F357491

General Info

Members Datasets Scaffolds Average Seq Length
245 119 244 242

Family's Representative Sequence

Representative Sequence 3300031665|Ga0316575_10027758|Ga0316575_100277583
Length 267
Sequence MRRFFRVVIRNFLCRPDSIMIIIPAIDIQSGRCVRLLQGRKDDATVFSDDPAAMARRWAAAGAQLIHVVDLDGAFEKGPRNTVAIRAILDSVDVAVQVGGGVRDEQTIQNYLDAGVAKVVIGTAAVRDPDRVRAICSRFPDRIVLGIDARNGMVAVEGWTETTRIRAVDLARRFEECPVAAINFTDIHRDGMQTGVNIEETRRLAQSVSIPVVASGGISSLADIHQLLPLGAFGVCGVIVGRALYAGTLDLKQAIDSANAYLAQRQI

Samples

Sample ID Description Type Environment
1 2786546548 Spartobacteria bacterium LR76 Isolate Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
5 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
6 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
7 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
8 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
11 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
12 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
15 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
16 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
17 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
18 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
19 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
20 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
21 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
24 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
34 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
35 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
49 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
50 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
51 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
52 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
53 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
54 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
55 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
56 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
57 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
58 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
59 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
60 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
61 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
62 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
63 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
64 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
65 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
66 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
67 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
68 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
69 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
70 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
71 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
72 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
73 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
74 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
75 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
76 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
77 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
78 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
79 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
80 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
81 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
82 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
83 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
84 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
94 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
95 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
96 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
97 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
98 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
99 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
100 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
101 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
102 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
103 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
106 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
107 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
108 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
109 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
110 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
111 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
112 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
113 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
114 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
115 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
116 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
117 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
118 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
119 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.14
Metatranscriptomes 2.45
Isolates 0.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.41
Nodule 0
Rhizoplane 0.41
Rhizosphere 97.55
Stem 0
Stem Tuber 0
Unclassified 1.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10032308 3300005327 Bacteria 4208
2 Ga0070682_100180892 3300005337 Bacteria 1473
3 Ga0070701_10008686 3300005438 Bacteria 4409
4 Ga0070700_100510702 3300005441 Bacteria 926
5 Ga0070700_100657955 3300005441 Bacteria 828
6 Ga0070708_100058087 3300005445 Bacteria 3446
7 Ga0070708_100145647 3300005445 Bacteria 2200
8 Ga0070708_100261145 3300005445 Bacteria 1628
9 Ga0070706_100004983 3300005467 Bacteria 12715
10 Ga0070706_100007619 3300005467 Bacteria 10132
11 Ga0070706_100126979 3300005467 Bacteria 2379
12 Ga0070706_100267099 3300005467 Bacteria 1597
13 Ga0070707_100003079 3300005468 Bacteria 15793
14 Ga0070707_100035261 3300005468 Bacteria 4773
15 Ga0070707_100052370 3300005468 Bacteria 3913
16 Ga0070698_100003826 3300005471 Bacteria 16541
17 Ga0070698_100070324 3300005471 Bacteria 3512
18 Ga0070699_100019751 3300005518 Bacteria 5808
19 Ga0070699_100077317 3300005518 Bacteria 2897
20 Ga0070697_100053080 3300005536 Bacteria 3294
21 Ga0070697_100326482 3300005536 Bacteria 1322
22 Ga0070696_100156578 3300005546 Bacteria 1676
23 Ga0068855_100068149 3300005563 Bacteria 4143
24 Ga0070702_100640092 3300005615 Bacteria 803
25 Ga0068859_100177606 3300005617 Bacteria 2211
26 Ga0068859_100673617 3300005617 Bacteria 1126
27 Ga0068863_100150985 3300005841 Bacteria 2223
28 Ga0068858_100101159 3300005842 Bacteria 2688
29 Ga0068860_100115367 3300005843 Bacteria 2569
30 Ga0081540_1006469 3300005983 Bacteria 8524
31 Ga0070715_10041031 3300006163 Bacteria 1938
32 Ga0070712_100003464 3300006175 Bacteria 9715
33 Ga0075428_100037204 3300006844 Bacteria 5359
34 Ga0075430_100015537 3300006846 Bacteria 6482
35 Ga0075433_10224530 3300006852 Bacteria 1668
36 Ga0075433_10266188 3300006852 Bacteria 1519
37 Ga0075433_10333926 3300006852 Unclassified 1340
38 Ga0075434_100060615 3300006871 Bacteria 3763
39 Ga0075434_100202195 3300006871 Bacteria 2007
40 Ga0075434_100650868 3300006871 Bacteria 1072
41 Ga0075429_100007255 3300006880 Bacteria 9617
42 Ga0097620_100177619 3300006931 Bacteria 2211
43 Ga0097620_100673731 3300006931 Bacteria 1126
44 Ga0111539_10496495 3300009094 Bacteria 1421
45 Ga0105247_10196404 3300009101 Bacteria 1353
46 Ga0114129_10018301 3300009147 Bacteria 9979
47 Ga0114129_10439756 3300009147 Bacteria 1712
48 Ga0105249_10247295 3300009553 Bacteria 1766
49 Ga0105239_10006676 3300010375 Bacteria 13328
50 Ga0163162_10040488 3300013306 Bacteria 4660
51 Ga0163162_10286050 3300013306 Bacteria 1780
52 Ga0163162_11345139 3300013306 Bacteria 812
53 Ga0157376_10889819 3300014969 Bacteria 908
54 Ga0207685_10133080 3300025905 Bacteria 1106
55 Ga0207705_10007171 3300025909 Bacteria 8211
56 Ga0207684_10001053 3300025910 Bacteria 30859
57 Ga0207684_10001988 3300025910 Bacteria 21075
58 Ga0207684_10018274 3300025910 Bacteria 6002
59 Ga0207684_10468912 3300025910 Bacteria 1080
60 Ga0207693_10010921 3300025915 Bacteria 7362
61 Ga0207646_10002181 3300025922 Bacteria 23345
62 Ga0207646_10009042 3300025922 Bacteria 9897
63 Ga0207646_10125950 3300025922 Bacteria 2303
64 Ga0207646_10367661 3300025922 Bacteria 1299
65 Ga0207646_10434484 3300025922 Bacteria 1185
66 Ga0207644_10349777 3300025931 Bacteria 1200
67 Ga0207711_10205459 3300025941 Bacteria 1798
68 Ga0207667_10057065 3300025949 Bacteria 4100
69 Ga0207712_10397886 3300025961 Bacteria 1157
70 Ga0207658_10104098 3300025986 Bacteria 2230
71 Ga0207703_10080659 3300026035 Bacteria 2710
72 Ga0207641_10405710 3300026088 Bacteria 1309
73 Ga0268265_10433928 3300028380 Bacteria 1223
74 Ga0265318_10011577 3300028577 Bacteria 3791
75 Ga0265327_10063095 3300031251 Bacteria 1883
76 Ga0265316_10016749 3300031344 Bacteria 6349
77 Ga0316575_10008312 3300031665 Unclassified 3776
78 Ga0316575_10011677 3300031665 Bacteria 3254
79 Ga0316575_10027758 3300031665 Bacteria 2202
80 Ga0316575_10074268 3300031665 Bacteria 1368
81 Ga0316579_10001464 3300031691 Bacteria 8585
82 Ga0316579_10028552 3300031691 Bacteria 2540
83 Ga0316579_10032003 3300031691 Bacteria 2411
84 Ga0316579_10032385 3300031691 Bacteria 2397
85 Ga0316579_10048972 3300031691 Bacteria 1974
86 Ga0316576_10007604 3300031727 Bacteria 6836
87 Ga0316576_10024517 3300031727 Bacteria 4212
88 Ga0316576_10183514 3300031727 Bacteria 1578
89 Ga0316578_10002466 3300031728 Bacteria 8134
90 Ga0316578_10005549 3300031728 Bacteria 6129
91 Ga0316578_10006379 3300031728 Bacteria 5813
92 Ga0316578_10015387 3300031728 Bacteria 4111
93 Ga0316578_10038536 3300031728 Bacteria 2756
94 Ga0316578_10187867 3300031728 Bacteria 1245
95 Ga0316577_10003949 3300031733 Bacteria 7580
96 Ga0316577_10041836 3300031733 Bacteria 2564
97 Ga0316577_10117396 3300031733 Unclassified 1494
98 Ga0316577_10161760 3300031733 Bacteria 1263
99 Ga0307416_100119273 3300032002 Bacteria 2346
100 Ga0307415_100179928 3300032126 Bacteria 1658
101 Ga0316583_10000742 3300032133 Bacteria 10186
102 Ga0316583_10003247 3300032133 Bacteria 5712
103 Ga0316583_10003998 3300032133 Bacteria 5238
104 Ga0316583_10013458 3300032133 Bacteria 2952
105 Ga0316583_10013696 3300032133 Bacteria 2926
106 Ga0316583_10024788 3300032133 Bacteria 2142
107 Ga0316583_10153575 3300032133 Bacteria 801
108 Ga0316585_10000857 3300032137 Bacteria 7743
109 Ga0316585_10002598 3300032137 Bacteria 4887
110 Ga0316585_10004621 3300032137 Unclassified 3846
111 Ga0316585_10009536 3300032137 Bacteria 2836
112 Ga0316585_10017172 3300032137 Bacteria 2186
113 Ga0316580_10000821 3300032139 Bacteria 7611
114 Ga0316580_10001659 3300032139 Bacteria 5912
115 Ga0316580_10006204 3300032139 Bacteria 3523
116 Ga0316593_10004055 3300032168 Bacteria 3712
117 Ga0316593_10011283 3300032168 Bacteria 2592
118 Ga0316588_1002919 3300033528 Bacteria 3045
119 Ga0316588_1005312 3300033528 Unclassified 2497
120 Ga0316588_1008403 3300033528 Unclassified 2124
121 Ga0316596_1002706 3300033541 Bacteria 3810
122 Ga0373928_0000754 3300035084 Bacteria 6332
123 Ga0373932_0016511 3300035112 Bacteria 1885
124 Ga0316574_0000612 3300035398 Bacteria 14872
125 Ga0316574_0002024 3300035398 Bacteria 9986
126 Ga0316574_0012329 3300035398 Bacteria 4888
127 Ga0316574_0081321 3300035398 Bacteria 2057
128 Ga0316574_0154937 3300035398 Bacteria 1476
129 Ga0316582_0000351 3300036647 Bacteria 16329
130 Ga0316582_0000754 3300036647 Bacteria 12979
131 Ga0316582_0003353 3300036647 Bacteria 7836
132 Ga0316582_0027615 3300036647 Bacteria 3430
133 Ga0316582_0120679 3300036647 Bacteria 1753
134 Ga0316582_0158474 3300036647 Bacteria 1532
135 Ga0316582_0187422 3300036647 Unclassified 1408
136 Ga0316584_0002196 3300036712 Bacteria 12232
137 Ga0316584_0015636 3300036712 Bacteria 5429
138 Ga0316584_0022942 3300036712 Bacteria 4555
139 Ga0316584_0026380 3300036712 Bacteria 4270
140 Ga0316584_0036375 3300036712 Bacteria 3653
141 Ga0316584_0054628 3300036712 Unclassified 2989
142 Ga0316584_0106634 3300036712 Unclassified 2096
143 Ga0395900_0671839 3300037418 Bacteria 971
144 Ga0316581_0078399 3300037588 Bacteria 1016
145 Ga0436364_0975048 3300037853 Bacteria 3343
146 Ga0400483_076602 3300039062 Bacteria 21101
147 Ga0400489_60588 3300039093 Bacteria 1088
148 Ga0436360_0377020 3300039438 Bacteria 1540
149 Ga0436361_0410569 3300039447 Bacteria 1927
150 Ga0451795_0566977 3300041456 Unclassified 4009
151 Ga0439464_0054469 3300042439 Unclassified 1162
152 Ga0439460_0026299 3300042461 Bacteria 1627
153 Ga0451577_0000006 3300042876 Bacteria 709265
154 Ga0451577_0001251 3300042876 Bacteria 35154
155 Ga0451577_0001330 3300042876 Bacteria 33600
156 Ga0451577_0014865 3300042876 Bacteria 7252
157 Ga0451577_0039198 3300042876 Bacteria 4258
158 Ga0451577_0047860 3300042876 Bacteria 3821
159 Ga0451577_0070332 3300042876 Bacteria 3121
160 Ga0451577_0183934 3300042876 Bacteria 1884
161 Ga0451577_0193410 3300042876 Bacteria 1835
162 Ga0451577_0263104 3300042876 Bacteria 1562
163 Ga0451577_0370688 3300042876 Bacteria 1299
164 Ga0451577_0683094 3300042876 Bacteria 930
165 Ga0453683_0000001 3300044673 Bacteria 1384965
166 Ga0453683_0000019 3300044673 Bacteria 287249
167 Ga0453683_0000027 3300044673 Bacteria 248505
168 Ga0453683_0000132 3300044673 Bacteria 108582
169 Ga0453683_0000134 3300044673 Bacteria 108503
170 Ga0453683_0000185 3300044673 Bacteria 86588
171 Ga0453683_0002782 3300044673 Bacteria 13306
172 Ga0453683_0002907 3300044673 Bacteria 12952
173 Ga0453683_0035108 3300044673 Bacteria 3160
174 Ga0453683_0203862 3300044673 Bacteria 1256
175 Ga0453683_0207667 3300044673 Bacteria 1244
176 Ga0453684_0000037 3300044712 Bacteria 709327
177 Ga0453684_0000254 3300044712 Bacteria 229888
178 Ga0453684_0005480 3300044712 Bacteria 25106
179 Ga0453684_0008305 3300044712 Bacteria 18690
180 Ga0453684_0010760 3300044712 Bacteria 15535
181 Ga0453684_0042528 3300044712 Bacteria 6125
182 Ga0453684_0044320 3300044712 Bacteria 5955
183 Ga0453684_0054871 3300044712 Bacteria 5186
184 Ga0453684_0058391 3300044712 Bacteria 4984
185 Ga0453684_0058647 3300044712 Bacteria 4970
186 Ga0453684_0081533 3300044712 Bacteria 4035
187 Ga0453684_0117301 3300044712 Bacteria 3222
188 Ga0453684_0168347 3300044712 Bacteria 2585
189 Ga0453684_0325589 3300044712 Bacteria 1739
190 Ga0453684_1007704 3300044712 Bacteria 885
191 Ga0451576_0000453 3300045051 Bacteria 93077
192 Ga0451576_0000709 3300045051 Bacteria 67301
193 Ga0451576_0000871 3300045051 Bacteria 57999
194 Ga0451576_0010500 3300045051 Bacteria 10616
195 Ga0451576_0061835 3300045051 Bacteria 3905
196 Ga0451576_0094548 3300045051 Bacteria 3108
197 Ga0451576_0128211 3300045051 Bacteria 2644
198 Ga0451576_0281122 3300045051 Bacteria 1740
199 Ga0451576_0451004 3300045051 Bacteria 1350
200 Ga0451576_0777818 3300045051 Bacteria 1005
201 Ga0451576_0963495 3300045051 Bacteria 894
202 Ga0451576_1210483 3300045051 Bacteria 789
203 Ga0495582_0165682 3300046473 Bacteria 1258
204 Ga0501032_0033297 3300049569 Bacteria 3531
205 Ga0501034_0129289 3300049571 Bacteria 2509
206 Ga0501036_0044083 3300049572 Bacteria 3778
207 Ga0501037_0010293 3300049573 Bacteria 6863
208 Ga0501038_0001822 3300049574 Bacteria 19745
209 Ga0501040_0090578 3300049576 Bacteria 2126
210 Ga0501043_0002761 3300049579 Bacteria 14689
211 Ga0501047_0035373 3300049581 Bacteria 4825
212 Ga0501048_0153139 3300049582 Bacteria 1631
213 Ga0501067_0004358 3300049583 Bacteria 7796
214 Ga0501067_0127384 3300049583 Bacteria 1416
215 Ga0501071_0388530 3300049587 Bacteria 1065
216 Ga0501071_0859953 3300049587 Bacteria 699
217 Ga0501072_0136669 3300049588 Bacteria 1954
218 Ga0501073_0001770 3300049589 Bacteria 16060
219 Ga0501074_0018070 3300049590 Bacteria 5123
220 Ga0501075_0054600 3300049591 Bacteria 3006
221 Ga0501079_0669912 3300049741 Bacteria 817
222 Ga0501080_0078658 3300049742 Bacteria 3066
223 Ga0501081_0322571 3300049743 Bacteria 1135
224 Ga0501083_0017893 3300049744 Bacteria 4943
225 Ga0501083_0030670 3300049744 Bacteria 3692
226 Ga0501035_0009715 3300049822 Bacteria 8949
227 Ga0501035_0022850 3300049822 Bacteria 5743
228 Ga0501044_0029893 3300049823 Bacteria 5744
229 Ga0501045_0003361 3300049824 Bacteria 10962
230 nmdc:mga05p37_179929_c1 3300050507 Bacteria 2573
231 nmdc:mga05p37_57324_c1 3300050507 Bacteria 4798
232 nmdc:mga09592_14294_c1 3300050508 Bacteria 6480
233 nmdc:mga0qj67_28809_c1 3300050509 Bacteria 4312
234 nmdc:mga06r32_233670_c1 3300050510 Bacteria 1827
235 nmdc:mga08y16_517225_c1 3300050511 Bacteria 1211
236 nmdc:mga0n895_74925_c1 3300050512 Bacteria 3363
237 nmdc:mga0rr50_287373_c1 3300050513 Bacteria 1373
238 nmdc:mga08x19_238101_c1 3300050514 Bacteria 1254
239 nmdc:mga0a205_138437_c1 3300050515 Bacteria 2334
240 Ga0495601_0067522 3300053077 Bacteria 2278
241 Ga0495619_0014638 3300053085 Bacteria 4955
242 Ga0500616_0010682 3300053153 Bacteria 5480
243 Ga0501084_0675402 3300054114 Bacteria 872
244 Ga0501082_0060180 3300060353 Bacteria 3271

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049741 Ga0501079_0669912 Ga0501079_0669912_159_797 209
2 3300005471 Ga0070698_100070324 Ga0070698_1000703244 220
3 3300036712 Ga0316584_0022942 Ga0316584_0022942_3833_4501 220
4 3300042876 Ga0451577_0001251 Ga0451577_0001251_29485_30147 220
5 3300042876 Ga0451577_0193410 Ga0451577_0193410_234_905 220
6 3300042876 Ga0451577_0263104 Ga0451577_0263104_850_1524 220
7 3300044712 Ga0453684_0000254 Ga0453684_0000254_140748_141410 220
8 3300044712 Ga0453684_1007704 Ga0453684_1007704_173_847 220
9 3300045051 Ga0451576_0061835 Ga0451576_0061835_625_1287 220
10 3300045051 Ga0451576_0128211 Ga0451576_0128211_1817_2488 220
11 3300045051 Ga0451576_0777818 Ga0451576_0777818_319_987 220
12 3300045051 Ga0451576_1210483 Ga0451576_1210483_38_706 220
13 3300046473 Ga0495582_0165682 Ga0495582_0165682_22_696 221
14 3300053077 Ga0495601_0067522 Ga0495601_0067522_1110_1781 221
15 3300053085 Ga0495619_0014638 Ga0495619_0014638_2989_3660 221
16 3300044712 Ga0453684_0117301 Ga0453684_0117301_619_1347 222
17 3300049576 Ga0501040_0090578 Ga0501040_0090578_1368_2096 222
18 3300049587 Ga0501071_0388530 Ga0501071_0388530_100_828 222
19 3300049587 Ga0501071_0859953 Ga0501071_0859953_12_689 222
20 3300049588 Ga0501072_0136669 Ga0501072_0136669_894_1622 222
21 3300049743 Ga0501081_0322571 Ga0501081_0322571_173_901 222
22 3300032002 Ga0307416_100119273 Ga0307416_1001192734 225
23 3300032126 Ga0307415_100179928 Ga0307415_1001799282 225
24 3300044673 Ga0453683_0002782 Ga0453683_0002782_2820_3500 225
25 3300042876 Ga0451577_0000006 Ga0451577_0000006_257493_258227 227
26 3300044673 Ga0453683_0000019 Ga0453683_0000019_28119_28853 227
27 3300044712 Ga0453684_0000037 Ga0453684_0000037_257488_258222 227
28 3300005441 Ga0070700_100657955 Ga0070700_1006579551 229
29 3300005615 Ga0070702_100640092 Ga0070702_1006400921 229
30 3300006163 Ga0070715_10041031 Ga0070715_100410313 229
31 3300025905 Ga0207685_10133080 Ga0207685_101330802 229
32 3300035398 Ga0316574_0002024 Ga0316574_0002024_5622_6350 229
33 iso_pu_bacteria 2786546548 2787508137 229
34 3300049591 Ga0501075_0054600 Ga0501075_0054600_777_1499 231
35 3300054114 Ga0501084_0675402 Ga0501084_0675402_44_766 231
36 3300005518 Ga0070699_100019751 Ga0070699_1000197515 233
37 3300050514 nmdc:mga08x19_238101_c1 nmdc:mga08x19_238101_c1_324_1052 233
38 3300005438 Ga0070701_10008686 Ga0070701_100086865 237
39 3300005617 Ga0068859_100177606 Ga0068859_1001776062 237
40 3300006931 Ga0097620_100177619 Ga0097620_1001776192 237
41 3300009101 Ga0105247_10196404 Ga0105247_101964042 237
42 3300009553 Ga0105249_10247295 Ga0105249_102472952 237
43 3300013306 Ga0163162_11345139 Ga0163162_113451391 237
44 3300025941 Ga0207711_10205459 Ga0207711_102054593 237
45 3300025961 Ga0207712_10397886 Ga0207712_103978862 237
46 3300028380 Ga0268265_10433928 Ga0268265_104339282 237
47 3300005337 Ga0070682_100180892 Ga0070682_1001808922 238
48 3300005445 Ga0070708_100058087 Ga0070708_1000580874 238
49 3300005445 Ga0070708_100145647 Ga0070708_1001456472 238
50 3300005467 Ga0070706_100126979 Ga0070706_1001269793 238
51 3300005468 Ga0070707_100035261 Ga0070707_1000352617 238
52 3300005471 Ga0070698_100003826 Ga0070698_10000382617 238
53 3300005536 Ga0070697_100053080 Ga0070697_1000530803 238
54 3300005536 Ga0070697_100326482 Ga0070697_1003264822 238
55 3300005841 Ga0068863_100150985 Ga0068863_1001509853 238
56 3300005843 Ga0068860_100115367 Ga0068860_1001153672 238
57 3300006175 Ga0070712_100003464 Ga0070712_1000034642 238
58 3300006844 Ga0075428_100037204 Ga0075428_1000372044 238
59 3300006846 Ga0075430_100015537 Ga0075430_1000155372 238
60 3300006871 Ga0075434_100060615 Ga0075434_1000606153 238
61 3300006880 Ga0075429_100007255 Ga0075429_1000072558 238
62 3300009094 Ga0111539_10496495 Ga0111539_104964952 238
63 3300009147 Ga0114129_10018301 Ga0114129_100183017 238
64 3300014969 Ga0157376_10889819 Ga0157376_108898191 238
65 3300025910 Ga0207684_10001988 Ga0207684_100019883 238
66 3300025910 Ga0207684_10468912 Ga0207684_104689122 238
67 3300025915 Ga0207693_10010921 Ga0207693_100109214 238
68 3300025922 Ga0207646_10002181 Ga0207646_1000218119 238
69 3300025922 Ga0207646_10009042 Ga0207646_100090422 238
70 3300025922 Ga0207646_10367661 Ga0207646_103676612 238
71 3300025931 Ga0207644_10349777 Ga0207644_103497772 238
72 3300026088 Ga0207641_10405710 Ga0207641_104057102 238
73 3300039438 Ga0436360_0377020 Ga0436360_0377020_232_972 238
74 3300039447 Ga0436361_0410569 Ga0436361_0410569_242_982 238
75 3300041456 Ga0451795_0566977 Ga0451795_0566977_273_989 238
76 3300042461 Ga0439460_0026299 Ga0439460_0026299_731_1453 238
77 3300042876 Ga0451577_0047860 Ga0451577_0047860_1450_2169 238
78 3300042876 Ga0451577_0070332 Ga0451577_0070332_2051_2767 238
79 3300044673 Ga0453683_0002907 Ga0453683_0002907_10926_11642 238
80 3300044673 Ga0453683_0035108 Ga0453683_0035108_12_728 238
81 3300044712 Ga0453684_0325589 Ga0453684_0325589_428_1144 238
82 3300045051 Ga0451576_0281122 Ga0451576_0281122_205_921 238
83 3300049571 Ga0501034_0129289 Ga0501034_0129289_1398_2141 238
84 3300050507 nmdc:mga05p37_57324_c1 nmdc:mga05p37_57324_c1_1482_2240 238
85 3300050508 nmdc:mga09592_14294_c1 nmdc:mga09592_14294_c1_819_1577 238
86 3300050509 nmdc:mga0qj67_28809_c1 nmdc:mga0qj67_28809_c1_2229_2987 238
87 3300050510 nmdc:mga06r32_233670_c1 nmdc:mga06r32_233670_c1_596_1354 238
88 3300050511 nmdc:mga08y16_517225_c1 nmdc:mga08y16_517225_c1_112_834 238
89 3300050512 nmdc:mga0n895_74925_c1 nmdc:mga0n895_74925_c1_1083_1805 238
90 3300050513 nmdc:mga0rr50_287373_c1 nmdc:mga0rr50_287373_c1_352_1074 238
91 3300053153 Ga0500616_0010682 Ga0500616_0010682_839_1591 238
92 3300005467 Ga0070706_100004983 Ga0070706_1000049838 239
93 3300005468 Ga0070707_100003079 Ga0070707_1000030792 239
94 3300005468 Ga0070707_100052370 Ga0070707_1000523703 239
95 3300005546 Ga0070696_100156578 Ga0070696_1001565782 239
96 3300005983 Ga0081540_1006469 Ga0081540_10064695 239
97 3300006852 Ga0075433_10224530 Ga0075433_102245303 239
98 3300006871 Ga0075434_100650868 Ga0075434_1006508682 239
99 3300025910 Ga0207684_10001053 Ga0207684_1000105318 239
100 3300025922 Ga0207646_10125950 Ga0207646_101259502 239
101 3300031344 Ga0265316_10016749 Ga0265316_100167498 239
102 3300037853 Ga0436364_0975048 Ga0436364_0975048_874_1593 239
103 3300042876 Ga0451577_0039198 Ga0451577_0039198_1394_2122 239
104 3300049583 Ga0501067_0004358 Ga0501067_0004358_6640_7362 239
105 3300049744 Ga0501083_0017893 Ga0501083_0017893_641_1369 239
106 3300050507 nmdc:mga05p37_179929_c1 nmdc:mga05p37_179929_c1_446_1168 239
107 3300050515 nmdc:mga0a205_138437_c1 nmdc:mga0a205_138437_c1_943_1665 239
108 3300005467 Ga0070706_100267099 Ga0070706_1002670992 240
109 3300025922 Ga0207646_10434484 Ga0207646_104344842 240
110 3300049824 Ga0501045_0003361 Ga0501045_0003361_3733_4467 240
111 3300005441 Ga0070700_100510702 Ga0070700_1005107021 241
112 3300005445 Ga0070708_100261145 Ga0070708_1002611452 241
113 3300005467 Ga0070706_100007619 Ga0070706_10000761910 241
114 3300005518 Ga0070699_100077317 Ga0070699_1000773172 241
115 3300005617 Ga0068859_100673617 Ga0068859_1006736172 241
116 3300005842 Ga0068858_100101159 Ga0068858_1001011593 241
117 3300006852 Ga0075433_10266188 Ga0075433_102661882 241
118 3300006852 Ga0075433_10333926 Ga0075433_103339262 241
119 3300006871 Ga0075434_100202195 Ga0075434_1002021952 241
120 3300006931 Ga0097620_100673731 Ga0097620_1006737312 241
121 3300009147 Ga0114129_10439756 Ga0114129_104397562 241
122 3300013306 Ga0163162_10040488 Ga0163162_100404888 241
123 3300013306 Ga0163162_10286050 Ga0163162_102860502 241
124 3300025910 Ga0207684_10018274 Ga0207684_100182746 241
125 3300025986 Ga0207658_10104098 Ga0207658_101040982 241
126 3300026035 Ga0207703_10080659 Ga0207703_100806593 241
127 3300028577 Ga0265318_10011577 Ga0265318_100115772 241
128 3300031251 Ga0265327_10063095 Ga0265327_100630952 241
129 3300031665 Ga0316575_10008312 Ga0316575_100083124 241
130 3300031665 Ga0316575_10011677 Ga0316575_100116772 241
131 3300031665 Ga0316575_10027758 Ga0316575_100277583 241
132 3300031665 Ga0316575_10074268 Ga0316575_100742682 241
133 3300031691 Ga0316579_10001464 Ga0316579_100014646 241
134 3300031691 Ga0316579_10028552 Ga0316579_100285523 241
135 3300031691 Ga0316579_10032003 Ga0316579_100320032 241
136 3300031691 Ga0316579_10032385 Ga0316579_100323852 241
137 3300031691 Ga0316579_10048972 Ga0316579_100489723 241
138 3300031727 Ga0316576_10007604 Ga0316576_100076045 241
139 3300031727 Ga0316576_10024517 Ga0316576_100245172 241
140 3300031727 Ga0316576_10183514 Ga0316576_101835141 241
141 3300031728 Ga0316578_10002466 Ga0316578_100024662 241
142 3300031728 Ga0316578_10005549 Ga0316578_100055493 241
143 3300031728 Ga0316578_10006379 Ga0316578_100063792 241
144 3300031728 Ga0316578_10015387 Ga0316578_100153871 241
145 3300031728 Ga0316578_10038536 Ga0316578_100385361 241
146 3300031728 Ga0316578_10187867 Ga0316578_101878672 241
147 3300031733 Ga0316577_10003949 Ga0316577_100039493 241
148 3300031733 Ga0316577_10041836 Ga0316577_100418361 241
149 3300031733 Ga0316577_10117396 Ga0316577_101173962 241
150 3300031733 Ga0316577_10161760 Ga0316577_101617601 241
151 3300032133 Ga0316583_10000742 Ga0316583_100007424 241
152 3300032133 Ga0316583_10003247 Ga0316583_100032471 241
153 3300032133 Ga0316583_10003998 Ga0316583_100039984 241
154 3300032133 Ga0316583_10013458 Ga0316583_100134582 241
155 3300032133 Ga0316583_10013696 Ga0316583_100136962 241
156 3300032133 Ga0316583_10024788 Ga0316583_100247882 241
157 3300032133 Ga0316583_10153575 Ga0316583_101535751 241
158 3300032137 Ga0316585_10000857 Ga0316585_100008574 241
159 3300032137 Ga0316585_10002598 Ga0316585_100025983 241
160 3300032137 Ga0316585_10004621 Ga0316585_100046214 241
161 3300032137 Ga0316585_10009536 Ga0316585_100095362 241
162 3300032137 Ga0316585_10017172 Ga0316585_100171722 241
163 3300032139 Ga0316580_10000821 Ga0316580_100008211 241
164 3300032139 Ga0316580_10001659 Ga0316580_100016593 241
165 3300032139 Ga0316580_10006204 Ga0316580_100062044 241
166 3300032168 Ga0316593_10004055 Ga0316593_100040553 241
167 3300032168 Ga0316593_10011283 Ga0316593_100112832 241
168 3300033528 Ga0316588_1002919 Ga0316588_10029193 241
169 3300033528 Ga0316588_1005312 Ga0316588_10053123 241
170 3300033528 Ga0316588_1008403 Ga0316588_10084032 241
171 3300033541 Ga0316596_1002706 Ga0316596_10027062 241
172 3300035084 Ga0373928_0000754 Ga0373928_0000754_5051_5785 241
173 3300035112 Ga0373932_0016511 Ga0373932_0016511_941_1675 241
174 3300035398 Ga0316574_0000612 Ga0316574_0000612_12929_13672 241
175 3300035398 Ga0316574_0012329 Ga0316574_0012329_272_1003 241
176 3300035398 Ga0316574_0081321 Ga0316574_0081321_144_890 241
177 3300035398 Ga0316574_0154937 Ga0316574_0154937_700_1434 241
178 3300036647 Ga0316582_0000351 Ga0316582_0000351_14386_15129 241
179 3300036647 Ga0316582_0000754 Ga0316582_0000754_507_1250 241
180 3300036647 Ga0316582_0003353 Ga0316582_0003353_6377_7123 241
181 3300036647 Ga0316582_0027615 Ga0316582_0027615_567_1331 241
182 3300036647 Ga0316582_0120679 Ga0316582_0120679_112_858 241
183 3300036647 Ga0316582_0187422 Ga0316582_0187422_114_917 241
184 3300036712 Ga0316584_0002196 Ga0316584_0002196_2037_2780 241
185 3300036712 Ga0316584_0015636 Ga0316584_0015636_1637_2437 241
186 3300036712 Ga0316584_0026380 Ga0316584_0026380_3145_3891 241
187 3300036712 Ga0316584_0036375 Ga0316584_0036375_1200_1943 241
188 3300036712 Ga0316584_0054628 Ga0316584_0054628_1024_1770 241
189 3300036712 Ga0316584_0106634 Ga0316584_0106634_131_934 241
190 3300037418 Ga0395900_0671839 Ga0395900_0671839_67_807 241
191 3300037588 Ga0316581_0078399 Ga0316581_0078399_129_860 241
192 3300039062 Ga0400483_076602 Ga0400483_076602_5149_5898 241
193 3300039093 Ga0400489_60588 Ga0400489_60588_70_813 241
194 3300042439 Ga0439464_0054469 Ga0439464_0054469_427_1152 241
195 3300042876 Ga0451577_0001330 Ga0451577_0001330_5948_6685 241
196 3300042876 Ga0451577_0014865 Ga0451577_0014865_5888_6625 241
197 3300042876 Ga0451577_0183934 Ga0451577_0183934_612_1349 241
198 3300042876 Ga0451577_0370688 Ga0451577_0370688_547_1275 241
199 3300042876 Ga0451577_0683094 Ga0451577_0683094_18_749 241
200 3300044673 Ga0453683_0000001 Ga0453683_0000001_13483_14208 241
201 3300044673 Ga0453683_0000027 Ga0453683_0000027_25812_26549 241
202 3300044673 Ga0453683_0000132 Ga0453683_0000132_53696_54433 241
203 3300044673 Ga0453683_0000134 Ga0453683_0000134_107125_107856 241
204 3300044673 Ga0453683_0000185 Ga0453683_0000185_41961_42698 241
205 3300044673 Ga0453683_0203862 Ga0453683_0203862_133_861 241
206 3300044673 Ga0453683_0207667 Ga0453683_0207667_131_862 241
207 3300044712 Ga0453684_0005480 Ga0453684_0005480_9870_10607 241
208 3300044712 Ga0453684_0008305 Ga0453684_0008305_6175_6912 241
209 3300044712 Ga0453684_0010760 Ga0453684_0010760_5000_5731 241
210 3300044712 Ga0453684_0042528 Ga0453684_0042528_3956_4693 241
211 3300044712 Ga0453684_0044320 Ga0453684_0044320_3716_4444 241
212 3300044712 Ga0453684_0054871 Ga0453684_0054871_2705_3442 241
213 3300044712 Ga0453684_0058391 Ga0453684_0058391_869_1594 241
214 3300044712 Ga0453684_0058647 Ga0453684_0058647_3558_4289 241
215 3300044712 Ga0453684_0081533 Ga0453684_0081533_2722_3459 241
216 3300044712 Ga0453684_0168347 Ga0453684_0168347_1321_2052 241
217 3300045051 Ga0451576_0000453 Ga0451576_0000453_6244_6978 241
218 3300045051 Ga0451576_0000709 Ga0451576_0000709_15979_16710 241
219 3300045051 Ga0451576_0000871 Ga0451576_0000871_50756_51487 241
220 3300045051 Ga0451576_0010500 Ga0451576_0010500_8465_9202 241
221 3300045051 Ga0451576_0094548 Ga0451576_0094548_1515_2240 241
222 3300045051 Ga0451576_0451004 Ga0451576_0451004_486_1220 241
223 3300045051 Ga0451576_0963495 Ga0451576_0963495_15_755 241
224 3300049569 Ga0501032_0033297 Ga0501032_0033297_1354_2088 241
225 3300049572 Ga0501036_0044083 Ga0501036_0044083_1845_2579 241
226 3300049573 Ga0501037_0010293 Ga0501037_0010293_5600_6334 241
227 3300049574 Ga0501038_0001822 Ga0501038_0001822_15952_16686 241
228 3300049579 Ga0501043_0002761 Ga0501043_0002761_13209_13943 241
229 3300049581 Ga0501047_0035373 Ga0501047_0035373_1757_2491 241
230 3300049582 Ga0501048_0153139 Ga0501048_0153139_470_1204 241
231 3300049583 Ga0501067_0127384 Ga0501067_0127384_454_1188 241
232 3300049589 Ga0501073_0001770 Ga0501073_0001770_1519_2253 241
233 3300049590 Ga0501074_0018070 Ga0501074_0018070_85_819 241
234 3300049742 Ga0501080_0078658 Ga0501080_0078658_1002_1736 241
235 3300049744 Ga0501083_0030670 Ga0501083_0030670_2234_2968 241
236 3300049822 Ga0501035_0009715 Ga0501035_0009715_7639_8364 241
237 3300049822 Ga0501035_0022850 Ga0501035_0022850_299_1033 241
238 3300049823 Ga0501044_0029893 Ga0501044_0029893_32_766 241
239 3300060353 Ga0501082_0060180 Ga0501082_0060180_2105_2839 241
240 3300005563 Ga0068855_100068149 Ga0068855_1000681492 242
241 3300025949 Ga0207667_10057065 Ga0207667_100570657 242
242 3300036647 Ga0316582_0158474 Ga0316582_0158474_545_1318 243
243 3300005327 Ga0070658_10032308 Ga0070658_100323083 247
244 3300010375 Ga0105239_10006676 Ga0105239_100066763 247
245 3300025909 Ga0207705_10007171 Ga0207705_100071713 247

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00977

His_biosynth

Histidine biosynthesis protein

21

250

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4x2r-assembly1.cif.gz_A crystal structure of pria from actinomyces urogenitalis 0.9568 1 242
4u28-assembly1.cif.gz_A crystal structure of apo phosphoribosyl isomerase a from streptomyces sviceus atcc 29083 0.9567 1 243
4w9t-assembly1.cif.gz_A crystal structure of hisap from streptomyces sp. mg1 0.9557 1 243
4tx9-assembly1.cif.gz_A crystal structure of hisap from streptomyces sviceus with degraded profar 0.9556 1 247
4x9s-assembly1.cif.gz_A crystal structure of hisap from streptomyces sp. mg1 0.9551 1 247
ID Description Score Start End Superfamily
4x2rA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9567 1 242 3.20.20.70
af_Q58927_1_237_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9553 1 247 3.20.20.70
af_Q58927_1_237_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9514 1 247 3.20.20.70
af_Q2FUU2_4_232_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9464 4 232 3.20.20.70
af_P10371_1_245_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9347 2 246 3.20.20.70
ID Description Score Start End GO Terms
AF-S0EVZ1-F1-model_v4 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (EC 5.3.1.16) (Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase) 0.9931 1 246 GO:0000105
GO:0000162
GO:0003949
GO:0005737
AF-A0A535FKL3-F1-model_v4 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (EC 5.3.1.16) (Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase) 0.9894 1 244 GO:0000105
GO:0000162
GO:0003949
GO:0005737
AF-A0A399FYW8-F1-model_v4 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (EC 5.3.1.16) (Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase) 0.9886 1 243 GO:0000105
GO:0000162
GO:0003949
GO:0005737
AF-A0A7C9RI88-F1-model_v4 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (EC 5.3.1.16) (Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase) 0.9879 1 243 GO:0000105
GO:0000162
GO:0003949
GO:0005737
AF-A0A2K2FIQ8-F1-model_v4 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (EC 5.3.1.16) (Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase) 0.9872 1 243 GO:0000105
GO:0000162
GO:0003949
GO:0005737

Feature Viewer

pLDDT pTM Quality
94.38 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map