0040755 3300044706 Bacteria 1876
131 Ga0466970_0082503 3300044765 Bacteria 1739
132 Ga0466957_0015265 3300044842 Bacteria 4486
133 Ga0466958_0011368 3300045836 Bacteria 5014
134 Ga0466958_0081365 3300045836 Bacteria 1993
135 Ga0466967_0036890 3300045976 Bacteria 4178
136 Ga0466967_0040656 3300045976 Bacteria 4005
137 Ga0495629_0022363 3300046459 Bacteria 4509
138 Ga0495653_0057369 3300046463 Bacteria 2963
139 Ga0495582_0023956 3300046473 Bacteria 3337
140 Ga0495605_0041801 3300046474 Bacteria 2282
141 Ga0495662_0084779 3300046476 Bacteria 1542
142 Ga0495664_0008601 3300046477 Bacteria 5694
143 Ga0495584_0085086 3300046491 Bacteria 1593
144 Ga0495607_0056792 3300046501 Bacteria 2246
145 Ga0495608_0002686 3300046511 Bacteria 12778
146 Ga0495618_0029185 3300046514 Bacteria 3440
147 Ga0495618_0066529 3300046514 Bacteria 2291
148 Ga0495618_0340059 3300046514 Bacteria 926
149 Ga0495628_0005287 3300046516 Bacteria 11320
150 Ga0495628_0037367 3300046516 Bacteria 3893
151 Ga0495630_0064895 3300046517 Bacteria 2743
152 Ga0495637_0054811 3300046520 Bacteria 1655
153 Ga0495663_0083494 3300046525 Bacteria 1032
154 Ga0495652_0003084 3300046529 Bacteria 16680
155 Ga0495665_0023606 3300046531 Bacteria 3303
156 Ga0495640_0054890 3300046533 Bacteria 2727
157 Ga0495586_0012414 3300046535 Bacteria 4519
158 Ga0495587_0009438 3300046536 Bacteria 6254
159 Ga0495587_0056626 3300046536 Bacteria 2306
160 Ga0495667_0030112 3300046559 Bacteria 3649
161 Ga0495656_0009670 3300046615 Bacteria 3476
162 Ga0495634_0104751 3300046642 Bacteria 1824
163 Ga0495635_0002712 3300046663 Bacteria 12128
164 Ga0495635_0004051 3300046663 Bacteria 10167
165 Ga0495599_0035057 3300046678 Bacteria 3150
166 Ga0495658_0012273 3300046683 Bacteria 4334
167 Ga0495669_0021440 3300046684 Bacteria 2804
168 Ga0495670_0044200 3300046691 Bacteria 2224
169 Ga0495671_0070214 3300046692 Bacteria 1721
170 Ga0495589_0061278 3300046794 Bacteria 1847
171 Ga0495581_0009910 3300047315 Bacteria 5512
172 Ga0495674_0020375 3300047319 Bacteria 6140
173 Ga0495674_0058211 3300047319 Bacteria 3379
174 Ga0495674_0125879 3300047319 Bacteria 2162
175 Ga0495672_0069006 3300047320 Bacteria 2008
176 Ga0495675_0037227 3300047444 Bacteria 3098
177 Ga0495602_0011857 3300048088 Bacteria 8995
178 Ga0495602_0189936 3300048088 Bacteria 1576
179 Ga0495602_0254358 3300048088 Bacteria 1307
180 Ga0496100_0046438 3300048903 Bacteria 2793
181 Ga0496101_0110749 3300048904 Bacteria 2066
182 Ga0496102_0114819 3300048905 Bacteria 2512
183 Ga0496104_0001597 3300048907 Bacteria 19508
184 Ga0496104_0346973 3300048907 Bacteria 1397
185 Ga0496105_0042167 3300048908 Bacteria 3761
186 Ga0496106_0106619 3300048909 Bacteria 2178
187 Ga0496106_0357937 3300048909 Bacteria 1172
188 Ga0496107_0029677 3300048910 Bacteria 3893
189 Ga0496108_0103780 3300048911 Bacteria 2426
190 Ga0496109_0099595 3300048912 Bacteria 2696
191 Ga0496114_0034189 3300048917 Bacteria 4192
192 Ga0496114_0404890 3300048917 Bacteria 1208
193 Ga0496115_0041272 3300048918 Bacteria 3671
194 Ga0496115_0058743 3300048918 Bacteria 3096
195 Ga0496119_0007299 3300048922 Bacteria 10000
196 Ga0496121_0011754 3300048924 Bacteria 9658
197 Ga0501032_0063953 3300049569 Bacteria 2463
198 Ga0501034_0292957 3300049571 Bacteria 1565
199 Ga0501037_0120720 3300049573 Bacteria 1885
200 Ga0501038_0253084 3300049574 Bacteria 1394
201 Ga0501047_0006467 3300049581 Bacteria 11026
202 Ga0501048_0045026 3300049582 Bacteria 3153
203 Ga0501070_0003018 3300049586 Bacteria 14655
204 Ga0501070_0074754 3300049586 Bacteria 2805
205 Ga0501070_0077844 3300049586 Bacteria 2744
206 Ga0501074_0248909 3300049590 Bacteria 1264
207 Ga0501074_0315437 3300049590 Bacteria 1110
208 Ga0501080_0032145 3300049742 Bacteria 4892
209 Ga0501080_0036680 3300049742 Bacteria 4576
210 Ga0501080_0127218 3300049742 Bacteria 2359
211 Ga0501080_0374039 3300049742 Bacteria 1284
212 Ga0501044_0031176 3300049823 Bacteria 5613
213 Ga0501044_0080416 3300049823 Bacteria 3301
214 Ga0501044_0082490 3300049823 Bacteria 3253
215 Ga0501044_0213900 3300049823 Bacteria 1881
216 nmdc:mga05p37_57_c1 3300050507 Bacteria 96042
217 nmdc:mga05p37_77807_c1 3300050507 Bacteria 4084
218 nmdc:mga09592_82551_c1 3300050508 Bacteria 2739
219 nmdc:mga06r32_198758_c1 3300050510 Bacteria 1992
220 nmdc:mga06r32_854_c1 3300050510 Bacteria 27030
221 nmdc:mga08y16_6518_c1 3300050511 Bacteria 12242
222 nmdc:mga0n895_15257_c1 3300050512 Bacteria 7000
223 nmdc:mga0n895_50859_c1 3300050512 Bacteria 4064
224 nmdc:mga0a205_15490_c1 3300050515 Bacteria 7126
225 Ga0495601_0015056 3300053077 Bacteria 4670
226 Ga0495601_0058105 3300053077 Bacteria 2451
227 Ga0495601_0084227 3300053077 Bacteria 2042
228 Ga0495601_0141517 3300053077 Bacteria 1569
229 Ga0495601_0164965 3300053077 Bacteria 1448
230 Ga0495612_0002480 3300053078 Bacteria 7603
231 Ga0495612_0003394 3300053078 Bacteria 6598
232 Ga0495655_0001546 3300053083 Bacteria 3541
233 Ga0495595_0017144 3300053084 Bacteria 3113
234 Ga0495619_0020090 3300053085 Bacteria 4250
235 Ga0495619_0095590 3300053085 Bacteria 2016
236 Ga0500616_0009604 3300053153 Bacteria 5869
237 Ga0466962_0010427 3300061719 Bacteria 4467
238 Ga0466962_0084793 3300061719 Bacteria 1516
239 2671834331 2671180195 Bacteria 9757215
240 2676201968 2675902999 Bacteria 9438463
241 2731906664 2731639228 Bacteria 4187555
242 2774846544 2773857921 Bacteria 9435764
243 2774852487 2773857922 Bacteria 9757215
244 2915775892 2915768154 Bacteria 8424322
245 8002778027 8002775197 Bacteria 10728764
246 Ga0466967_0179407
247 rootH2_10017588
248 JGI25160J50197_1015250
249 JGI25407J50210_10000566
250 JGI25407J50210_10001725
251 Ga0070658_10006452
252 Ga0070658_10082087
253 Ga0070676_10152107
254 Ga0070683_100139665
255 Ga0070680_100000507
256 Ga0070682_100215622
257 Ga0070674_100035212
258 Ga0070709_10025960
259 Ga0070714_100008472
260 Ga0070713_100196308
261 Ga0070713_100238702
262 Ga0070710_10008067
263 Ga0070711_100003937
264 Ga0070681_10009769
265 Ga0070706_100000901
266 Ga0070706_100054228
267 Ga0070706_100226416
268 Ga0070706_100258007
269 Ga0070707_100030055
270 Ga0070698_100017428
271 Ga0070698_100071251
272 Ga0070698_100135311
273 Ga0070698_100402178
274 Ga0070679_100000045
275 Ga0070679_100055541
276 Ga0070697_100019888
277 Ga0070697_100291091
278 Ga0068859_100000044
279 Ga0068861_100029497
280 Ga0068858_100000024
281 Ga0068862_100001101
282 Ga0081455_10001481
283 Ga0081455_10034212
284 Ga0081538_10000762
285 Ga0081538_10001474
286 Ga0081538_10005870
287 Ga0070717_10057976
288 Ga0070717_10123971
289 Ga0070712_100001252
290 Ga0070712_100046930
291 Ga0070712_100147418
292 Ga0075428_100015465
293 Ga0075431_100000494
294 Ga0075433_10049561
295 Ga0075433_10366634
296 Ga0075434_100015691
297 Ga0075434_100267498
298 Ga0075429_100087310
299 Ga0075436_100022661
300 Ga0097620_100000044
301 Ga0075435_100021974
302 Ga0111539_10001516
303 Ga0105245_10282275
304 Ga0114129_10000317
305 Ga0114129_10039767
306 Ga0105243_10071297
307 Ga0105239_10041391
308 Ga0163162_10215402
309 Ga0157372_10036703
310 Ga0157375_10446344
311 Ga0157380_10327575
312 Ga0157379_10001677
313 Ga0163161_10148797
314 Ga0213876_10004561
315 Ga0213875_10000381
316 Ga0207653_10008287
317 Ga0207692_10017776
318 Ga0207699_10043364
319 Ga0207705_10008302
320 Ga0207705_10067583
321 Ga0207684_10000298
322 Ga0207684_10002551
323 Ga0207684_10042851
324 Ga0207707_10000114
325 Ga0207693_10001109
326 Ga0207693_10021545
327 Ga0207693_10030076
328 Ga0207663_10053341
329 Ga0207660_10000460
330 Ga0207652_10017845
331 Ga0207652_10050193
332 Ga0207646_10059329
333 Ga0207646_10172970
334 Ga0207646_10395543
335 Ga0207700_10034196
336 Ga0207700_10134537
337 Ga0207664_10007356
338 Ga0207664_10405378
339 Ga0207709_10113114
340 Ga0207665_10003046
341 Ga0207661_10020335
342 Ga0207668_10033265
343 Ga0207703_10000005
344 Ga0207678_10051737
345 Ga0207675_100015703
346 Ga0207698_10161535
347 Ga0207428_10007404
348 Ga0268265_10000205
349 Ga0307409_100239252
350 Ga0307416_100320241
351 Ga0307416_100349575
352 Ga0307414_10227263
353 Ga0307415_100111432
354 Ga0373934_0059661
355 Ga0373953_0052270
356 Ga0373955_0056056
357 Ga0373924_0005852
358 Ga0373931_0253201
359 Ga0373935_0019439
360 Ga0373935_0028942
361 Ga0373935_0151235
362 Ga0373933_0054514
363 Ga0373933_0182186
364 Ga0373937_0282846
365 Ga0373925_0003231
366 Ga0373925_0153300
367 Ga0395900_0121368
368 Ga0436364_1564923
369 Ga0400483_200631
370 Ga0436365_1235482
371 Ga0466969_0044766
372 Ga0466966_0042166
373 Ga0466961_0125647
374 Ga0466963_0139432
375 Ga0466964_0040755
376 Ga0466970_0082503
377 Ga0466957_0015265
378 Ga0466958_0011368
379 Ga0466958_0081365
380 Ga0466967_0036890
381 Ga0466967_0040656
382 Ga0495629_0022363
383 Ga0495653_0057369
384 Ga0495582_0023956
385 Ga0495605_0041801
386 Ga0495662_0084779
387 Ga0495664_0008601
388 Ga0495584_0085086
389 Ga0495607_0056792
390 Ga0495608_0002686
391 Ga0495618_0029185
392 Ga0495618_0066529
393 Ga0495618_0340059
394 Ga0495628_0005287
395 Ga0495628_0037367
396 Ga0495630_0064895
397 Ga0495637_0054811
398 Ga0495663_0083494
399 Ga0495652_0003084
400 Ga0495665_0023606
401 Ga0495640_0054890
402 Ga0495586_0012414
403 Ga0495587_0009438
404 Ga0495587_0056626
405 Ga0495667_0030112
406 Ga0495656_0009670
407 Ga0495634_0104751
408 Ga0495635_0002712
409 Ga0495635_0004051
410 Ga0495599_0035057
411 Ga0495658_0012273
412 Ga0495669_0021440
413 Ga0495670_0044200
414 Ga0495671_0070214
415 Ga0495589_0061278
416 Ga0495581_0009910
417 Ga0495674_0020375
418 Ga0495674_0058211
419 Ga0495674_0125879
420 Ga0495672_0069006
421 Ga0495675_0037227
422 Ga0495602_0011857
423 Ga0495602_0189936
424 Ga0495602_0254358
425 Ga0496100_0046438
426 Ga0496101_0110749
427 Ga0496102_0114819
428 Ga0496104_0001597
429 Ga0496104_0346973
430 Ga0496105_0042167
431 Ga0496106_0106619
432 Ga0496106_0357937
433 Ga0496107_0029677
434 Ga0496108_0103780
435 Ga0496109_0099595
436 Ga0496114_0034189
437 Ga0496114_0404890
438 Ga0496115_0041272
439 Ga0496115_0058743
440 Ga0496119_0007299
441 Ga0496121_0011754
442 Ga0501032_0063953
443 Ga0501034_0292957
444 Ga0501037_0120720
445 Ga0501038_0253084
446 Ga0501047_0006467
447 Ga0501048_0045026
448 Ga0501070_0003018
449 Ga0501070_0074754
450 Ga0501070_0077844
451 Ga0501074_0248909
452 Ga0501074_0315437
453 Ga0501080_0032145
454 Ga0501080_0036680
455 Ga0501080_0127218
456 Ga0501080_0374039
457 Ga0501044_0031176
458 Ga0501044_0080416
459 Ga0501044_0082490
460 Ga0501044_0213900
461 nmdc:mga05p37_57_c1
462 nmdc:mga05p37_77807_c1
463 nmdc:mga09592_82551_c1
464 nmdc:mga06r32_198758_c1
465 nmdc:mga06r32_854_c1
466 nmdc:mga08y16_6518_c1
467 nmdc:mga0n895_15257_c1
468 nmdc:mga0n895_50859_c1
469 nmdc:mga0a205_15490_c1
470 Ga0495601_0015056
471 Ga0495601_0058105
472 Ga0495601_0084227
473 Ga0495601_0141517
474 Ga0495601_0164965
475 Ga0495612_0002480
476 Ga0495612_0003394
477 Ga0495655_0001546
478 Ga0495595_0017144
479 Ga0495619_0020090
480 Ga0495619_0095590
481 Ga0500616_0009604
482 Ga0466962_0010427
483 Ga0466962_0084793
484 2671834331
485 2676201968
486 2731906664
487 2774846544
488 2774852487
489 2915775892
490 8002778027

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

15

306

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1pz0-assembly1.cif.gz_A structure of nadph-dependent family 11 aldo-keto reductase akr11a(holo) 0.944 2 285
3v0u-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.9315 1 287
3n2t-assembly1.cif.gz_A structure of the glycerol dehydrogenase akr11b4 from gluconobacter oxydans 0.9183 3 294
1pz1-assembly2.cif.gz_B structure of nadph-dependent family 11 aldo-keto reductase akr11b(holo) 0.9105 1 285
3v0u-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.9062 1 287
ID Description Score Start End Superfamily
af_P49249_9_269_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9641 2 227 3.20.20.100
af_F4HPY8_8_325_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9584 1 295 3.20.20.100
af_Q09923_6_337_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9533 4 295 3.20.20.100
af_A0A0R0ETH2_7_234_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9482 1 208 3.20.20.100
af_A0A0P0W8U8_11_146_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9464 1 127 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A328TDJ7-F1-model_v4 Aldo/keto reductase family protein 0.9828 118 203 GO:0004033
GO:0005737
AF-A0A4Q6A8B0-F1-model_v4 deleted 0.9774 2 172
AF-A0A4Q3GSW9-F1-model_v4 Aldo/keto reductase 0.9756 1 201 GO:0004033
GO:0005737
AF-U5D1Z7-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9695 1 207
AF-A0A2I0IYB2-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9683 90 295 GO:0004033
GO:0005737

Map