F357390

General Info

Members Datasets Scaffolds Average Seq Length
245 156 490 161

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10495251|Ga0157380_104952512
Length 193
Sequence MARRFWLMKCEPAAYTIDDLARDGRTSWEGVRNYQARNFMRDQMQEGDGVLFYASNADPSGVTGLATIARAAYPDHFALKKGHKYFDEAGSAESPVWYMVDVAFVERFAAIVPLETLKSTPGLEKMMVIQKGSRLSVQPVTPAEYDIVVGLGHGGAKDAAAGTETPSRPRTAPKATGSGTATRRGAKSKSARR

Samples

Sample ID Description Type Environment
1 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
2 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
111 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
114 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
115 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
116 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
117 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
118 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
119 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
120 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
121 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
124 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
125 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
126 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
127 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
133 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
134 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
135 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
136 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
137 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
138 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
139 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
140 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
141 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
142 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
143 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
144 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
145 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
146 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
147 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
148 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
149 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
150 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
151 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
152 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
153 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
154 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
155 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
156 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0.41
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.84
Nodule 0
Rhizoplane 3.67
Rhizosphere 82.86
Stem 0
Stem Tuber 0
Unclassified 7.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157380_10495251 3300014326 Bacteria 1186
2 Ga0058860_11976662 3300004801 Bacteria 2672
3 Ga0065707_10130342 3300005295 Bacteria 1931
4 Ga0070658_10128791 3300005327 Bacteria 2108
5 Ga0070676_10260534 3300005328 Bacteria 1161
6 Ga0070676_10992782 3300005328 Bacteria 630
7 Ga0070690_100130780 3300005330 Bacteria 1695
8 Ga0070690_100719857 3300005330 Unclassified 768
9 Ga0070670_100093318 3300005331 Bacteria 2589
10 Ga0070670_101267376 3300005331 Unclassified 674
11 Ga0070670_101375589 3300005331 Unclassified 647
12 Ga0070677_10081688 3300005333 Bacteria 1384
13 Ga0070666_10397156 3300005335 Bacteria 991
14 Ga0070660_100042346 3300005339 Bacteria 3475
15 Ga0070689_100500590 3300005340 Bacteria 1041
16 Ga0070691_10397488 3300005341 Bacteria 776
17 Ga0070675_100002881 3300005354 Bacteria 12966
18 Ga0070675_100035950 3300005354 Bacteria 4027
19 Ga0070675_100262711 3300005354 Bacteria 1513
20 Ga0070671_100148763 3300005355 Bacteria 1977
21 Ga0070674_100009372 3300005356 Bacteria 5863
22 Ga0070674_101271093 3300005356 Bacteria 655
23 Ga0070673_100010378 3300005364 Bacteria 6305
24 Ga0070673_100452193 3300005364 Bacteria 1155
25 Ga0070688_100088124 3300005365 Bacteria 2023
26 Ga0070688_100478235 3300005365 Bacteria 936
27 Ga0070659_100302316 3300005366 Bacteria 1335
28 Ga0070659_100472820 3300005366 Bacteria 1066
29 Ga0070659_100809695 3300005366 Bacteria 815
30 Ga0070667_100227746 3300005367 Unclassified 1661
31 Ga0070694_101027735 3300005444 Bacteria 685
32 Ga0070678_100133511 3300005456 Bacteria 1976
33 Ga0068867_101038339 3300005459 Bacteria 745
34 Ga0070685_10312172 3300005466 Bacteria 1063
35 Ga0070679_100025649 3300005530 Bacteria 5785
36 Ga0070684_100395548 3300005535 Bacteria 1274
37 Ga0070684_100547212 3300005535 Unclassified 1074
38 Ga0068853_100461247 3300005539 Bacteria 1196
39 Ga0070672_100010243 3300005543 Bacteria 6495
40 Ga0070672_100145294 3300005543 Bacteria 1959
41 Ga0070672_100321791 3300005543 Bacteria 1315
42 Ga0070686_101818581 3300005544 Bacteria 519
43 Ga0070665_100214414 3300005548 Unclassified 1926
44 Ga0070665_100221003 3300005548 Unclassified 1895
45 Ga0070665_100356172 3300005548 Bacteria 1469
46 Ga0068855_100005774 3300005563 Bacteria 15104
47 Ga0070664_100157773 3300005564 Bacteria 2006
48 Ga0068857_100043255 3300005577 Bacteria 3996
49 Ga0068852_100230039 3300005616 Bacteria 1767
50 Ga0068852_100834356 3300005616 Bacteria 937
51 Ga0068859_102403398 3300005617 Bacteria 581
52 Ga0068864_101596837 3300005618 Bacteria 656
53 Ga0068866_10313612 3300005718 Bacteria 984
54 Ga0068861_100307736 3300005719 Bacteria 1375
55 Ga0068870_10004440 3300005840 Bacteria 6043
56 Ga0068870_10005024 3300005840 Bacteria 5745
57 Ga0068858_100371133 3300005842 Bacteria 1372
58 Ga0068858_100695821 3300005842 Bacteria 989
59 Ga0068862_100107276 3300005844 Bacteria 2449
60 Ga0068862_100189445 3300005844 Bacteria 1850
61 Ga0068862_101178378 3300005844 Bacteria 764
62 Ga0081538_10106535 3300005981 Bacteria 1391
63 Ga0081539_10028080 3300005985 Unclassified 3546
64 Ga0075365_10004624 3300006038 Bacteria 7324
65 Ga0075368_10112545 3300006042 Bacteria 1123
66 Ga0075363_100456953 3300006048 Bacteria 755
67 Ga0075363_100571347 3300006048 Bacteria 676
68 Ga0075364_10002992 3300006051 Bacteria 9545
69 Ga0075362_10028016 3300006177 Bacteria 2416
70 Ga0075367_10058291 3300006178 Bacteria 2297
71 Ga0075367_10264128 3300006178 Bacteria 1081
72 Ga0075366_10001710 3300006195 Bacteria 11030
73 Ga0075366_10076850 3300006195 Bacteria 1993
74 Ga0075366_10298098 3300006195 Bacteria 986
75 Ga0097621_100488802 3300006237 Unclassified 1114
76 Ga0075370_10026853 3300006353 Bacteria 3192
77 Ga0068871_100097583 3300006358 Bacteria 2457
78 Ga0068871_100589370 3300006358 Bacteria 1010
79 Ga0068871_101588232 3300006358 Bacteria 619
80 Ga0075428_100200498 3300006844 Bacteria 2157
81 Ga0075431_100162980 3300006847 Unclassified 2292
82 Ga0075434_100046749 3300006871 Bacteria 4294
83 Ga0075434_100170445 3300006871 Bacteria 2197
84 Ga0068865_100032745 3300006881 Bacteria 3476
85 Ga0068865_100298349 3300006881 Bacteria 1289
86 Ga0068865_101023137 3300006881 Bacteria 724
87 Ga0097620_102402477 3300006931 Bacteria 581
88 Ga0075435_100070245 3300007076 Bacteria 2858
89 Ga0105245_10517962 3300009098 Bacteria 1211
90 Ga0105247_10029365 3300009101 Bacteria 3331
91 Ga0114129_10271991 3300009147 Bacteria 2266
92 Ga0105242_10063256 3300009176 Bacteria 3047
93 Ga0105242_10198299 3300009176 Bacteria 1781
94 Ga0105248_10082055 3300009177 Bacteria 3624
95 Ga0105248_10110610 3300009177 Bacteria 3098
96 Ga0105248_10152943 3300009177 Bacteria 2603
97 Ga0105248_10576073 3300009177 Bacteria 1270
98 Ga0105248_10786008 3300009177 Unclassified 1074
99 Ga0105248_11214530 3300009177 Bacteria 852
100 Ga0105238_10007412 3300009551 Bacteria 10990
101 Ga0105238_10479509 3300009551 Bacteria 1243
102 Ga0105249_10619289 3300009553 Bacteria 1138
103 Ga0105239_11314123 3300010375 Bacteria 834
104 Ga0157374_11489234 3300013296 Bacteria 700
105 Ga0157378_11082976 3300013297 Bacteria 838
106 Ga0163162_10270092 3300013306 Bacteria 1832
107 Ga0157375_10090052 3300013308 Bacteria 3126
108 Ga0157375_10727462 3300013308 Bacteria 1145
109 Ga0163163_10469087 3300014325 Bacteria 1319
110 Ga0163163_11393128 3300014325 Bacteria 763
111 Ga0163163_12219165 3300014325 Bacteria 608
112 Ga0157380_11114427 3300014326 Bacteria 829
113 Ga0157377_10212157 3300014745 Bacteria 1235
114 Ga0157379_10016491 3300014968 Bacteria 6497
115 Ga0157376_10133473 3300014969 Bacteria 2218
116 Ga0157376_10800340 3300014969 Bacteria 955
117 Ga0157376_11136189 3300014969 Bacteria 808
118 Ga0163161_10210218 3300017792 Bacteria 1503
119 Ga0163161_10530497 3300017792 Bacteria 962
120 Ga0163161_10700265 3300017792 Unclassified 843
121 Ga0207682_10192284 3300025893 Bacteria 936
122 Ga0207642_10369935 3300025899 Bacteria 850
123 Ga0207680_10154824 3300025903 Bacteria 1531
124 Ga0207645_10196321 3300025907 Bacteria 1327
125 Ga0207645_10576358 3300025907 Bacteria 764
126 Ga0207643_10009930 3300025908 Bacteria 5115
127 Ga0207643_10028631 3300025908 Bacteria 3095
128 Ga0207654_10953649 3300025911 Bacteria 623
129 Ga0207660_10320180 3300025917 Bacteria 1238
130 Ga0207681_10048687 3300025923 Bacteria 2862
131 Ga0207681_10104019 3300025923 Bacteria 2053
132 Ga0207681_10452858 3300025923 Bacteria 1044
133 Ga0207694_10004252 3300025924 Bacteria 11220
134 Ga0207650_10154305 3300025925 Bacteria 1815
135 Ga0207650_10514990 3300025925 Bacteria 1001
136 Ga0207659_10002065 3300025926 Bacteria 11906
137 Ga0207659_10024048 3300025926 Bacteria 4076
138 Ga0207659_10035867 3300025926 Bacteria 3431
139 Ga0207659_10176357 3300025926 Bacteria 1690
140 Ga0207687_10512314 3300025927 Bacteria 1002
141 Ga0207644_10201614 3300025931 Bacteria 1570
142 Ga0207644_10360828 3300025931 Bacteria 1182
143 Ga0207690_10384568 3300025932 Bacteria 1116
144 Ga0207686_10019475 3300025934 Bacteria 3862
145 Ga0207686_10436020 3300025934 Bacteria 1005
146 Ga0207670_10299047 3300025936 Unclassified 1260
147 Ga0207669_10006169 3300025937 Bacteria 5454
148 Ga0207704_10426053 3300025938 Bacteria 1053
149 Ga0207691_10041033 3300025940 Bacteria 4275
150 Ga0207691_10061555 3300025940 Bacteria 3409
151 Ga0207691_10112195 3300025940 Bacteria 2423
152 Ga0207691_10560345 3300025940 Bacteria 968
153 Ga0207711_10276990 3300025941 Bacteria 1544
154 Ga0207711_10497038 3300025941 Unclassified 1137
155 Ga0207689_10023463 3300025942 Bacteria 5178
156 Ga0207689_10416935 3300025942 Bacteria 1120
157 Ga0207651_10019825 3300025960 Bacteria 4042
158 Ga0207651_10576752 3300025960 Bacteria 981
159 Ga0207712_10430853 3300025961 Bacteria 1115
160 Ga0207668_10056964 3300025972 Bacteria 2725
161 Ga0207658_10160099 3300025986 Unclassified 1844
162 Ga0207658_10329327 3300025986 Bacteria 1324
163 Ga0207703_10202061 3300026035 Bacteria 1766
164 Ga0207703_10677185 3300026035 Bacteria 980
165 Ga0207648_10455928 3300026089 Bacteria 1165
166 Ga0207674_10045953 3300026116 Bacteria 4487
167 Ga0207675_100103150 3300026118 Bacteria 2688
168 Ga0207675_101353161 3300026118 Bacteria 733
169 Ga0207683_10072835 3300026121 Bacteria 3038
170 Ga0207698_10827904 3300026142 Bacteria 929
171 Ga0209813_10105439 3300027866 Bacteria 964
172 Ga0268266_10462076 3300028379 Bacteria 1208
173 Ga0268265_10172270 3300028380 Bacteria 1851
174 Ga0307513_10265068 3300031456 Bacteria 1505
175 Ga0307405_10462942 3300031731 Bacteria 1008
176 Ga0307416_100288556 3300032002 Bacteria 1623
177 Ga0307416_100954968 3300032002 Bacteria 959
178 Ga0307416_102037548 3300032002 Bacteria 676
179 Ga0307414_10616788 3300032004 Bacteria 975
180 Ga0307411_10111925 3300032005 Bacteria 1956
181 Ga0307415_100273072 3300032126 Bacteria 1386
182 Ga0451849_0723622 3300041505 Unclassified 996
183 Ga0451853_0510837 3300041512 Bacteria 708
184 Ga0495643_0001705 3300046522 Bacteria 19059
185 Ga0495656_0050374 3300046615 Bacteria 1778
186 Ga0495658_0163674 3300046683 Bacteria 1373
187 Ga0496101_0647770 3300048904 Bacteria 835
188 Ga0496104_0087456 3300048907 Bacteria 2976
189 Ga0496105_0097959 3300048908 Bacteria 2422
190 Ga0496106_0131016 3300048909 Bacteria 1967
191 Ga0496110_0579421 3300048913 Bacteria 1019
192 Ga0496110_0647072 3300048913 Bacteria 957
193 Ga0496114_0058570 3300048917 Bacteria 3216
194 Ga0496114_0390554 3300048917 Bacteria 1232
195 Ga0496114_1057667 3300048917 Bacteria 696
196 Ga0501034_0200594 3300049571 Bacteria 1953
197 Ga0501036_0463088 3300049572 Bacteria 1056
198 Ga0501036_0585016 3300049572 Bacteria 927
199 Ga0501036_0884035 3300049572 Bacteria 734
200 Ga0501043_0033135 3300049579 Bacteria 4064
201 Ga0501043_0335521 3300049579 Bacteria 1151
202 Ga0501046_0215528 3300049580 Bacteria 1424
203 Ga0501047_0049923 3300049581 Bacteria 4040
204 Ga0501074_0369317 3300049590 Bacteria 1018
205 Ga0501076_0588188 3300049592 Bacteria 918
206 Ga0501243_059275 3300049675 Bacteria 707
207 Ga0501079_0036858 3300049741 Bacteria 3767
208 Ga0501081_0175869 3300049743 Bacteria 1547
209 Ga0501083_0002858 3300049744 Bacteria 11940
210 Ga0501044_0001012 3300049823 Bacteria 33764
211 nmdc:mga03n38_494277_c1 3300050490 Bacteria 686
212 nmdc:mga03n38_509400_c1 3300050490 Bacteria 676
213 nmdc:mga00v17_164845_c1 3300050491 Bacteria 1428
214 nmdc:mga00v17_420671_c1 3300050491 Bacteria 868
215 nmdc:mga0k408_215695_c1 3300050493 Bacteria 1146
216 nmdc:mga0k408_42882_c1 3300050493 Bacteria 2606
217 nmdc:mga0k408_513017_c1 3300050493 Bacteria 710
218 nmdc:mga06z11_160089_c1 3300050494 Bacteria 1286
219 nmdc:mga06z11_61749_c1 3300050494 Bacteria 1956
220 nmdc:mga06z11_90282_c1 3300050494 Bacteria 1662
221 nmdc:mga04h51_124391_c1 3300050495 Bacteria 964
222 nmdc:mga04h51_464589_c1 3300050495 Bacteria 537
223 nmdc:mga04h51_67469_c1 3300050495 Bacteria 1241
224 nmdc:mga05p37_112033_c1 3300050507 Bacteria 3355
225 nmdc:mga05p37_139569_c1 3300050507 Unclassified 2613
226 nmdc:mga05p37_1741902_c1 3300050507 Unclassified 605
227 nmdc:mga05p37_691544_c1 3300050507 Bacteria 1135
228 nmdc:mga09592_112540_c1 3300050508 Bacteria 2335
229 nmdc:mga09592_360910_c1 3300050508 Bacteria 1257
230 nmdc:mga09592_65488_c1 3300050508 Bacteria 3079
231 nmdc:mga09592_831339_c1 3300050508 Bacteria 780
232 nmdc:mga0qj67_66728_c1 3300050509 Bacteria 2866
233 nmdc:mga0qj67_754311_c1 3300050509 Bacteria 772
234 nmdc:mga06r32_32024_c1 3300050510 Bacteria 4942
235 nmdc:mga08y16_10444_c1 3300050511 Bacteria 9740
236 nmdc:mga0n895_15277_c1 3300050512 Bacteria 6995
237 nmdc:mga0n895_577393_c1 3300050512 Bacteria 1128
238 nmdc:mga0rr50_28098_c1 3300050513 Bacteria 3949
239 nmdc:mga0rr50_57497_c1 3300050513 Bacteria 2910
240 nmdc:mga08x19_14655_c1 3300050514 Bacteria 4760
241 nmdc:mga0a205_62961_c1 3300050515 Bacteria 3583
242 Ga0500641_0013446 3300053096 Bacteria 3007
243 Ga0500568_0027957 3300053139 Bacteria 2354
244 Ga0500599_025118 3300053736 Bacteria 862
245 Ga0501082_0521601 3300060353 Bacteria 1039
246 Ga0157380_10495251
247 Ga0058860_11976662
248 Ga0065707_10130342
249 Ga0070658_10128791
250 Ga0070676_10260534
251 Ga0070676_10992782
252 Ga0070690_100130780
253 Ga0070690_100719857
254 Ga0070670_100093318
255 Ga0070670_101267376
256 Ga0070670_101375589
257 Ga0070677_10081688
258 Ga0070666_10397156
259 Ga0070660_100042346
260 Ga0070689_100500590
261 Ga0070691_10397488
262 Ga0070675_100002881
263 Ga0070675_100035950
264 Ga0070675_100262711
265 Ga0070671_100148763
266 Ga0070674_100009372
267 Ga0070674_101271093
268 Ga0070673_100010378
269 Ga0070673_100452193
270 Ga0070688_100088124
271 Ga0070688_100478235
272 Ga0070659_100302316
273 Ga0070659_100472820
274 Ga0070659_100809695
275 Ga0070667_100227746
276 Ga0070694_101027735
277 Ga0070678_100133511
278 Ga0068867_101038339
279 Ga0070685_10312172
280 Ga0070679_100025649
281 Ga0070684_100395548
282 Ga0070684_100547212
283 Ga0068853_100461247
284 Ga0070672_100010243
285 Ga0070672_100145294
286 Ga0070672_100321791
287 Ga0070686_101818581
288 Ga0070665_100214414
289 Ga0070665_100221003
290 Ga0070665_100356172
291 Ga0068855_100005774
292 Ga0070664_100157773
293 Ga0068857_100043255
294 Ga0068852_100230039
295 Ga0068852_100834356
296 Ga0068859_102403398
297 Ga0068864_101596837
298 Ga0068866_10313612
299 Ga0068861_100307736
300 Ga0068870_10004440
301 Ga0068870_10005024
302 Ga0068858_100371133
303 Ga0068858_100695821
304 Ga0068862_100107276
305 Ga0068862_100189445
306 Ga0068862_101178378
307 Ga0081538_10106535
308 Ga0081539_10028080
309 Ga0075365_10004624
310 Ga0075368_10112545
311 Ga0075363_100456953
312 Ga0075363_100571347
313 Ga0075364_10002992
314 Ga0075362_10028016
315 Ga0075367_10058291
316 Ga0075367_10264128
317 Ga0075366_10001710
318 Ga0075366_10076850
319 Ga0075366_10298098
320 Ga0097621_100488802
321 Ga0075370_10026853
322 Ga0068871_100097583
323 Ga0068871_100589370
324 Ga0068871_101588232
325 Ga0075428_100200498
326 Ga0075431_100162980
327 Ga0075434_100046749
328 Ga0075434_100170445
329 Ga0068865_100032745
330 Ga0068865_100298349
331 Ga0068865_101023137
332 Ga0097620_102402477
333 Ga0075435_100070245
334 Ga0105245_10517962
335 Ga0105247_10029365
336 Ga0114129_10271991
337 Ga0105242_10063256
338 Ga0105242_10198299
339 Ga0105248_10082055
340 Ga0105248_10110610
341 Ga0105248_10152943
342 Ga0105248_10576073
343 Ga0105248_10786008
344 Ga0105248_11214530
345 Ga0105238_10007412
346 Ga0105238_10479509
347 Ga0105249_10619289
348 Ga0105239_11314123
349 Ga0157374_11489234
350 Ga0157378_11082976
351 Ga0163162_10270092
352 Ga0157375_10090052
353 Ga0157375_10727462
354 Ga0163163_10469087
355 Ga0163163_11393128
356 Ga0163163_12219165
357 Ga0157380_11114427
358 Ga0157377_10212157
359 Ga0157379_10016491
360 Ga0157376_10133473
361 Ga0157376_10800340
362 Ga0157376_11136189
363 Ga0163161_10210218
364 Ga0163161_10530497
365 Ga0163161_10700265
366 Ga0207682_10192284
367 Ga0207642_10369935
368 Ga0207680_10154824
369 Ga0207645_10196321
370 Ga0207645_10576358
371 Ga0207643_10009930
372 Ga0207643_10028631
373 Ga0207654_10953649
374 Ga0207660_10320180
375 Ga0207681_10048687
376 Ga0207681_10104019
377 Ga0207681_10452858
378 Ga0207694_10004252
379 Ga0207650_10154305
380 Ga0207650_10514990
381 Ga0207659_10002065
382 Ga0207659_10024048
383 Ga0207659_10035867
384 Ga0207659_10176357
385 Ga0207687_10512314
386 Ga0207644_10201614
387 Ga0207644_10360828
388 Ga0207690_10384568
389 Ga0207686_10019475
390 Ga0207686_10436020
391 Ga0207670_10299047
392 Ga0207669_10006169
393 Ga0207704_10426053
394 Ga0207691_10041033
395 Ga0207691_10061555
396 Ga0207691_10112195
397 Ga0207691_10560345
398 Ga0207711_10276990
399 Ga0207711_10497038
400 Ga0207689_10023463
401 Ga0207689_10416935
402 Ga0207651_10019825
403 Ga0207651_10576752
404 Ga0207712_10430853
405 Ga0207668_10056964
406 Ga0207658_10160099
407 Ga0207658_10329327
408 Ga0207703_10202061
409 Ga0207703_10677185
410 Ga0207648_10455928
411 Ga0207674_10045953
412 Ga0207675_100103150
413 Ga0207675_101353161
414 Ga0207683_10072835
415 Ga0207698_10827904
416 Ga0209813_10105439
417 Ga0268266_10462076
418 Ga0268265_10172270
419 Ga0307513_10265068
420 Ga0307405_10462942
421 Ga0307416_100288556
422 Ga0307416_100954968
423 Ga0307416_102037548
424 Ga0307414_10616788
425 Ga0307411_10111925
426 Ga0307415_100273072
427 Ga0451849_0723622
428 Ga0451853_0510837
429 Ga0495643_0001705
430 Ga0495656_0050374
431 Ga0495658_0163674
432 Ga0496101_0647770
433 Ga0496104_0087456
434 Ga0496105_0097959
435 Ga0496106_0131016
436 Ga0496110_0579421
437 Ga0496110_0647072
438 Ga0496114_0058570
439 Ga0496114_0390554
440 Ga0496114_1057667
441 Ga0501034_0200594
442 Ga0501036_0463088
443 Ga0501036_0585016
444 Ga0501036_0884035
445 Ga0501043_0033135
446 Ga0501043_0335521
447 Ga0501046_0215528
448 Ga0501047_0049923
449 Ga0501074_0369317
450 Ga0501076_0588188
451 Ga0501243_059275
452 Ga0501079_0036858
453 Ga0501081_0175869
454 Ga0501083_0002858
455 Ga0501044_0001012
456 nmdc:mga03n38_494277_c1
457 nmdc:mga03n38_509400_c1
458 nmdc:mga00v17_164845_c1
459 nmdc:mga00v17_420671_c1
460 nmdc:mga0k408_215695_c1
461 nmdc:mga0k408_42882_c1
462 nmdc:mga0k408_513017_c1
463 nmdc:mga06z11_160089_c1
464 nmdc:mga06z11_61749_c1
465 nmdc:mga06z11_90282_c1
466 nmdc:mga04h51_124391_c1
467 nmdc:mga04h51_464589_c1
468 nmdc:mga04h51_67469_c1
469 nmdc:mga05p37_112033_c1
470 nmdc:mga05p37_139569_c1
471 nmdc:mga05p37_1741902_c1
472 nmdc:mga05p37_691544_c1
473 nmdc:mga09592_112540_c1
474 nmdc:mga09592_360910_c1
475 nmdc:mga09592_65488_c1
476 nmdc:mga09592_831339_c1
477 nmdc:mga0qj67_66728_c1
478 nmdc:mga0qj67_754311_c1
479 nmdc:mga06r32_32024_c1
480 nmdc:mga08y16_10444_c1
481 nmdc:mga0n895_15277_c1
482 nmdc:mga0n895_577393_c1
483 nmdc:mga0rr50_28098_c1
484 nmdc:mga0rr50_57497_c1
485 nmdc:mga08x19_14655_c1
486 nmdc:mga0a205_62961_c1
487 Ga0500641_0013446
488 Ga0500568_0027957
489 Ga0500599_025118
490 Ga0501082_0521601

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01878

EVE

EVE domain

4

151

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zce-assembly1.cif.gz_A x-ray crystal structure of protein atu2648 from agrobacterium tumefaciens. northeast structural genomics consortium target atr33. 0.9096 6 158
2g2x-assembly3.cif.gz_C x-ray crystal structure protein q88ch6 from pseudomonas putida. northeast structural genomics consortium target ppr72. 0.9062 7 153
2gbs-assembly1.cif.gz_A nmr structure of rpa0253 from rhodopseudomonas palustris. northeast structural genomics consortium target rpr3 0.9044 6 154
2ar1-assembly1.cif.gz_A structure of hypothetical protein from leishmania major 0.8971 1 153
2eve-assembly1.cif.gz_A x-ray crystal structure of protein pspto5229 from pseudomonas syringae. northeast structural genomics consortium target psr62 0.8967 7 153
ID Description Score Start End Superfamily
af_I1JAX2_1_77_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.925 1 77 3.10.590.10
af_I1JAX2_1_77_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.9137 1 77 3.10.590.10
2eveA00 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.8917 7 153 3.10.590.10
af_A4ICC8_1_164_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.8908 1 153 3.10.590.10
1zceA00 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.8878 6 152 3.10.590.10
ID Description Score Start End GO Terms
AF-A0A7Z9T9R3-F1-model_v4 EVE domain-containing protein 0.9775 3 73
AF-A0A4V1S8E7-F1-model_v4 EVE domain-containing protein 0.9743 7 69
AF-A0A7J4MH91-F1-model_v4 EVE domain-containing protein 0.9741 6 76
AF-A0A2V7WGJ2-F1-model_v4 EVE domain-containing protein 0.9643 6 155
AF-A0A521SUM5-F1-model_v4 EVE domain-containing protein 0.9628 3 133

Map