F357310

General Info

Members Datasets Scaffolds Average Seq Length
245 133 490 164

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_11400774|Ga0114129_114007741
Length 185
Sequence VLHGQHLSSIVLRTNKRNELTFSKKLSQVNTLITIEHYVNREIIINAPRQKVFDFLKLLKNQDQFNKWATADKKNRKEEFKGTDGTVGFIYSWSGDKSAGRGEKEIKNIIEGKRIETEIRFVKPMRVAASVIFETESLSDDQTKVNLINTGTLKYPLNIMIPMAEKRFPKDMDESLSTLKNILEK

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
112 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
113 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
114 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
115 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
116 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
121 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
122 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
123 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
124 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
125 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
126 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
127 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
128 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
129 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
130 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
131 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
132 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
133 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0
Isolates 0.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.22
Nodule 0
Rhizoplane 0
Rhizosphere 95.1
Stem 0
Stem Tuber 0
Unclassified 13.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_11400774 3300009147 Bacteria 863
2 JGI24751J29686_10003380 3300002459 Bacteria 3218
3 rootH2_10072655 3300003320 Bacteria 2182
4 rootL2_10008241 3300003322 Unclassified 2156
5 Ga0065712_10347044 3300005290 Bacteria 792
6 Ga0065707_10784166 3300005295 Bacteria 605
7 Ga0070658_10435428 3300005327 Bacteria 1129
8 Ga0070676_10226370 3300005328 Unclassified 1238
9 Ga0070690_100355047 3300005330 Bacteria 1065
10 Ga0070670_100095972 3300005331 Bacteria 2550
11 Ga0070670_100291970 3300005331 Bacteria 1425
12 Ga0070670_100397088 3300005331 Bacteria 1217
13 Ga0070670_101198741 3300005331 Bacteria 694
14 Ga0068869_100140476 3300005334 Unclassified 1864
15 Ga0068869_100457021 3300005334 Bacteria 1059
16 Ga0070666_10000041 3300005335 Bacteria 112410
17 Ga0070666_10272213 3300005335 Bacteria 1202
18 Ga0068868_100009572 3300005338 Bacteria 6986
19 Ga0068868_100285586 3300005338 Bacteria 1398
20 Ga0068868_100709112 3300005338 Bacteria 901
21 Ga0070689_100509764 3300005340 Bacteria 1032
22 Ga0070689_101077177 3300005340 Bacteria 718
23 Ga0070687_100094057 3300005343 Bacteria 1664
24 Ga0070687_100143483 3300005343 Bacteria 1393
25 Ga0070687_100153031 3300005343 Bacteria 1356
26 Ga0070661_100816472 3300005344 Bacteria 766
27 Ga0070692_10833650 3300005345 Bacteria 632
28 Ga0070668_100749270 3300005347 Unclassified 864
29 Ga0070668_100799096 3300005347 Bacteria 838
30 Ga0070669_100250788 3300005353 Bacteria 1409
31 Ga0070669_100432632 3300005353 Bacteria 1082
32 Ga0070675_100014588 3300005354 Bacteria 6196
33 Ga0070675_100589610 3300005354 Bacteria 1007
34 Ga0070671_100024447 3300005355 Bacteria 4945
35 Ga0070673_100680900 3300005364 Bacteria 943
36 Ga0070673_100686063 3300005364 Bacteria 940
37 Ga0070688_100011452 3300005365 Bacteria 4927
38 Ga0070688_100064478 3300005365 Bacteria 2325
39 Ga0070688_100228534 3300005365 Bacteria 1315
40 Ga0070667_100109441 3300005367 Bacteria 2394
41 Ga0070667_100549517 3300005367 Unclassified 1061
42 Ga0070701_10062120 3300005438 Bacteria 1972
43 Ga0068867_101492787 3300005459 Unclassified 629
44 Ga0070685_10034136 3300005466 Bacteria 2863
45 Ga0070685_10059889 3300005466 Bacteria 2224
46 Ga0070698_100007455 3300005471 Bacteria 11839
47 Ga0070698_100341924 3300005471 Bacteria 1428
48 Ga0070672_100140189 3300005543 Bacteria 1994
49 Ga0070686_100349874 3300005544 Bacteria 1110
50 Ga0070693_100908801 3300005547 Unclassified 660
51 Ga0070665_100374730 3300005548 Unclassified 1430
52 Ga0070704_100191040 3300005549 Bacteria 1646
53 Ga0068855_100770235 3300005563 Bacteria 1025
54 Ga0070664_100142531 3300005564 Bacteria 2111
55 Ga0068857_100147927 3300005577 Bacteria 2126
56 Ga0068857_100226525 3300005577 Bacteria 1708
57 Ga0068857_100745474 3300005577 Bacteria 933
58 Ga0068854_100110010 3300005578 Bacteria 2077
59 Ga0068852_100557173 3300005616 Bacteria 1147
60 Ga0068859_100000139 3300005617 Bacteria 68691
61 Ga0068859_100208893 3300005617 Bacteria 2038
62 Ga0068864_100021861 3300005618 Bacteria 5362
63 Ga0068864_100197046 3300005618 Bacteria 1849
64 Ga0068861_100945440 3300005719 Bacteria 819
65 Ga0068851_10000094 3300005834 Bacteria 49249
66 Ga0068870_10039516 3300005840 Bacteria 2442
67 Ga0068863_100005882 3300005841 Bacteria 12020
68 Ga0068863_100479551 3300005841 Bacteria 1223
69 Ga0068863_100721902 3300005841 Bacteria 991
70 Ga0068858_100015680 3300005842 Bacteria 7129
71 Ga0068860_100008378 3300005843 Bacteria 10296
72 Ga0068860_100186129 3300005843 Bacteria 2008
73 Ga0068860_100411500 3300005843 Bacteria 1339
74 Ga0068862_100011449 3300005844 Bacteria 7321
75 Ga0068862_100394136 3300005844 Bacteria 1294
76 Ga0081539_10311526 3300005985 Bacteria 672
77 Ga0097621_100030652 3300006237 Unclassified 4260
78 Ga0097621_101857309 3300006237 Bacteria 575
79 Ga0068871_100067023 3300006358 Bacteria 2943
80 Ga0068871_100100696 3300006358 Bacteria 2421
81 Ga0068871_100957174 3300006358 Bacteria 796
82 Ga0075428_100249467 3300006844 Unclassified 1913
83 Ga0075428_100453323 3300006844 Bacteria 1374
84 Ga0068865_100429292 3300006881 Bacteria 1088
85 Ga0068865_100437709 3300006881 Bacteria 1078
86 Ga0068865_100754486 3300006881 Bacteria 836
87 Ga0097620_100000139 3300006931 Bacteria 68691
88 Ga0097620_100208909 3300006931 Bacteria 2038
89 Ga0111539_10124034 3300009094 Bacteria 3027
90 Ga0111539_10125368 3300009094 Bacteria 3009
91 Ga0111539_10179579 3300009094 Bacteria 2473
92 Ga0105247_10001499 3300009101 Bacteria 16717
93 Ga0105247_10197914 3300009101 Unclassified 1348
94 Ga0114129_10938162 3300009147 Unclassified 1094
95 Ga0105241_10001041 3300009174 Bacteria 21106
96 Ga0105241_11296751 3300009174 Bacteria 693
97 Ga0105242_10128238 3300009176 Bacteria 2186
98 Ga0105242_10134535 3300009176 Bacteria 2138
99 Ga0105242_10740901 3300009176 Bacteria 966
100 Ga0105237_10145523 3300009545 Bacteria 2365
101 Ga0105249_10041400 3300009553 Unclassified 4188
102 Ga0105249_10043223 3300009553 Bacteria 4099
103 Ga0105249_10081029 3300009553 Bacteria 3016
104 Ga0105249_10233767 3300009553 Bacteria 1814
105 Ga0105249_11972931 3300009553 Bacteria 656
106 Ga0105246_10016857 3300011119 Bacteria 4635
107 Ga0157371_10202731 3300013102 Bacteria 1422
108 Ga0157370_11113290 3300013104 Bacteria 713
109 Ga0157374_10122942 3300013296 Unclassified 2507
110 Ga0157374_10240875 3300013296 Bacteria 1779
111 Ga0157374_11006751 3300013296 Unclassified 852
112 Ga0157378_10012625 3300013297 Bacteria 7394
113 Ga0157378_10111420 3300013297 Unclassified 2509
114 Ga0157378_10112286 3300013297 Bacteria 2500
115 Ga0157378_10553240 3300013297 Bacteria 1156
116 Ga0163162_10007246 3300013306 Bacteria 10765
117 Ga0163162_10275480 3300013306 Unclassified 1814
118 Ga0163162_10857452 3300013306 Bacteria 1023
119 Ga0163162_10907969 3300013306 Bacteria 994
120 Ga0163162_10939405 3300013306 Bacteria 976
121 Ga0163162_11147211 3300013306 Bacteria 881
122 Ga0163162_11163010 3300013306 Bacteria 875
123 Ga0157372_10000251 3300013307 Bacteria 59407
124 Ga0157372_10084406 3300013307 Bacteria 3599
125 Ga0157375_10064116 3300013308 Unclassified 3657
126 Ga0157375_10098485 3300013308 Bacteria 3001
127 Ga0157375_10109853 3300013308 Bacteria 2854
128 Ga0157375_10227359 3300013308 Bacteria 2024
129 Ga0157375_10802487 3300013308 Unclassified 1090
130 Ga0157375_12314250 3300013308 Bacteria 641
131 Ga0163163_10231784 3300014325 Bacteria 1896
132 Ga0157380_10000013 3300014326 Bacteria 131248
133 Ga0157380_10001341 3300014326 Bacteria 16027
134 Ga0157380_10297786 3300014326 Bacteria 1484
135 Ga0157380_10913049 3300014326 Bacteria 905
136 Ga0157380_11918440 3300014326 Bacteria 653
137 Ga0157377_10456442 3300014745 Bacteria 883
138 Ga0157379_10518115 3300014968 Bacteria 1107
139 Ga0157376_10134966 3300014969 Bacteria 2207
140 Ga0163161_10108624 3300017792 Bacteria 2071
141 Ga0213876_10007588 3300021384 Bacteria 5888
142 Ga0207656_10000061 3300025321 Bacteria 42734
143 Ga0207710_10055859 3300025900 Bacteria 1780
144 Ga0207680_10020624 3300025903 Bacteria 3552
145 Ga0207680_10335821 3300025903 Bacteria 1059
146 Ga0207645_10008025 3300025907 Bacteria 7404
147 Ga0207645_10167956 3300025907 Unclassified 1437
148 Ga0207643_10035742 3300025908 Bacteria 2787
149 Ga0207643_10367216 3300025908 Unclassified 905
150 Ga0207654_10004289 3300025911 Bacteria 7193
151 Ga0207671_10113477 3300025914 Bacteria 2064
152 Ga0207662_10032371 3300025918 Bacteria 3043
153 Ga0207662_10173748 3300025918 Bacteria 1383
154 Ga0207662_10371748 3300025918 Bacteria 964
155 Ga0207662_10513098 3300025918 Bacteria 827
156 Ga0207662_10620850 3300025918 Bacteria 753
157 Ga0207681_10237841 3300025923 Bacteria 1416
158 Ga0207650_10056219 3300025925 Unclassified 2923
159 Ga0207650_10185912 3300025925 Bacteria 1658
160 Ga0207650_10801926 3300025925 Bacteria 798
161 Ga0207659_10244904 3300025926 Bacteria 1452
162 Ga0207644_11200137 3300025931 Bacteria 638
163 Ga0207670_10626475 3300025936 Bacteria 885
164 Ga0207669_10323149 3300025937 Bacteria 1182
165 Ga0207704_10177076 3300025938 Bacteria 1537
166 Ga0207704_10445649 3300025938 Bacteria 1032
167 Ga0207704_10979313 3300025938 Bacteria 714
168 Ga0207691_10021564 3300025940 Bacteria 6081
169 Ga0207691_10039832 3300025940 Bacteria 4346
170 Ga0207691_10093647 3300025940 Unclassified 2689
171 Ga0207689_10488016 3300025942 Bacteria 1032
172 Ga0207689_11037209 3300025942 Bacteria 692
173 Ga0207679_10323161 3300025945 Unclassified 1337
174 Ga0207667_10286021 3300025949 Unclassified 1685
175 Ga0207651_10030579 3300025960 Bacteria 3431
176 Ga0207651_10386442 3300025960 Bacteria 1187
177 Ga0207651_11311603 3300025960 Bacteria 651
178 Ga0207712_10025942 3300025961 Bacteria 3899
179 Ga0207712_10053926 3300025961 Bacteria 2823
180 Ga0207712_10262453 3300025961 Bacteria 1401
181 Ga0207712_10771221 3300025961 Bacteria 844
182 Ga0207668_10460454 3300025972 Bacteria 1087
183 Ga0207668_10721879 3300025972 Bacteria 877
184 Ga0207640_10042114 3300025981 Bacteria 2910
185 Ga0207658_10472293 3300025986 Bacteria 1113
186 Ga0207658_10872080 3300025986 Unclassified 819
187 Ga0207658_11040333 3300025986 Bacteria 747
188 Ga0207677_10028549 3300026023 Bacteria 3531
189 Ga0207703_10011582 3300026035 Bacteria 6857
190 Ga0207703_10063158 3300026035 Bacteria 3036
191 Ga0207703_11258135 3300026035 Bacteria 712
192 Ga0207708_10041721 3300026075 Bacteria 3498
193 Ga0207708_10317217 3300026075 Bacteria 1271
194 Ga0207641_10001301 3300026088 Bacteria 24754
195 Ga0207641_10054164 3300026088 Bacteria 3403
196 Ga0207641_10230856 3300026088 Unclassified 1720
197 Ga0207648_10037869 3300026089 Unclassified 4245
198 Ga0207648_10047735 3300026089 Unclassified 3751
199 Ga0207648_10079074 3300026089 Bacteria 2869
200 Ga0207648_10531358 3300026089 Bacteria 1079
201 Ga0207648_11240633 3300026089 Unclassified 700
202 Ga0207676_10076936 3300026095 Bacteria 2698
203 Ga0207676_10412583 3300026095 Bacteria 1265
204 Ga0207674_10028784 3300026116 Bacteria 5858
205 Ga0207674_10089245 3300026116 Bacteria 3075
206 Ga0207674_10285297 3300026116 Bacteria 1599
207 Ga0207674_10370726 3300026116 Bacteria 1384
208 Ga0207674_10782766 3300026116 Unclassified 921
209 Ga0207675_100181426 3300026118 Bacteria 2016
210 Ga0207675_100406172 3300026118 Bacteria 1343
211 Ga0207675_100839000 3300026118 Bacteria 933
212 Ga0207683_10499662 3300026121 Bacteria 1123
213 Ga0207428_10413307 3300027907 Bacteria 987
214 Ga0268265_10025384 3300028380 Bacteria 4205
215 Ga0268264_10005049 3300028381 Bacteria 11171
216 Ga0268264_10163225 3300028381 Bacteria 2009
217 Ga0268264_10427499 3300028381 Unclassified 1278
218 Ga0307515_10000092 3300028794 Bacteria 212425
219 Ga0265327_10000533 3300031251 Bacteria 65500
220 Ga0265327_10001555 3300031251 Bacteria 28194
221 Ga0265327_10069925 3300031251 Bacteria 1760
222 Ga0265327_10247166 3300031251 Bacteria 795
223 Ga0307513_10413241 3300031456 Bacteria 1081
224 Ga0307509_10318907 3300031507 Unclassified 1292
225 Ga0265314_10056118 3300031711 Bacteria 2713
226 Ga0373947_0402605 3300035725 Bacteria 923
227 Ga0395900_0089985 3300037418 Bacteria 3155
228 Ga0395905_0001159 3300037471 Bacteria 32949
229 Ga0395905_0622910 3300037471 Unclassified 981
230 Ga0395901_0001563 3300038443 Bacteria 23722
231 Ga0436365_1855296 3300039437 Bacteria 37922
232 Ga0436363_1178106 3300039450 Bacteria 867
233 Ga0451577_0147593 3300042876 Bacteria 2115
234 Ga0453683_0715754 3300044673 Bacteria 656
235 Ga0453684_0027727 3300044712 Bacteria 8108
236 Ga0453684_0063618 3300044712 Bacteria 4718
237 Ga0451576_0046320 3300045051 Bacteria 4580
238 Ga0495668_0000115 3300046616 Bacteria 125423
239 Ga0495672_0028363 3300047320 Bacteria 3544
240 nmdc:mga05p37_155638_c1 3300050507 Bacteria 2793
241 nmdc:mga08y16_153766_c1 3300050511 Bacteria 2391
242 Ga0500578_0001279 3300053086 Bacteria 26009
243 Ga0500583_0171293 3300053092 Bacteria 1081
244 Ga0500652_297196 3300053131 Bacteria 626
245 2929241081 2929239360 Bacteria 7745570
246 Ga0114129_11400774
247 JGI24751J29686_10003380
248 rootH2_10072655
249 rootL2_10008241
250 Ga0065712_10347044
251 Ga0065707_10784166
252 Ga0070658_10435428
253 Ga0070676_10226370
254 Ga0070690_100355047
255 Ga0070670_100095972
256 Ga0070670_100291970
257 Ga0070670_100397088
258 Ga0070670_101198741
259 Ga0068869_100140476
260 Ga0068869_100457021
261 Ga0070666_10000041
262 Ga0070666_10272213
263 Ga0068868_100009572
264 Ga0068868_100285586
265 Ga0068868_100709112
266 Ga0070689_100509764
267 Ga0070689_101077177
268 Ga0070687_100094057
269 Ga0070687_100143483
270 Ga0070687_100153031
271 Ga0070661_100816472
272 Ga0070692_10833650
273 Ga0070668_100749270
274 Ga0070668_100799096
275 Ga0070669_100250788
276 Ga0070669_100432632
277 Ga0070675_100014588
278 Ga0070675_100589610
279 Ga0070671_100024447
280 Ga0070673_100680900
281 Ga0070673_100686063
282 Ga0070688_100011452
283 Ga0070688_100064478
284 Ga0070688_100228534
285 Ga0070667_100109441
286 Ga0070667_100549517
287 Ga0070701_10062120
288 Ga0068867_101492787
289 Ga0070685_10034136
290 Ga0070685_10059889
291 Ga0070698_100007455
292 Ga0070698_100341924
293 Ga0070672_100140189
294 Ga0070686_100349874
295 Ga0070693_100908801
296 Ga0070665_100374730
297 Ga0070704_100191040
298 Ga0068855_100770235
299 Ga0070664_100142531
300 Ga0068857_100147927
301 Ga0068857_100226525
302 Ga0068857_100745474
303 Ga0068854_100110010
304 Ga0068852_100557173
305 Ga0068859_100000139
306 Ga0068859_100208893
307 Ga0068864_100021861
308 Ga0068864_100197046
309 Ga0068861_100945440
310 Ga0068851_10000094
311 Ga0068870_10039516
312 Ga0068863_100005882
313 Ga0068863_100479551
314 Ga0068863_100721902
315 Ga0068858_100015680
316 Ga0068860_100008378
317 Ga0068860_100186129
318 Ga0068860_100411500
319 Ga0068862_100011449
320 Ga0068862_100394136
321 Ga0081539_10311526
322 Ga0097621_100030652
323 Ga0097621_101857309
324 Ga0068871_100067023
325 Ga0068871_100100696
326 Ga0068871_100957174
327 Ga0075428_100249467
328 Ga0075428_100453323
329 Ga0068865_100429292
330 Ga0068865_100437709
331 Ga0068865_100754486
332 Ga0097620_100000139
333 Ga0097620_100208909
334 Ga0111539_10124034
335 Ga0111539_10125368
336 Ga0111539_10179579
337 Ga0105247_10001499
338 Ga0105247_10197914
339 Ga0114129_10938162
340 Ga0105241_10001041
341 Ga0105241_11296751
342 Ga0105242_10128238
343 Ga0105242_10134535
344 Ga0105242_10740901
345 Ga0105237_10145523
346 Ga0105249_10041400
347 Ga0105249_10043223
348 Ga0105249_10081029
349 Ga0105249_10233767
350 Ga0105249_11972931
351 Ga0105246_10016857
352 Ga0157371_10202731
353 Ga0157370_11113290
354 Ga0157374_10122942
355 Ga0157374_10240875
356 Ga0157374_11006751
357 Ga0157378_10012625
358 Ga0157378_10111420
359 Ga0157378_10112286
360 Ga0157378_10553240
361 Ga0163162_10007246
362 Ga0163162_10275480
363 Ga0163162_10857452
364 Ga0163162_10907969
365 Ga0163162_10939405
366 Ga0163162_11147211
367 Ga0163162_11163010
368 Ga0157372_10000251
369 Ga0157372_10084406
370 Ga0157375_10064116
371 Ga0157375_10098485
372 Ga0157375_10109853
373 Ga0157375_10227359
374 Ga0157375_10802487
375 Ga0157375_12314250
376 Ga0163163_10231784
377 Ga0157380_10000013
378 Ga0157380_10001341
379 Ga0157380_10297786
380 Ga0157380_10913049
381 Ga0157380_11918440
382 Ga0157377_10456442
383 Ga0157379_10518115
384 Ga0157376_10134966
385 Ga0163161_10108624
386 Ga0213876_10007588
387 Ga0207656_10000061
388 Ga0207710_10055859
389 Ga0207680_10020624
390 Ga0207680_10335821
391 Ga0207645_10008025
392 Ga0207645_10167956
393 Ga0207643_10035742
394 Ga0207643_10367216
395 Ga0207654_10004289
396 Ga0207671_10113477
397 Ga0207662_10032371
398 Ga0207662_10173748
399 Ga0207662_10371748
400 Ga0207662_10513098
401 Ga0207662_10620850
402 Ga0207681_10237841
403 Ga0207650_10056219
404 Ga0207650_10185912
405 Ga0207650_10801926
406 Ga0207659_10244904
407 Ga0207644_11200137
408 Ga0207670_10626475
409 Ga0207669_10323149
410 Ga0207704_10177076
411 Ga0207704_10445649
412 Ga0207704_10979313
413 Ga0207691_10021564
414 Ga0207691_10039832
415 Ga0207691_10093647
416 Ga0207689_10488016
417 Ga0207689_11037209
418 Ga0207679_10323161
419 Ga0207667_10286021
420 Ga0207651_10030579
421 Ga0207651_10386442
422 Ga0207651_11311603
423 Ga0207712_10025942
424 Ga0207712_10053926
425 Ga0207712_10262453
426 Ga0207712_10771221
427 Ga0207668_10460454
428 Ga0207668_10721879
429 Ga0207640_10042114
430 Ga0207658_10472293
431 Ga0207658_10872080
432 Ga0207658_11040333
433 Ga0207677_10028549
434 Ga0207703_10011582
435 Ga0207703_10063158
436 Ga0207703_11258135
437 Ga0207708_10041721
438 Ga0207708_10317217
439 Ga0207641_10001301
440 Ga0207641_10054164
441 Ga0207641_10230856
442 Ga0207648_10037869
443 Ga0207648_10047735
444 Ga0207648_10079074
445 Ga0207648_10531358
446 Ga0207648_11240633
447 Ga0207676_10076936
448 Ga0207676_10412583
449 Ga0207674_10028784
450 Ga0207674_10089245
451 Ga0207674_10285297
452 Ga0207674_10370726
453 Ga0207674_10782766
454 Ga0207675_100181426
455 Ga0207675_100406172
456 Ga0207675_100839000
457 Ga0207683_10499662
458 Ga0207428_10413307
459 Ga0268265_10025384
460 Ga0268264_10005049
461 Ga0268264_10163225
462 Ga0268264_10427499
463 Ga0307515_10000092
464 Ga0265327_10000533
465 Ga0265327_10001555
466 Ga0265327_10069925
467 Ga0265327_10247166
468 Ga0307513_10413241
469 Ga0307509_10318907
470 Ga0265314_10056118
471 Ga0373947_0402605
472 Ga0395900_0089985
473 Ga0395905_0001159
474 Ga0395905_0622910
475 Ga0395901_0001563
476 Ga0436365_1855296
477 Ga0436363_1178106
478 Ga0451577_0147593
479 Ga0453683_0715754
480 Ga0453684_0027727
481 Ga0453684_0063618
482 Ga0451576_0046320
483 Ga0495668_0000115
484 Ga0495672_0028363
485 nmdc:mga05p37_155638_c1
486 nmdc:mga08y16_153766_c1
487 Ga0500578_0001279
488 Ga0500583_0171293
489 Ga0500652_297196
490 2929241081

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7wa9-assembly1.cif.gz_A crystal structure of msmeg_5634 from mycobacterium smegmatis 0.7983 29 163
3ijt-assembly1.cif.gz_A structural characterization of smu.440, a hypothetical protein from streptococcus mutans 0.7701 27 164
5non-assembly3.cif.gz_C structure of truncated norcoclaurine synthase from thalictrum flavum with product mimic 0.7586 28 163
8ho2-assembly1.cif.gz_B crystal structure of norcoclaurine synthase from chinese lotus (nelumbo nucicera) 0.749 28 163
2le1-assembly1.cif.gz_A solution nmr structure of tfu_2981 from thermobifida fusca, northeast structural genomics consortium target tfr85a 0.7469 30 163
ID Description Score Start End Superfamily
af_P9WJ05_1_142_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7856 29 163 3.30.530.20
af_I6X666_8_157_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7673 29 163 3.30.530.20
3ijtB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7668 26 161 3.30.530.20
5nonC00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7586 28 163 3.30.530.20
2le1A00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7469 30 163 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A4Q3CLK1-F1-model_v4 Polyketide cyclase 0.952 45 163
AF-A0A534YPF1-F1-model_v4 SRPBCC family protein 0.9518 29 146
AF-A0A519MTZ1-F1-model_v4 Polyketide cyclase 0.9361 31 162
AF-A0A7Y3B323-F1-model_v4 SRPBCC family protein 0.9231 29 138
AF-A0A1Q8L8D4-F1-model_v4 Transcriptional regulator 0.9148 28 162

Map