F357383

General Info

Members Datasets Scaffolds Average Seq Length
245 139 244 431

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10063784|Ga0157372_100637844
Length 513
Sequence VQLYYGNSSNRLNNFSKGRNGATKEHKAFLSPFLCDFIAGKFYMHYFCRKPLFRFSFCNYCYMVYITRMAVKIKNIASYVFIKTVSFLIALLFLLPFLSQSQQVVSITIDGGINPASAELIHDAIEKAQHEKAQCVVINLNTPGGLLTSTRAIVSDILKSQVPVVVYVSPSGAHAGSAGTFITMAAHIAAMAPGTNIGAAHPVSMQGGSDAVMNEKGTNDAAAFIRSIAEKRGRDAVWAEQAVRHSLSITEKEALEKKVVDLIAANESDLLTQINGRNIETSNGTKTLHTQNATVQTIEMGFFQKILNMLSDPNIAYILMMLGFYGILFELFNPGAIFPGIAGVIFLXXAFYAMSSMPVNYAGVALIVFGIILFLLEIKIISHGLLAIGGTISVLLGSMILFRNSPMQNLVAISWTVMITTTAVTALFFLFVVGMGLKAQRTQPVSGTHALIGQTAIALGDLNPEGQVQLMGEIWSAVSPSGKIKANEEVIVKDIINLTLYVAPLSEEKTETA

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
96 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
97 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
98 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
99 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
105 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
106 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
107 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
108 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
109 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
110 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
111 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
112 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
113 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
114 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
115 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
120 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
121 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
122 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
123 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
124 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
126 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
127 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
128 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
129 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
130 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
131 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
132 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
133 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
134 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
135 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
136 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
137 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
138 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
139 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0
Isolates 0.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.9
Nodule 0
Rhizoplane 0
Rhizosphere 92.24
Stem 0
Stem Tuber 0
Unclassified 2.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10010462 3300002459 Bacteria 1912
2 rootH1_10004024 3300003323 Bacteria 14745
3 Ga0070658_10039326 3300005327 Bacteria 3815
4 Ga0070658_10113817 3300005327 Bacteria 2243
5 Ga0070658_10121869 3300005327 Bacteria 2167
6 Ga0070683_100151141 3300005329 Bacteria 2201
7 Ga0070670_100051380 3300005331 Bacteria 3540
8 Ga0070670_100087897 3300005331 Bacteria 2671
9 Ga0068869_100036482 3300005334 Unclassified 3491
10 Ga0068869_100242719 3300005334 Bacteria 1436
11 Ga0070680_100122929 3300005336 Bacteria 2167
12 Ga0070660_100000150 3300005339 Bacteria 44978
13 Ga0070689_100005361 3300005340 Bacteria 8746
14 Ga0070689_100062267 3300005340 Unclassified 2903
15 Ga0070668_100068410 3300005347 Bacteria 2760
16 Ga0070669_100047880 3300005353 Bacteria 3120
17 Ga0070669_100062832 3300005353 Unclassified 2732
18 Ga0070675_100058575 3300005354 Unclassified 3177
19 Ga0070675_100102880 3300005354 Bacteria 2407
20 Ga0070673_100040886 3300005364 Bacteria 3560
21 Ga0070673_100087507 3300005364 Bacteria 2539
22 Ga0070688_100015521 3300005365 Bacteria 4337
23 Ga0070659_100058991 3300005366 Bacteria 3030
24 Ga0070700_100172206 3300005441 Bacteria 1500
25 Ga0070662_100060524 3300005457 Unclassified 2762
26 Ga0070681_10013686 3300005458 Bacteria 8073
27 Ga0070681_10106325 3300005458 Bacteria 2747
28 Ga0070681_10151311 3300005458 Bacteria 2247
29 Ga0068867_100040982 3300005459 Bacteria 3383
30 Ga0068867_100052245 3300005459 Bacteria 3016
31 Ga0070698_100121854 3300005471 Bacteria 2567
32 Ga0070679_100017477 3300005530 Bacteria 6942
33 Ga0070679_100043396 3300005530 Bacteria 4479
34 Ga0070679_100091102 3300005530 Unclassified 3037
35 Ga0070684_100028151 3300005535 Bacteria 4751
36 Ga0068853_100039931 3300005539 Unclassified 4003
37 Ga0070672_100016695 3300005543 Bacteria 5262
38 Ga0070672_100068581 3300005543 Bacteria 2813
39 Ga0068855_100001835 3300005563 Bacteria 26494
40 Ga0068855_100024577 3300005563 Bacteria 7207
41 Ga0068855_100037284 3300005563 Bacteria 5783
42 Ga0068855_100179040 3300005563 Bacteria 2398
43 Ga0068857_100036966 3300005577 Bacteria 4325
44 Ga0068857_100058463 3300005577 Unclassified 3424
45 Ga0068857_100122511 3300005577 Bacteria 2342
46 Ga0068857_100143633 3300005577 Bacteria 2158
47 Ga0068856_100019707 3300005614 Bacteria 6547
48 Ga0068856_100036881 3300005614 Unclassified 4794
49 Ga0068852_100010311 3300005616 Bacteria 6976
50 Ga0068859_100158450 3300005617 Bacteria 2342
51 Ga0068859_100161521 3300005617 Unclassified 2319
52 Ga0068859_100184908 3300005617 Bacteria 2167
53 Ga0068864_100006540 3300005618 Bacteria 9546
54 Ga0068864_100177343 3300005618 Bacteria 1946
55 Ga0068861_100036146 3300005719 Unclassified 3664
56 Ga0068861_100048058 3300005719 Bacteria 3224
57 Ga0068870_10019635 3300005840 Unclassified 3280
58 Ga0068870_10026582 3300005840 Bacteria 2886
59 Ga0068860_100007077 3300005843 Bacteria 11229
60 Ga0068860_100014092 3300005843 Bacteria 7844
61 Ga0068860_100138771 3300005843 Bacteria 2335
62 Ga0068862_100004064 3300005844 Bacteria 12405
63 Ga0075366_10015880 3300006195 Bacteria 4322
64 Ga0075366_10062633 3300006195 Unclassified 2211
65 Ga0097621_100124521 3300006237 Bacteria 2188
66 Ga0068871_100034914 3300006358 Bacteria 3993
67 Ga0075428_100013467 3300006844 Bacteria 9101
68 Ga0075428_100020289 3300006844 Bacteria 7361
69 Ga0075430_100005946 3300006846 Bacteria 10306
70 Ga0075431_100025385 3300006847 Bacteria 6074
71 Ga0075429_100000533 3300006880 Bacteria 28947
72 Ga0075429_100112675 3300006880 Unclassified 2377
73 Ga0068865_100063769 3300006881 Bacteria 2591
74 Ga0097620_100158452 3300006931 Bacteria 2342
75 Ga0097620_100161534 3300006931 Unclassified 2319
76 Ga0097620_100184902 3300006931 Bacteria 2167
77 Ga0105247_10002938 3300009101 Bacteria 11326
78 Ga0114129_10005958 3300009147 Bacteria 17260
79 Ga0105241_10000801 3300009174 Bacteria 23852
80 Ga0105241_10021961 3300009174 Bacteria 4725
81 Ga0105241_10059582 3300009174 Bacteria 2936
82 Ga0105248_10140054 3300009177 Bacteria 2729
83 Ga0105237_10003140 3300009545 Bacteria 19871
84 Ga0105237_10020776 3300009545 Bacteria 6763
85 Ga0105237_10069320 3300009545 Bacteria 3522
86 Ga0105249_10000805 3300009553 Bacteria 28223
87 Ga0105249_10010289 3300009553 Bacteria 8216
88 Ga0105239_10000360 3300010375 Bacteria 66494
89 Ga0105239_10067821 3300010375 Bacteria 3920
90 Ga0157373_10002120 3300013100 Bacteria 15020
91 Ga0157373_10031280 3300013100 Bacteria 3831
92 Ga0157373_10034949 3300013100 Bacteria 3610
93 Ga0157371_10001416 3300013102 Bacteria 24929
94 Ga0157371_10006265 3300013102 Bacteria 9855
95 Ga0157371_10010451 3300013102 Bacteria 7232
96 Ga0157371_10014347 3300013102 Bacteria 5982
97 Ga0157371_10016021 3300013102 Bacteria 5605
98 Ga0157371_10026040 3300013102 Bacteria 4256
99 Ga0157370_10000530 3300013104 Bacteria 47795
100 Ga0157370_10001371 3300013104 Bacteria 30157
101 Ga0157370_10113262 3300013104 Bacteria 2535
102 Ga0157370_10241561 3300013104 Bacteria 1671
103 Ga0157370_10266129 3300013104 Bacteria 1584
104 Ga0157369_10028872 3300013105 Bacteria 6136
105 Ga0157369_10235863 3300013105 Bacteria 1912
106 Ga0157378_10047319 3300013297 Bacteria 3824
107 Ga0157378_10119318 3300013297 Bacteria 2429
108 Ga0163162_10000396 3300013306 Bacteria 39981
109 Ga0163162_10044381 3300013306 Bacteria 4452
110 Ga0157372_10012981 3300013307 Bacteria 8887
111 Ga0157372_10025614 3300013307 Bacteria 6417
112 Ga0157372_10039834 3300013307 Bacteria 5187
113 Ga0157372_10046562 3300013307 Bacteria 4815
114 Ga0157372_10063784 3300013307 Bacteria 4133
115 Ga0157372_10139086 3300013307 Unclassified 2797
116 Ga0163163_10063070 3300014325 Bacteria 3674
117 Ga0157380_10080484 3300014326 Unclassified 2663
118 Ga0157380_10115824 3300014326 Bacteria 2261
119 Ga0207710_10000853 3300025900 Bacteria 16432
120 Ga0207688_10012975 3300025901 Bacteria 4531
121 Ga0207645_10007918 3300025907 Bacteria 7465
122 Ga0207643_10037866 3300025908 Bacteria 2707
123 Ga0207705_10008383 3300025909 Bacteria 7546
124 Ga0207705_10008822 3300025909 Bacteria 7352
125 Ga0207654_10009827 3300025911 Bacteria 4865
126 Ga0207707_10042155 3300025912 Bacteria 3985
127 Ga0207707_10083468 3300025912 Bacteria 2790
128 Ga0207707_10179763 3300025912 Bacteria 1847
129 Ga0207695_10001408 3300025913 Bacteria 40540
130 Ga0207695_10066811 3300025913 Bacteria 3691
131 Ga0207671_10002462 3300025914 Bacteria 19787
132 Ga0207671_10017286 3300025914 Bacteria 5566
133 Ga0207671_10129691 3300025914 Bacteria 1934
134 Ga0207660_10053143 3300025917 Bacteria 2886
135 Ga0207662_10072377 3300025918 Bacteria 2089
136 Ga0207657_10006915 3300025919 Bacteria 11698
137 Ga0207657_10065128 3300025919 Unclassified 3108
138 Ga0207657_10072205 3300025919 Bacteria 2920
139 Ga0207657_10098147 3300025919 Bacteria 2434
140 Ga0207657_10128463 3300025919 Bacteria 2079
141 Ga0207652_10000367 3300025921 Bacteria 46853
142 Ga0207652_10001480 3300025921 Bacteria 20773
143 Ga0207652_10034799 3300025921 Bacteria 4248
144 Ga0207652_10081956 3300025921 Bacteria 2822
145 Ga0207652_10099345 3300025921 Bacteria 2568
146 Ga0207681_10030541 3300025923 Bacteria 3513
147 Ga0207650_10023722 3300025925 Bacteria 4356
148 Ga0207650_10073481 3300025925 Bacteria 2575
149 Ga0207659_10013282 3300025926 Bacteria 5267
150 Ga0207659_10135873 3300025926 Bacteria 1903
151 Ga0207706_10025751 3300025933 Bacteria 5270
152 Ga0207686_10014918 3300025934 Bacteria 4337
153 Ga0207670_10017702 3300025936 Bacteria 4312
154 Ga0207691_10007132 3300025940 Bacteria 10789
155 Ga0207691_10009195 3300025940 Bacteria 9485
156 Ga0207691_10096282 3300025940 Bacteria 2646
157 Ga0207689_10012788 3300025942 Bacteria 7169
158 Ga0207689_10047333 3300025942 Unclassified 3552
159 Ga0207667_10006577 3300025949 Bacteria 14063
160 Ga0207667_10022055 3300025949 Bacteria 7045
161 Ga0207667_10025218 3300025949 Bacteria 6511
162 Ga0207667_10037233 3300025949 Bacteria 5202
163 Ga0207667_10082227 3300025949 Bacteria 3336
164 Ga0207667_10166442 3300025949 Bacteria 2266
165 Ga0207712_10004929 3300025961 Bacteria 8437
166 Ga0207712_10108365 3300025961 Bacteria 2078
167 Ga0207668_10032745 3300025972 Bacteria 3439
168 Ga0207703_10136643 3300026035 Unclassified 2123
169 Ga0207639_10060608 3300026041 Bacteria 2919
170 Ga0207702_10086856 3300026078 Bacteria 2729
171 Ga0207641_10000921 3300026088 Bacteria 30349
172 Ga0207648_10006837 3300026089 Bacteria 11302
173 Ga0207648_10100365 3300026089 Bacteria 2536
174 Ga0207676_10115678 3300026095 Bacteria 2252
175 Ga0207674_10120933 3300026116 Bacteria 2586
176 Ga0207674_10152383 3300026116 Bacteria 2268
177 Ga0207674_10193539 3300026116 Bacteria 1983
178 Ga0207675_100000496 3300026118 Bacteria 38204
179 Ga0207675_100016590 3300026118 Bacteria 6879
180 Ga0207675_100042495 3300026118 Bacteria 4244
181 Ga0207675_100093490 3300026118 Bacteria 2828
182 Ga0207683_10000843 3300026121 Bacteria 28112
183 Ga0268265_10028349 3300028380 Unclassified 4008
184 Ga0307513_10081709 3300031456 Bacteria 3329
185 Ga0307509_10057479 3300031507 Bacteria 4124
186 Ga0307508_10153639 3300031616 Bacteria 1906
187 Ga0373927_0066792 3300035695 Bacteria 2327
188 Ga0395899_0003711 3300037312 Bacteria 12081
189 Ga0395899_0044183 3300037312 Bacteria 3321
190 Ga0395900_0000203 3300037418 Bacteria 93536
191 Ga0395900_0060089 3300037418 Bacteria 3912
192 Ga0395900_0089834 3300037418 Bacteria 3157
193 Ga0395900_0172955 3300037418 Unclassified 2198
194 Ga0395898_0001978 3300037466 Bacteria 25752
195 Ga0395898_0016337 3300037466 Bacteria 7596
196 Ga0395898_0030530 3300037466 Bacteria 5392
197 Ga0395898_0114416 3300037466 Unclassified 2585
198 Ga0395905_0038584 3300037471 Bacteria 4483
199 Ga0395901_0012648 3300038443 Bacteria 8563
200 Ga0395901_0019967 3300038443 Bacteria 6855
201 Ga0451851_1165330 3300041507 Bacteria 2033
202 Ga0451853_1911935 3300041512 Bacteria 3255
203 Ga0439449_0002187 3300042007 Bacteria 7688
204 Ga0439449_0006511 3300042007 Bacteria 4463
205 Ga0439457_001330 3300042014 Bacteria 7412
206 Ga0439462_0000717 3300042015 Bacteria 6814
207 Ga0466969_0005756 3300044656 Bacteria 6587
208 Ga0466972_0000044 3300044658 Bacteria 131031
209 Ga0466972_0036708 3300044658 Bacteria 2396
210 Ga0466957_0004747 3300044842 Bacteria 7611
211 Ga0466959_0000045 3300045049 Bacteria 89773
212 Ga0495648_0066277 3300046524 Bacteria 2117
213 Ga0495687_000004 3300047443 Bacteria 779298
214 Ga0501034_0344050 3300049571 Unclassified 1421
215 Ga0501037_0025209 3300049573 Bacteria 4394
216 Ga0501043_0075748 3300049579 Unclassified 2643
217 Ga0501047_0013337 3300049581 Bacteria 7787
218 Ga0501198_005389 3300049649 Unclassified 1801
219 Ga0501240_000820 3300049673 Unclassified 2776
220 Ga0501253_002043 3300049683 Unclassified 2206
221 Ga0501259_003596 3300049688 Unclassified 2462
222 Ga0501266_001046 3300049763 Bacteria 3572
223 Ga0501035_0068224 3300049822 Bacteria 3154
224 Ga0501035_0176662 3300049822 Bacteria 1842
225 Ga0501044_0006409 3300049823 Bacteria 13008
226 Ga0501044_0067101 3300049823 Bacteria 3656
227 nmdc:mga0k408_46056_c1 3300050493 Unclassified 2518
228 nmdc:mga05p37_3999_c1 3300050507 Bacteria 11270
229 nmdc:mga09592_23239_c1 3300050508 Bacteria 5120
230 nmdc:mga0qj67_30515_c1 3300050509 Unclassified 4198
231 nmdc:mga06r32_39311_c1 3300050510 Bacteria 4488
232 nmdc:mga06r32_83539_c1 3300050510 Unclassified 3112
233 nmdc:mga08y16_117136_c1 3300050511 Bacteria 2773
234 nmdc:mga08y16_40223_c1 3300050511 Bacteria 4901
235 Ga0500578_0012559 3300053086 Bacteria 5463
236 Ga0500646_0005281 3300053090 Bacteria 3265
237 Ga0500583_0000001 3300053092 Bacteria 241642
238 Ga0500583_0001159 3300053092 Bacteria 7512
239 Ga0500569_000375 3300053109 Bacteria 7278
240 Ga0500652_018830 3300053131 Bacteria 2556
241 Ga0500577_0004046 3300053142 Bacteria 3843
242 Ga0500622_0001107 3300053156 Bacteria 22458
243 Ga0500622_0095234 3300053156 Bacteria 1472
244 Ga0466962_0073423 3300061719 Bacteria 1635

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050511 nmdc:mga08y16_117136_c1 nmdc:mga08y16_117136_c1_848_2056 378
2 3300031616 Ga0307508_10153639 Ga0307508_101536392 381
3 3300005843 Ga0068860_100138771 Ga0068860_1001387712 391
4 3300025900 Ga0207710_10000853 Ga0207710_100008536 391
5 3300026118 Ga0207675_100093490 Ga0207675_1000934901 391
6 3300005340 Ga0070689_100005361 Ga0070689_1000053614 400
7 3300005353 Ga0070669_100047880 Ga0070669_1000478802 400
8 3300005354 Ga0070675_100102880 Ga0070675_1001028803 400
9 3300005364 Ga0070673_100087507 Ga0070673_1000875072 400
10 3300005365 Ga0070688_100015521 Ga0070688_1000155214 400
11 3300005543 Ga0070672_100016695 Ga0070672_1000166953 400
12 3300005617 Ga0068859_100184908 Ga0068859_1001849082 400
13 3300005840 Ga0068870_10026582 Ga0068870_100265822 400
14 3300006931 Ga0097620_100184902 Ga0097620_1001849022 400
15 3300014326 Ga0157380_10115824 Ga0157380_101158242 400
16 3300025908 Ga0207643_10037866 Ga0207643_100378662 400
17 3300025936 Ga0207670_10017702 Ga0207670_100177024 400
18 3300025940 Ga0207691_10009195 Ga0207691_100091952 400
19 3300041512 Ga0451853_1911935 Ga0451853_1911935_1676_2914 400
20 3300025942 Ga0207689_10012788 Ga0207689_100127883 402
21 3300049688 Ga0501259_003596 Ga0501259_003596_889_2241 402
22 3300042007 Ga0439449_0002187 Ga0439449_0002187_5160_6416 406
23 3300042007 Ga0439449_0006511 Ga0439449_0006511_2522_3778 406
24 3300042014 Ga0439457_001330 Ga0439457_001330_338_1594 406
25 3300042015 Ga0439462_0000717 Ga0439462_0000717_4739_5995 406
26 3300049573 Ga0501037_0025209 Ga0501037_0025209_2713_4005 407
27 3300006847 Ga0075431_100025385 Ga0075431_1000253853 408
28 3300044842 Ga0466957_0004747 Ga0466957_0004747_2718_3980 408
29 3300005327 Ga0070658_10121869 Ga0070658_101218691 411
30 3300026116 Ga0207674_10120933 Ga0207674_101209332 411
31 3300026118 Ga0207675_100016590 Ga0207675_1000165903 411
32 3300005563 Ga0068855_100179040 Ga0068855_1001790401 412
33 3300005843 Ga0068860_100014092 Ga0068860_1000140929 412
34 3300013306 Ga0163162_10000396 Ga0163162_1000039613 412
35 3300035695 Ga0373927_0066792 Ga0373927_0066792_889_2163 412
36 3300047443 Ga0495687_000004 Ga0495687_000004_683865_685151 412
37 3300005327 Ga0070658_10113817 Ga0070658_101138172 413
38 3300005331 Ga0070670_100051380 Ga0070670_1000513802 413
39 3300005458 Ga0070681_10013686 Ga0070681_100136864 413
40 3300005617 Ga0068859_100158450 Ga0068859_1001584502 413
41 3300005618 Ga0068864_100006540 Ga0068864_1000065404 413
42 3300005843 Ga0068860_100007077 Ga0068860_1000070775 413
43 3300005844 Ga0068862_100004064 Ga0068862_1000040649 413
44 3300006844 Ga0075428_100013467 Ga0075428_1000134677 413
45 3300006880 Ga0075429_100000533 Ga0075429_1000005335 413
46 3300006931 Ga0097620_100158452 Ga0097620_1001584522 413
47 3300013105 Ga0157369_10028872 Ga0157369_100288724 413
48 3300013307 Ga0157372_10039834 Ga0157372_100398343 413
49 3300025961 Ga0207712_10108365 Ga0207712_101083652 413
50 3300049823 Ga0501044_0067101 Ga0501044_0067101_1880_3193 413
51 3300050508 nmdc:mga09592_23239_c1 nmdc:mga09592_23239_c1_3150_4433 413
52 3300050510 nmdc:mga06r32_39311_c1 nmdc:mga06r32_39311_c1_1580_2863 413
53 iso_pu_bacteria 2738541278 2738725326 413
54 3300005458 Ga0070681_10106325 Ga0070681_101063252 414
55 3300005530 Ga0070679_100017477 Ga0070679_1000174776 414
56 3300005535 Ga0070684_100028151 Ga0070684_1000281512 414
57 3300005614 Ga0068856_100019707 Ga0068856_1000197072 414
58 3300005616 Ga0068852_100010311 Ga0068852_1000103116 414
59 3300006237 Ga0097621_100124521 Ga0097621_1001245212 414
60 3300006358 Ga0068871_100034914 Ga0068871_1000349142 414
61 3300009174 Ga0105241_10021961 Ga0105241_100219612 414
62 3300009545 Ga0105237_10003140 Ga0105237_1000314016 414
63 3300009545 Ga0105237_10020776 Ga0105237_100207766 414
64 3300010375 Ga0105239_10067821 Ga0105239_100678212 414
65 3300013100 Ga0157373_10031280 Ga0157373_100312801 414
66 3300013102 Ga0157371_10010451 Ga0157371_100104515 414
67 3300025912 Ga0207707_10083468 Ga0207707_100834682 414
68 3300025913 Ga0207695_10066811 Ga0207695_100668113 414
69 3300025914 Ga0207671_10002462 Ga0207671_1000246215 414
70 3300025914 Ga0207671_10129691 Ga0207671_101296912 414
71 3300025921 Ga0207652_10081956 Ga0207652_100819562 414
72 3300025940 Ga0207691_10096282 Ga0207691_100962824 414
73 3300025949 Ga0207667_10037233 Ga0207667_100372332 414
74 3300026078 Ga0207702_10086856 Ga0207702_100868562 414
75 3300046524 Ga0495648_0066277 Ga0495648_0066277_379_1653 414
76 3300053092 Ga0500583_0001159 Ga0500583_0001159_5904_7178 414
77 3300053109 Ga0500569_000375 Ga0500569_000375_3350_4624 414
78 3300053142 Ga0500577_0004046 Ga0500577_0004046_2514_3788 414
79 3300053156 Ga0500622_0001107 Ga0500622_0001107_3610_4884 414
80 3300005327 Ga0070658_10039326 Ga0070658_100393262 415
81 3300005530 Ga0070679_100043396 Ga0070679_1000433963 415
82 3300013102 Ga0157371_10026040 Ga0157371_100260402 415
83 3300025921 Ga0207652_10001480 Ga0207652_100014804 415
84 3300025921 Ga0207652_10034799 Ga0207652_100347993 415
85 3300037418 Ga0395900_0060089 Ga0395900_0060089_2115_3434 415
86 3300049579 Ga0501043_0075748 Ga0501043_0075748_526_1821 415
87 3300049649 Ga0501198_005389 Ga0501198_005389_382_1734 415
88 3300049673 Ga0501240_000820 Ga0501240_000820_191_1543 415
89 3300049683 Ga0501253_002043 Ga0501253_002043_813_2165 415
90 3300049763 Ga0501266_001046 Ga0501266_001046_1766_3118 415
91 3300053092 Ga0500583_0000001 Ga0500583_0000001_165886_167229 415
92 3300005334 Ga0068869_100242719 Ga0068869_1002427191 416
93 3300005339 Ga0070660_100000150 Ga0070660_10000015035 416
94 3300005340 Ga0070689_100062267 Ga0070689_1000622672 416
95 3300006195 Ga0075366_10062633 Ga0075366_100626332 416
96 3300009101 Ga0105247_10002938 Ga0105247_100029387 416
97 3300009147 Ga0114129_10005958 Ga0114129_1000595817 416
98 3300009174 Ga0105241_10000801 Ga0105241_1000080114 416
99 3300009545 Ga0105237_10069320 Ga0105237_100693203 416
100 3300013100 Ga0157373_10002120 Ga0157373_1000212011 416
101 3300013102 Ga0157371_10006265 Ga0157371_100062655 416
102 3300013104 Ga0157370_10001371 Ga0157370_1000137125 416
103 3300013104 Ga0157370_10113262 Ga0157370_101132623 416
104 3300013297 Ga0157378_10047319 Ga0157378_100473192 416
105 3300013307 Ga0157372_10012981 Ga0157372_100129815 416
106 3300025911 Ga0207654_10009827 Ga0207654_100098273 416
107 3300025913 Ga0207695_10001408 Ga0207695_1000140830 416
108 3300025914 Ga0207671_10017286 Ga0207671_100172864 416
109 3300025918 Ga0207662_10072377 Ga0207662_100723772 416
110 3300025919 Ga0207657_10006915 Ga0207657_100069157 416
111 3300025949 Ga0207667_10025218 Ga0207667_100252182 416
112 3300037466 Ga0395898_0030530 Ga0395898_0030530_922_2247 416
113 3300050493 nmdc:mga0k408_46056_c1 nmdc:mga0k408_46056_c1_427_1713 416
114 3300050507 nmdc:mga05p37_3999_c1 nmdc:mga05p37_3999_c1_538_1824 416
115 3300002459 JGI24751J29686_10010462 JGI24751J29686_100104621 417
116 3300003323 rootH1_10004024 rootH1_1000402414 417
117 3300005329 Ga0070683_100151141 Ga0070683_1001511412 417
118 3300005331 Ga0070670_100087897 Ga0070670_1000878972 417
119 3300005334 Ga0068869_100036482 Ga0068869_1000364824 417
120 3300005336 Ga0070680_100122929 Ga0070680_1001229291 417
121 3300005347 Ga0070668_100068410 Ga0070668_1000684102 417
122 3300005353 Ga0070669_100062832 Ga0070669_1000628322 417
123 3300005354 Ga0070675_100058575 Ga0070675_1000585751 417
124 3300005364 Ga0070673_100040886 Ga0070673_1000408863 417
125 3300005366 Ga0070659_100058991 Ga0070659_1000589912 417
126 3300005441 Ga0070700_100172206 Ga0070700_1001722061 417
127 3300005457 Ga0070662_100060524 Ga0070662_1000605242 417
128 3300005458 Ga0070681_10151311 Ga0070681_101513112 417
129 3300005459 Ga0068867_100040982 Ga0068867_1000409822 417
130 3300005459 Ga0068867_100052245 Ga0068867_1000522453 417
131 3300005471 Ga0070698_100121854 Ga0070698_1001218542 417
132 3300005530 Ga0070679_100091102 Ga0070679_1000911022 417
133 3300005539 Ga0068853_100039931 Ga0068853_1000399313 417
134 3300005543 Ga0070672_100068581 Ga0070672_1000685813 417
135 3300005563 Ga0068855_100001835 Ga0068855_10000183519 417
136 3300005563 Ga0068855_100024577 Ga0068855_1000245773 417
137 3300005563 Ga0068855_100037284 Ga0068855_1000372847 417
138 3300005577 Ga0068857_100036966 Ga0068857_1000369663 417
139 3300005577 Ga0068857_100058463 Ga0068857_1000584632 417
140 3300005577 Ga0068857_100122511 Ga0068857_1001225112 417
141 3300005577 Ga0068857_100143633 Ga0068857_1001436332 417
142 3300005614 Ga0068856_100036881 Ga0068856_1000368812 417
143 3300005617 Ga0068859_100161521 Ga0068859_1001615212 417
144 3300005618 Ga0068864_100177343 Ga0068864_1001773432 417
145 3300005719 Ga0068861_100036146 Ga0068861_1000361463 417
146 3300005719 Ga0068861_100048058 Ga0068861_1000480583 417
147 3300005840 Ga0068870_10019635 Ga0068870_100196352 417
148 3300006195 Ga0075366_10015880 Ga0075366_100158802 417
149 3300006844 Ga0075428_100020289 Ga0075428_1000202893 417
150 3300006846 Ga0075430_100005946 Ga0075430_1000059463 417
151 3300006880 Ga0075429_100112675 Ga0075429_1001126752 417
152 3300006881 Ga0068865_100063769 Ga0068865_1000637691 417
153 3300006931 Ga0097620_100161534 Ga0097620_1001615342 417
154 3300009174 Ga0105241_10059582 Ga0105241_100595824 417
155 3300009177 Ga0105248_10140054 Ga0105248_101400543 417
156 3300009553 Ga0105249_10000805 Ga0105249_100008055 417
157 3300009553 Ga0105249_10010289 Ga0105249_100102895 417
158 3300010375 Ga0105239_10000360 Ga0105239_1000036039 417
159 3300013100 Ga0157373_10034949 Ga0157373_100349493 417
160 3300013102 Ga0157371_10001416 Ga0157371_100014165 417
161 3300013102 Ga0157371_10014347 Ga0157371_100143474 417
162 3300013102 Ga0157371_10016021 Ga0157371_100160213 417
163 3300013104 Ga0157370_10000530 Ga0157370_1000053039 417
164 3300013104 Ga0157370_10241561 Ga0157370_102415611 417
165 3300013104 Ga0157370_10266129 Ga0157370_102661291 417
166 3300013105 Ga0157369_10235863 Ga0157369_102358632 417
167 3300013297 Ga0157378_10119318 Ga0157378_101193181 417
168 3300013306 Ga0163162_10044381 Ga0163162_100443813 417
169 3300013307 Ga0157372_10025614 Ga0157372_100256143 417
170 3300013307 Ga0157372_10046562 Ga0157372_100465624 417
171 3300013307 Ga0157372_10063784 Ga0157372_100637844 417
172 3300013307 Ga0157372_10139086 Ga0157372_101390862 417
173 3300014325 Ga0163163_10063070 Ga0163163_100630701 417
174 3300014326 Ga0157380_10080484 Ga0157380_100804842 417
175 3300025901 Ga0207688_10012975 Ga0207688_100129752 417
176 3300025907 Ga0207645_10007918 Ga0207645_100079182 417
177 3300025909 Ga0207705_10008383 Ga0207705_100083835 417
178 3300025909 Ga0207705_10008822 Ga0207705_100088223 417
179 3300025912 Ga0207707_10042155 Ga0207707_100421552 417
180 3300025912 Ga0207707_10179763 Ga0207707_101797631 417
181 3300025917 Ga0207660_10053143 Ga0207660_100531432 417
182 3300025919 Ga0207657_10065128 Ga0207657_100651283 417
183 3300025919 Ga0207657_10072205 Ga0207657_100722052 417
184 3300025919 Ga0207657_10098147 Ga0207657_100981473 417
185 3300025919 Ga0207657_10128463 Ga0207657_101284631 417
186 3300025921 Ga0207652_10000367 Ga0207652_100003675 417
187 3300025921 Ga0207652_10099345 Ga0207652_100993451 417
188 3300025923 Ga0207681_10030541 Ga0207681_100305414 417
189 3300025925 Ga0207650_10023722 Ga0207650_100237223 417
190 3300025925 Ga0207650_10073481 Ga0207650_100734812 417
191 3300025926 Ga0207659_10013282 Ga0207659_100132822 417
192 3300025926 Ga0207659_10135873 Ga0207659_101358732 417
193 3300025933 Ga0207706_10025751 Ga0207706_100257512 417
194 3300025934 Ga0207686_10014918 Ga0207686_100149182 417
195 3300025940 Ga0207691_10007132 Ga0207691_100071325 417
196 3300025942 Ga0207689_10047333 Ga0207689_100473334 417
197 3300025949 Ga0207667_10006577 Ga0207667_100065777 417
198 3300025949 Ga0207667_10022055 Ga0207667_100220556 417
199 3300025949 Ga0207667_10082227 Ga0207667_100822272 417
200 3300025949 Ga0207667_10166442 Ga0207667_101664422 417
201 3300025961 Ga0207712_10004929 Ga0207712_100049296 417
202 3300025972 Ga0207668_10032745 Ga0207668_100327452 417
203 3300026035 Ga0207703_10136643 Ga0207703_101366432 417
204 3300026041 Ga0207639_10060608 Ga0207639_100606082 417
205 3300026088 Ga0207641_10000921 Ga0207641_100009217 417
206 3300026089 Ga0207648_10006837 Ga0207648_100068378 417
207 3300026089 Ga0207648_10100365 Ga0207648_101003652 417
208 3300026095 Ga0207676_10115678 Ga0207676_101156782 417
209 3300026116 Ga0207674_10152383 Ga0207674_101523832 417
210 3300026116 Ga0207674_10193539 Ga0207674_101935392 417
211 3300026118 Ga0207675_100000496 Ga0207675_1000004964 417
212 3300026118 Ga0207675_100042495 Ga0207675_1000424952 417
213 3300026121 Ga0207683_10000843 Ga0207683_1000084320 417
214 3300028380 Ga0268265_10028349 Ga0268265_100283494 417
215 3300031456 Ga0307513_10081709 Ga0307513_100817092 417
216 3300031507 Ga0307509_10057479 Ga0307509_100574793 417
217 3300037312 Ga0395899_0003711 Ga0395899_0003711_7600_8934 417
218 3300037312 Ga0395899_0044183 Ga0395899_0044183_175_1503 417
219 3300037418 Ga0395900_0000203 Ga0395900_0000203_191_1519 417
220 3300037418 Ga0395900_0089834 Ga0395900_0089834_1757_3085 417
221 3300037418 Ga0395900_0172955 Ga0395900_0172955_17_1345 417
222 3300037466 Ga0395898_0001978 Ga0395898_0001978_1711_3039 417
223 3300037466 Ga0395898_0016337 Ga0395898_0016337_265_1593 417
224 3300037466 Ga0395898_0114416 Ga0395898_0114416_693_2021 417
225 3300037471 Ga0395905_0038584 Ga0395905_0038584_2086_3420 417
226 3300038443 Ga0395901_0012648 Ga0395901_0012648_185_1513 417
227 3300038443 Ga0395901_0019967 Ga0395901_0019967_1965_3293 417
228 3300041507 Ga0451851_1165330 Ga0451851_1165330_278_1567 417
229 3300044656 Ga0466969_0005756 Ga0466969_0005756_1821_3110 417
230 3300044658 Ga0466972_0000044 Ga0466972_0000044_44250_45539 417
231 3300044658 Ga0466972_0036708 Ga0466972_0036708_677_1966 417
232 3300045049 Ga0466959_0000045 Ga0466959_0000045_23675_24964 417
233 3300049571 Ga0501034_0344050 Ga0501034_0344050_76_1365 417
234 3300049581 Ga0501047_0013337 Ga0501047_0013337_3489_4778 417
235 3300049822 Ga0501035_0068224 Ga0501035_0068224_548_1876 417
236 3300049822 Ga0501035_0176662 Ga0501035_0176662_402_1691 417
237 3300049823 Ga0501044_0006409 Ga0501044_0006409_5866_7155 417
238 3300050509 nmdc:mga0qj67_30515_c1 nmdc:mga0qj67_30515_c1_1307_2587 417
239 3300050510 nmdc:mga06r32_83539_c1 nmdc:mga06r32_83539_c1_1595_2875 417
240 3300050511 nmdc:mga08y16_40223_c1 nmdc:mga08y16_40223_c1_3284_4636 417
241 3300053086 Ga0500578_0012559 Ga0500578_0012559_3596_4885 417
242 3300053090 Ga0500646_0005281 Ga0500646_0005281_732_2021 417
243 3300053131 Ga0500652_018830 Ga0500652_018830_147_1436 417
244 3300053156 Ga0500622_0095234 Ga0500622_0095234_111_1400 417
245 3300061719 Ga0466962_0073423 Ga0466962_0073423_111_1400 417

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01957

NfeD

NfeD-like C-terminal, partner-binding

420

504

0.91

PF00574

CLP_protease

Clp protease

97

267

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wwv-assembly1.cif.gz_A-2 c-terminal domain of stomatin operon partner protein 1510-c from pyrococcus horikoshii 0.9441 355 416
2deo-assembly1.cif.gz_A 1510-n membrane protease specific for a stomatin homolog from pyrococcus horikoshii 0.9338 21 231
3cp0-assembly1.cif.gz_A crystal structure of the soluble domain of membrane protein implicated in regulation of membrane protease activity from corynebacterium glutamicum 0.9287 359 411
2deo-assembly1.cif.gz_A 1510-n membrane protease specific for a stomatin homolog from pyrococcus horikoshii 0.9203 21 231
3viv-assembly1.cif.gz_B 1510-n membrane-bound stomatin-specific protease k138a mutant in complex with a substrate peptide 0.9048 20 231
ID Description Score Start End Superfamily
af_Q2FXZ8_166_227_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9728 359 415 2.40.50.140
af_P71767_83_144_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9607 359 414 2.40.50.140
3wwvA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9441 355 416 2.40.50.140
2deoA00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9169 21 231 3.90.226.10
3vivB00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9048 20 231 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A533Y8D3-F1-model_v4 Nodulation protein NfeD 0.9875 20 217
AF-A0A3C0TQ82-F1-model_v4 Nodulation protein NfeD 0.9872 20 217
AF-A0A351AYS3-F1-model_v4 deleted 0.9858 20 238
AF-X0SG34-F1-model_v4 Nodulation protein NfeD 0.9837 21 234
AF-A0A3D0DG96-F1-model_v4 Serine protease 0.9833 23 195 GO:0006508
GO:0008233

Feature Viewer

pLDDT pTM Quality
75.13 0.61 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map