F357495

General Info

Members Datasets Scaffolds Average Seq Length
245 137 490 332

Family's Representative Sequence

Representative Sequence 3300031727|Ga0316576_10032109|Ga0316576_100321094
Length 368
Sequence MRVGRVVRQGTGWGRFTLGHGSSLGSDPVTTLQPPAGRSLDVACIGNAIVDVLAHTDDDFLARHGMVKGAMQLIDTEAALRIYGDMPPAVEVSGGAAANTAAGVAAFGARSAFVGKVADDELGQVFAHDIRAAGVHFDTVPATGEDAAPGTARCLVLVSPDAQRTLNTYLGVAALVGPDDVDPEVLARAAVVYCEGYLWDEPVAKAAIRKAMDSAHAAGTPVSFTLSDGFCVDRHREEFLDLVEGRIDILFANESEICSLYEVDDFDEAARRVRGHCAIACLTRSEKGSVILTADGDRADVAPVPAEVVDTTGAGDLYAAGFLAGWSRGADLGTAGRMASVAAGEVISHLGARPQRDLGALFAGTAPA

Samples

Sample ID Description Type Environment
1 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
52 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
84 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
85 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
86 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
87 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
88 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
89 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
90 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
91 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
92 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
95 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
96 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
97 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
98 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
99 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
105 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
106 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
107 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
108 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
109 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
110 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
111 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
112 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
113 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
114 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
115 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
116 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
117 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
118 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
125 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
126 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
127 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
128 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
129 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
131 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
132 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
133 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
134 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
135 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
136 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
137 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.96
Metatranscriptomes 0.41
Isolates 1.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.63
Nodule 0
Rhizoplane 1.22
Rhizosphere 93.88
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316576_10032109 3300031727 Bacteria 3730
2 JGI24736J21556_1000620 3300001904 Bacteria 6525
3 JGI24737J22298_10005589 3300001990 Bacteria 4332
4 JGI24749J21850_1000218 3300002076 Bacteria 8932
5 JGI24751J29686_10001155 3300002459 Bacteria 5647
6 JGI24751J29686_10012160 3300002459 Bacteria 1774
7 Ga0065707_10093614 3300005295 Bacteria 3603
8 Ga0070658_10035706 3300005327 Bacteria 4005
9 Ga0070670_100000178 3300005331 Bacteria 57676
10 Ga0070670_100018043 3300005331 Bacteria 6057
11 Ga0070666_10026680 3300005335 Bacteria 3777
12 Ga0070660_100002806 3300005339 Bacteria 11979
13 Ga0070660_100124551 3300005339 Bacteria 2059
14 Ga0070661_100000254 3300005344 Bacteria 43578
15 Ga0070661_100010124 3300005344 Bacteria 6548
16 Ga0070661_100021112 3300005344 Bacteria 4649
17 Ga0070661_100095497 3300005344 Bacteria 2205
18 Ga0070668_100000005 3300005347 Bacteria 187511
19 Ga0070669_100000119 3300005353 Bacteria 73001
20 Ga0070669_100071542 3300005353 Bacteria 2566
21 Ga0070671_100000842 3300005355 Bacteria 22309
22 Ga0070671_100018924 3300005355 Bacteria 5599
23 Ga0070671_100131153 3300005355 Bacteria 2111
24 Ga0070659_100033041 3300005366 Bacteria 4018
25 Ga0070667_100000004 3300005367 Bacteria 444091
26 Ga0070667_100000302 3300005367 Bacteria 55150
27 Ga0070667_100000407 3300005367 Bacteria 46001
28 Ga0070714_100016053 3300005435 Bacteria 6037
29 Ga0070663_100001867 3300005455 Bacteria 11752
30 Ga0070663_100108734 3300005455 Bacteria 2080
31 Ga0070681_10243016 3300005458 Bacteria 1714
32 Ga0068867_100048657 3300005459 Bacteria 3120
33 Ga0070706_100245948 3300005467 Bacteria 1670
34 Ga0068853_100009706 3300005539 Bacteria 7762
35 Ga0068853_100274534 3300005539 Bacteria 1553
36 Ga0068853_100324898 3300005539 Bacteria 1427
37 Ga0070693_100047700 3300005547 Bacteria 2438
38 Ga0070665_100188117 3300005548 Bacteria 2066
39 Ga0068855_100018325 3300005563 Bacteria 8410
40 Ga0068855_100065588 3300005563 Bacteria 4233
41 Ga0070664_100193455 3300005564 Bacteria 1813
42 Ga0070664_100244930 3300005564 Bacteria 1610
43 Ga0068857_100031926 3300005577 Bacteria 4654
44 Ga0068857_100047201 3300005577 Bacteria 3823
45 Ga0068857_100061314 3300005577 Bacteria 3341
46 Ga0068857_100271062 3300005577 Bacteria 1560
47 Ga0068854_100004256 3300005578 Bacteria 9013
48 Ga0068854_100005131 3300005578 Bacteria 8254
49 Ga0068854_100054270 3300005578 Bacteria 2881
50 Ga0068856_100005334 3300005614 Bacteria 12686
51 Ga0068856_100051151 3300005614 Bacteria 4074
52 Ga0068856_100176081 3300005614 Bacteria 2151
53 Ga0068856_100224147 3300005614 Bacteria 1895
54 Ga0068852_100000751 3300005616 Bacteria 21304
55 Ga0068852_100052222 3300005616 Bacteria 3512
56 Ga0068852_100053207 3300005616 Bacteria 3483
57 Ga0068859_100015247 3300005617 Bacteria 7718
58 Ga0068859_100101487 3300005617 Bacteria 2934
59 Ga0068859_100228628 3300005617 Bacteria 1948
60 Ga0068864_100000183 3300005618 Bacteria 57684
61 Ga0068864_100005975 3300005618 Bacteria 9984
62 Ga0068861_100028736 3300005719 Bacteria 4059
63 Ga0068851_10014976 3300005834 Bacteria 3689
64 Ga0068863_100003334 3300005841 Bacteria 15865
65 Ga0068863_100003363 3300005841 Bacteria 15795
66 Ga0068863_100047096 3300005841 Bacteria 4091
67 Ga0068858_100000248 3300005842 Bacteria 57728
68 Ga0068858_100031187 3300005842 Bacteria 4950
69 Ga0068860_100000002 3300005843 Bacteria 627849
70 Ga0068860_100000416 3300005843 Bacteria 55156
71 Ga0068862_100000011 3300005844 Bacteria 270105
72 Ga0068862_100000255 3300005844 Bacteria 59738
73 Ga0075364_10053403 3300006051 Bacteria 2642
74 Ga0070712_100036377 3300006175 Bacteria 3350
75 Ga0075366_10033449 3300006195 Bacteria 3028
76 Ga0097620_100015247 3300006931 Bacteria 7718
77 Ga0097620_100101484 3300006931 Bacteria 2934
78 Ga0097620_100228622 3300006931 Bacteria 1948
79 Ga0105240_10052309 3300009093 Bacteria 5135
80 Ga0105240_10056373 3300009093 Bacteria 4918
81 Ga0105248_10012635 3300009177 Bacteria 9317
82 Ga0157373_10002218 3300013100 Bacteria 14697
83 Ga0157370_10142010 3300013104 Bacteria 2237
84 Ga0157370_10259838 3300013104 Bacteria 1605
85 Ga0157369_10027597 3300013105 Bacteria 6290
86 Ga0157369_10035701 3300013105 Bacteria 5449
87 Ga0157369_10280513 3300013105 Bacteria 1735
88 Ga0157374_10002301 3300013296 Bacteria 16089
89 Ga0157380_10001430 3300014326 Bacteria 15629
90 Ga0157380_10035058 3300014326 Bacteria 3874
91 Ga0206353_10597566 3300020082 Bacteria 9318
92 Ga0213876_10029210 3300021384 Bacteria 2907
93 Ga0207656_10002673 3300025321 Bacteria 6041
94 Ga0207680_10021763 3300025903 Bacteria 3475
95 Ga0207647_10012739 3300025904 Bacteria 5844
96 Ga0207647_10038100 3300025904 Bacteria 3042
97 Ga0207645_10021190 3300025907 Bacteria 4241
98 Ga0207705_10014590 3300025909 Bacteria 5653
99 Ga0207705_10017457 3300025909 Bacteria 5138
100 Ga0207705_10029036 3300025909 Bacteria 3944
101 Ga0207695_10001271 3300025913 Bacteria 42892
102 Ga0207695_10006302 3300025913 Bacteria 15443
103 Ga0207657_10007311 3300025919 Bacteria 11327
104 Ga0207657_10023515 3300025919 Bacteria 5737
105 Ga0207657_10026790 3300025919 Bacteria 5289
106 Ga0207657_10132293 3300025919 Bacteria 2044
107 Ga0207649_10000026 3300025920 Bacteria 177395
108 Ga0207649_10000176 3300025920 Bacteria 52479
109 Ga0207649_10032827 3300025920 Bacteria 3097
110 Ga0207649_10106814 3300025920 Bacteria 1863
111 Ga0207649_10138468 3300025920 Bacteria 1662
112 Ga0207652_10131665 3300025921 Bacteria 2231
113 Ga0207681_10000001 3300025923 Bacteria 1105841
114 Ga0207681_10043399 3300025923 Bacteria 3009
115 Ga0207650_10000050 3300025925 Bacteria 169589
116 Ga0207650_10002361 3300025925 Bacteria 13125
117 Ga0207650_10223602 3300025925 Bacteria 1516
118 Ga0207664_10005160 3300025929 Bacteria 8901
119 Ga0207644_10002369 3300025931 Bacteria 12167
120 Ga0207644_10009559 3300025931 Bacteria 6368
121 Ga0207644_10286085 3300025931 Bacteria 1325
122 Ga0207690_10002692 3300025932 Bacteria 10716
123 Ga0207706_10022556 3300025933 Bacteria 5650
124 Ga0207706_10087933 3300025933 Bacteria 2732
125 Ga0207711_10024856 3300025941 Bacteria 5025
126 Ga0207679_10159189 3300025945 Bacteria 1847
127 Ga0207667_10098633 3300025949 Bacteria 3015
128 Ga0207668_10000008 3300025972 Bacteria 189904
129 Ga0207640_10000295 3300025981 Bacteria 33245
130 Ga0207640_10023981 3300025981 Bacteria 3674
131 Ga0207658_10000002 3300025986 Bacteria 1364188
132 Ga0207658_10000263 3300025986 Bacteria 55175
133 Ga0207658_10001469 3300025986 Bacteria 18347
134 Ga0207703_10009728 3300026035 Bacteria 7546
135 Ga0207678_10001415 3300026067 Bacteria 21990
136 Ga0207678_10002551 3300026067 Bacteria 16595
137 Ga0207678_10024551 3300026067 Bacteria 5265
138 Ga0207702_10003139 3300026078 Bacteria 15321
139 Ga0207702_10008747 3300026078 Bacteria 8536
140 Ga0207702_10100108 3300026078 Bacteria 2556
141 Ga0207702_10397990 3300026078 Bacteria 1328
142 Ga0207702_10423502 3300026078 Bacteria 1288
143 Ga0207641_10000339 3300026088 Bacteria 56902
144 Ga0207641_10002467 3300026088 Bacteria 17084
145 Ga0207641_10010094 3300026088 Bacteria 7764
146 Ga0207641_10103806 3300026088 Bacteria 2508
147 Ga0207676_10000004 3300026095 Bacteria 725417
148 Ga0207676_10004367 3300026095 Bacteria 10004
149 Ga0207674_10017174 3300026116 Bacteria 7897
150 Ga0207674_10046187 3300026116 Bacteria 4473
151 Ga0207674_10051662 3300026116 Bacteria 4194
152 Ga0207674_10096170 3300026116 Bacteria 2947
153 Ga0207675_100001128 3300026118 Bacteria 26498
154 Ga0207675_100047359 3300026118 Bacteria 4014
155 Ga0207698_10010450 3300026142 Bacteria 5965
156 Ga0207698_10052221 3300026142 Bacteria 3131
157 Ga0207698_10101102 3300026142 Bacteria 2390
158 Ga0207698_10237354 3300026142 Bacteria 1659
159 Ga0268265_10000002 3300028380 Bacteria 1035381
160 Ga0268265_10000994 3300028380 Bacteria 25764
161 Ga0268264_10000001 3300028381 Bacteria 1221000
162 Ga0268264_10000184 3300028381 Bacteria 131402
163 Ga0265331_10000008 3300031250 Bacteria 324311
164 Ga0265331_10000067 3300031250 Bacteria 158073
165 Ga0265327_10000036 3300031251 Bacteria 312827
166 Ga0265314_10162076 3300031711 Bacteria 1359
167 Ga0316576_10090193 3300031727 Bacteria 2283
168 Ga0316578_10028119 3300031728 Bacteria 3182
169 Ga0307405_10059031 3300031731 Bacteria 2416
170 Ga0316577_10003521 3300031733 Bacteria 7922
171 Ga0307413_10005253 3300031824 Bacteria 5753
172 Ga0307413_10073469 3300031824 Bacteria 2162
173 Ga0307410_10013692 3300031852 Bacteria 4743
174 Ga0307410_10058628 3300031852 Bacteria 2625
175 Ga0307410_10287741 3300031852 Bacteria 1292
176 Ga0307412_10006933 3300031911 Bacteria 6428
177 Ga0307412_10018009 3300031911 Bacteria 4240
178 Ga0307412_10066343 3300031911 Bacteria 2446
179 Ga0307409_100122887 3300031995 Bacteria 2202
180 Ga0307409_100196782 3300031995 Bacteria 1799
181 Ga0307416_100119181 3300032002 Bacteria 2347
182 Ga0307414_10043204 3300032004 Bacteria 3068
183 Ga0307414_10106897 3300032004 Bacteria 2119
184 Ga0307411_10014798 3300032005 Bacteria 4356
185 Ga0307411_10192193 3300032005 Bacteria 1559
186 Ga0316580_10019499 3300032139 Bacteria 2087
187 Ga0316574_0060396 3300035398 Bacteria 2379
188 Ga0316584_0125093 3300036712 Bacteria 1920
189 Ga0373925_0138763 3300037068 Bacteria 1902
190 Ga0395899_0034965 3300037312 Bacteria 3773
191 Ga0395899_0060546 3300037312 Bacteria 2789
192 Ga0395900_0001678 3300037418 Bacteria 25788
193 Ga0395900_0032883 3300037418 Bacteria 5335
194 Ga0395900_0054535 3300037418 Bacteria 4116
195 Ga0395900_0104948 3300037418 Bacteria 2903
196 Ga0395898_0003841 3300037466 Bacteria 16653
197 Ga0395898_0042513 3300037466 Bacteria 4482
198 Ga0395898_0118231 3300037466 Bacteria 2539
199 Ga0395898_0226090 3300037466 Bacteria 1785
200 Ga0395905_0000083 3300037471 Bacteria 158407
201 Ga0436364_1344735 3300037853 Bacteria 3103
202 Ga0436365_0821190 3300039437 Bacteria 17086
203 Ga0436365_1040722 3300039437 Bacteria 3544
204 Ga0466969_0005422 3300044656 Bacteria 6782
205 Ga0466966_0000004 3300044684 Bacteria 223594
206 Ga0466966_0010501 3300044684 Bacteria 6153
207 Ga0466966_0165891 3300044684 Bacteria 1343
208 Ga0466961_0027095 3300044693 Bacteria 3684
209 Ga0466963_0001967 3300044694 Bacteria 11280
210 Ga0466963_0012822 3300044694 Bacteria 5135
211 Ga0466963_0168188 3300044694 Bacteria 1527
212 Ga0466971_0002026 3300044719 Bacteria 8579
213 Ga0466957_0004237 3300044842 Bacteria 7953
214 Ga0466959_0035546 3300045049 Bacteria 3684
215 Ga0466959_0226106 3300045049 Bacteria 1296
216 Ga0466958_0001495 3300045836 Bacteria 11169
217 Ga0466967_0036479 3300045976 Bacteria 4197
218 Ga0496107_0025147 3300048910 Bacteria 4214
219 Ga0496110_0375376 3300048913 Bacteria 1296
220 Ga0496112_0006510 3300048915 Bacteria 10269
221 Ga0501032_0034509 3300049569 Bacteria 3463
222 Ga0501032_0044836 3300049569 Bacteria 2992
223 Ga0501033_0027756 3300049570 Bacteria 4255
224 Ga0501034_0157235 3300049571 Bacteria 2246
225 Ga0501038_0029315 3300049574 Bacteria 4878
226 Ga0501043_0113635 3300049579 Bacteria 2126
227 Ga0501047_0012115 3300049581 Bacteria 8163
228 Ga0501047_0171749 3300049581 Bacteria 2036
229 Ga0501047_0206181 3300049581 Bacteria 1825
230 Ga0501047_0372813 3300049581 Bacteria 1262
231 Ga0501069_0114352 3300049585 Bacteria 1539
232 Ga0501070_0047024 3300049586 Bacteria 3588
233 Ga0501073_0124159 3300049589 Bacteria 1789
234 Ga0501249_000370 3300049679 Bacteria 11828
235 Ga0501080_0082630 3300049742 Bacteria 2983
236 Ga0501035_0010036 3300049822 Bacteria 8787
237 Ga0501035_0028073 3300049822 Bacteria 5139
238 Ga0501044_0222798 3300049823 Bacteria 1836
239 Ga0500635_0068039 3300053080 Bacteria 1257
240 Ga0500555_001677 3300053103 Bacteria 6676
241 Ga0466962_0010660 3300061719 Bacteria 4421
242 2643730431 2643221541 Bacteria 5498788
243 2644037152 2643221605 Bacteria 4772303
244 2644043600 2643221606 Bacteria 5588032
245 2644393759 2643221671 Bacteria 5496681
246 Ga0316576_10032109
247 JGI24736J21556_1000620
248 JGI24737J22298_10005589
249 JGI24749J21850_1000218
250 JGI24751J29686_10001155
251 JGI24751J29686_10012160
252 Ga0065707_10093614
253 Ga0070658_10035706
254 Ga0070670_100000178
255 Ga0070670_100018043
256 Ga0070666_10026680
257 Ga0070660_100002806
258 Ga0070660_100124551
259 Ga0070661_100000254
260 Ga0070661_100010124
261 Ga0070661_100021112
262 Ga0070661_100095497
263 Ga0070668_100000005
264 Ga0070669_100000119
265 Ga0070669_100071542
266 Ga0070671_100000842
267 Ga0070671_100018924
268 Ga0070671_100131153
269 Ga0070659_100033041
270 Ga0070667_100000004
271 Ga0070667_100000302
272 Ga0070667_100000407
273 Ga0070714_100016053
274 Ga0070663_100001867
275 Ga0070663_100108734
276 Ga0070681_10243016
277 Ga0068867_100048657
278 Ga0070706_100245948
279 Ga0068853_100009706
280 Ga0068853_100274534
281 Ga0068853_100324898
282 Ga0070693_100047700
283 Ga0070665_100188117
284 Ga0068855_100018325
285 Ga0068855_100065588
286 Ga0070664_100193455
287 Ga0070664_100244930
288 Ga0068857_100031926
289 Ga0068857_100047201
290 Ga0068857_100061314
291 Ga0068857_100271062
292 Ga0068854_100004256
293 Ga0068854_100005131
294 Ga0068854_100054270
295 Ga0068856_100005334
296 Ga0068856_100051151
297 Ga0068856_100176081
298 Ga0068856_100224147
299 Ga0068852_100000751
300 Ga0068852_100052222
301 Ga0068852_100053207
302 Ga0068859_100015247
303 Ga0068859_100101487
304 Ga0068859_100228628
305 Ga0068864_100000183
306 Ga0068864_100005975
307 Ga0068861_100028736
308 Ga0068851_10014976
309 Ga0068863_100003334
310 Ga0068863_100003363
311 Ga0068863_100047096
312 Ga0068858_100000248
313 Ga0068858_100031187
314 Ga0068860_100000002
315 Ga0068860_100000416
316 Ga0068862_100000011
317 Ga0068862_100000255
318 Ga0075364_10053403
319 Ga0070712_100036377
320 Ga0075366_10033449
321 Ga0097620_100015247
322 Ga0097620_100101484
323 Ga0097620_100228622
324 Ga0105240_10052309
325 Ga0105240_10056373
326 Ga0105248_10012635
327 Ga0157373_10002218
328 Ga0157370_10142010
329 Ga0157370_10259838
330 Ga0157369_10027597
331 Ga0157369_10035701
332 Ga0157369_10280513
333 Ga0157374_10002301
334 Ga0157380_10001430
335 Ga0157380_10035058
336 Ga0206353_10597566
337 Ga0213876_10029210
338 Ga0207656_10002673
339 Ga0207680_10021763
340 Ga0207647_10012739
341 Ga0207647_10038100
342 Ga0207645_10021190
343 Ga0207705_10014590
344 Ga0207705_10017457
345 Ga0207705_10029036
346 Ga0207695_10001271
347 Ga0207695_10006302
348 Ga0207657_10007311
349 Ga0207657_10023515
350 Ga0207657_10026790
351 Ga0207657_10132293
352 Ga0207649_10000026
353 Ga0207649_10000176
354 Ga0207649_10032827
355 Ga0207649_10106814
356 Ga0207649_10138468
357 Ga0207652_10131665
358 Ga0207681_10000001
359 Ga0207681_10043399
360 Ga0207650_10000050
361 Ga0207650_10002361
362 Ga0207650_10223602
363 Ga0207664_10005160
364 Ga0207644_10002369
365 Ga0207644_10009559
366 Ga0207644_10286085
367 Ga0207690_10002692
368 Ga0207706_10022556
369 Ga0207706_10087933
370 Ga0207711_10024856
371 Ga0207679_10159189
372 Ga0207667_10098633
373 Ga0207668_10000008
374 Ga0207640_10000295
375 Ga0207640_10023981
376 Ga0207658_10000002
377 Ga0207658_10000263
378 Ga0207658_10001469
379 Ga0207703_10009728
380 Ga0207678_10001415
381 Ga0207678_10002551
382 Ga0207678_10024551
383 Ga0207702_10003139
384 Ga0207702_10008747
385 Ga0207702_10100108
386 Ga0207702_10397990
387 Ga0207702_10423502
388 Ga0207641_10000339
389 Ga0207641_10002467
390 Ga0207641_10010094
391 Ga0207641_10103806
392 Ga0207676_10000004
393 Ga0207676_10004367
394 Ga0207674_10017174
395 Ga0207674_10046187
396 Ga0207674_10051662
397 Ga0207674_10096170
398 Ga0207675_100001128
399 Ga0207675_100047359
400 Ga0207698_10010450
401 Ga0207698_10052221
402 Ga0207698_10101102
403 Ga0207698_10237354
404 Ga0268265_10000002
405 Ga0268265_10000994
406 Ga0268264_10000001
407 Ga0268264_10000184
408 Ga0265331_10000008
409 Ga0265331_10000067
410 Ga0265327_10000036
411 Ga0265314_10162076
412 Ga0316576_10090193
413 Ga0316578_10028119
414 Ga0307405_10059031
415 Ga0316577_10003521
416 Ga0307413_10005253
417 Ga0307413_10073469
418 Ga0307410_10013692
419 Ga0307410_10058628
420 Ga0307410_10287741
421 Ga0307412_10006933
422 Ga0307412_10018009
423 Ga0307412_10066343
424 Ga0307409_100122887
425 Ga0307409_100196782
426 Ga0307416_100119181
427 Ga0307414_10043204
428 Ga0307414_10106897
429 Ga0307411_10014798
430 Ga0307411_10192193
431 Ga0316580_10019499
432 Ga0316574_0060396
433 Ga0316584_0125093
434 Ga0373925_0138763
435 Ga0395899_0034965
436 Ga0395899_0060546
437 Ga0395900_0001678
438 Ga0395900_0032883
439 Ga0395900_0054535
440 Ga0395900_0104948
441 Ga0395898_0003841
442 Ga0395898_0042513
443 Ga0395898_0118231
444 Ga0395898_0226090
445 Ga0395905_0000083
446 Ga0436364_1344735
447 Ga0436365_0821190
448 Ga0436365_1040722
449 Ga0466969_0005422
450 Ga0466966_0000004
451 Ga0466966_0010501
452 Ga0466966_0165891
453 Ga0466961_0027095
454 Ga0466963_0001967
455 Ga0466963_0012822
456 Ga0466963_0168188
457 Ga0466971_0002026
458 Ga0466957_0004237
459 Ga0466959_0035546
460 Ga0466959_0226106
461 Ga0466958_0001495
462 Ga0466967_0036479
463 Ga0496107_0025147
464 Ga0496110_0375376
465 Ga0496112_0006510
466 Ga0501032_0034509
467 Ga0501032_0044836
468 Ga0501033_0027756
469 Ga0501034_0157235
470 Ga0501038_0029315
471 Ga0501043_0113635
472 Ga0501047_0012115
473 Ga0501047_0171749
474 Ga0501047_0206181
475 Ga0501047_0372813
476 Ga0501069_0114352
477 Ga0501070_0047024
478 Ga0501073_0124159
479 Ga0501249_000370
480 Ga0501080_0082630
481 Ga0501035_0010036
482 Ga0501035_0028073
483 Ga0501044_0222798
484 Ga0500635_0068039
485 Ga0500555_001677
486 Ga0466962_0010660
487 2643730431
488 2644037152
489 2644043600
490 2644393759

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00294

PfkB

pfkB family carbohydrate kinase

84

357

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4n08-assembly1.cif.gz_A structure of trypanosoma brucei brucei adenosine kinase (apo) 0.91 6 313
4e3a-assembly1.cif.gz_A crystal structure of probable sugar kinase protein from rhizobium etli cfn 42 0.9092 1 326
3ubo-assembly1.cif.gz_B the crystal structure of adenosine kinase from sinorhizobium meliloti 0.9071 6 326
1lio-assembly1.cif.gz_A structure of apo t. gondii adenosine kinase 0.8921 5 313
4e3a-assembly1.cif.gz_A crystal structure of probable sugar kinase protein from rhizobium etli cfn 42 0.8908 1 326
ID Description Score Start End Superfamily
af_Q7XBZ0_99_432_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9242 6 323 3.40.1190.20
3uboB00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.908 6 326 3.40.1190.20
af_K7VK13_1_174_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8975 81 202 3.40.1190.20
3uboB00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8892 6 326 3.40.1190.20
af_Q7XBZ0_99_432_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8868 6 323 3.40.1190.20
ID Description Score Start End GO Terms
AF-A0A7W9R4V1-F1-model_v4 deleted 0.9819 1 331
AF-A0A1L5BU63-F1-model_v4 Carbohydrate kinase 0.9799 6 331 GO:0016301
AF-A0A531KZL5-F1-model_v4 deleted 0.9773 131 326
AF-A0A359F550-F1-model_v4 Adenosine kinase 0.9771 212 331 GO:0016301
AF-A0A7W9BTN9-F1-model_v4 Sugar/nucleoside kinase (Ribokinase family) 0.9754 1 326 GO:0016301

Map