F357030

General Info

Members Datasets Scaffolds Average Seq Length
245 175 490 114

Family's Representative Sequence

Representative Sequence 3300005293|Ga0065715_10184897|Ga0065715_101848971
Length 134
Sequence MPRAGCPAAAARASCRMSATPPPPTITFPDFDRVDIRVGRIVRAEPFPEARKPAYRLTIDFGPDLGTRRSSAQLTPRYRREELEGRLVVAVVNFPPRQIGPFMSEVLTLGVPDDSGAVILLSPDREVPLGGRMF

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
59 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
85 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
86 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
87 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
88 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
89 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
90 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
91 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
92 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
93 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
94 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
95 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
98 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
99 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
100 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
102 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
103 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
104 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
105 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
106 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
107 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
110 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
111 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
112 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
113 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
114 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
115 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
116 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
117 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
118 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
119 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
120 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
121 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
122 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
123 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
124 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
125 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
126 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
127 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
128 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
129 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
130 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
131 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
132 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
133 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
134 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
135 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
136 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
137 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
138 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
139 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
140 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
144 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
145 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
146 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
147 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
148 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
149 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
150 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
151 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
152 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
153 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
154 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
155 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
156 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
157 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
158 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
159 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
160 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
161 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
162 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
163 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
164 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
165 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
166 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
167 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
168 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
169 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
170 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
171 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
172 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
173 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
174 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
175 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.18
Metatranscriptomes 0.82
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.12
Nodule 0
Rhizoplane 10.2
Rhizosphere 81.63
Stem 0
Stem Tuber 0
Unclassified 7.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10184897 3300005293 Bacteria 1452
2 MBSR1b_contig_804242 2162886012 Bacteria 1460
3 Ga0032354_1021835 3300003693 Unclassified 2796
4 Ga0065704_10794411 3300005289 Bacteria 527
5 Ga0065712_10081216 3300005290 Bacteria 3028
6 Ga0065712_10092461 3300005290 Bacteria 2330
7 Ga0065712_10092859 3300005290 Bacteria 2315
8 Ga0065712_10163388 3300005290 Bacteria 1287
9 Ga0065715_10195882 3300005293 Bacteria 1388
10 Ga0065715_10229951 3300005293 Bacteria 1237
11 Ga0065715_10970702 3300005293 Bacteria 553
12 Ga0065707_10533204 3300005295 Bacteria 733
13 Ga0070683_101224239 3300005329 Bacteria 721
14 Ga0070670_100012012 3300005331 Bacteria 7407
15 Ga0070670_100025827 3300005331 Bacteria 5053
16 Ga0070670_100053379 3300005331 Bacteria 3471
17 Ga0070680_100482823 3300005336 Bacteria 1059
18 Ga0068868_100116960 3300005338 Bacteria 2171
19 Ga0070661_100109323 3300005344 Bacteria 2063
20 Ga0070661_100256760 3300005344 Bacteria 1350
21 Ga0070668_100404601 3300005347 Bacteria 1166
22 Ga0070675_100117502 3300005354 Bacteria 2257
23 Ga0070675_100579943 3300005354 Bacteria 1016
24 Ga0070671_100075760 3300005355 Bacteria 2811
25 Ga0070674_100029269 3300005356 Bacteria 3625
26 Ga0070674_100210145 3300005356 Bacteria 1508
27 Ga0070688_100204845 3300005365 Bacteria 1382
28 Ga0070688_101511834 3300005365 Bacteria 546
29 Ga0070667_100045711 3300005367 Bacteria 3682
30 Ga0070709_11571081 3300005434 Unclassified 535
31 Ga0070711_101648713 3300005439 Bacteria 561
32 Ga0070700_100978273 3300005441 Bacteria 694
33 Ga0070663_101468394 3300005455 Bacteria 605
34 Ga0070662_101004890 3300005457 Bacteria 714
35 Ga0070662_101040839 3300005457 Bacteria 701
36 Ga0070679_100126123 3300005530 Bacteria 2542
37 Ga0070684_100009548 3300005535 Bacteria 7645
38 Ga0070672_100026860 3300005543 Bacteria 4290
39 Ga0070686_100594079 3300005544 Bacteria 871
40 Ga0070686_100670035 3300005544 Bacteria 824
41 Ga0070696_101128358 3300005546 Bacteria 660
42 Ga0070664_100033054 3300005564 Bacteria 4329
43 Ga0070664_100244926 3300005564 Bacteria 1610
44 Ga0070664_100869967 3300005564 Bacteria 844
45 Ga0068857_100016651 3300005577 Bacteria 6440
46 Ga0068857_101102744 3300005577 Bacteria 766
47 Ga0068854_100431199 3300005578 Bacteria 1097
48 Ga0070702_100998735 3300005615 Bacteria 662
49 Ga0068859_101223303 3300005617 Bacteria 827
50 Ga0068864_100089055 3300005618 Bacteria 2719
51 Ga0068864_102001129 3300005618 Unclassified 585
52 Ga0068864_102552240 3300005618 Bacteria 517
53 Ga0068851_10629670 3300005834 Bacteria 655
54 Ga0068862_102510983 3300005844 Bacteria 527
55 Ga0075365_10002001 3300006038 Bacteria 9658
56 Ga0075367_10518967 3300006178 Bacteria 756
57 Ga0075366_10211784 3300006195 Bacteria 1180
58 Ga0075366_10841269 3300006195 Bacteria 571
59 Ga0075370_10242986 3300006353 Bacteria 1066
60 Ga0068871_100390799 3300006358 Bacteria 1237
61 Ga0075431_100069651 3300006847 Bacteria 3630
62 Ga0075431_100119872 3300006847 Bacteria 2714
63 Ga0075433_10042923 3300006852 Bacteria 3925
64 Ga0075433_10050011 3300006852 Bacteria 3638
65 Ga0075433_10205170 3300006852 Bacteria 1752
66 Ga0075434_100048572 3300006871 Bacteria 4210
67 Ga0068865_100643980 3300006881 Bacteria 900
68 Ga0068865_101443843 3300006881 Bacteria 615
69 Ga0097620_101223410 3300006931 Bacteria 827
70 Ga0075435_101158432 3300007076 Bacteria 676
71 Ga0111539_11114612 3300009094 Bacteria 917
72 Ga0105247_10767932 3300009101 Bacteria 732
73 Ga0114129_10218145 3300009147 Bacteria 2575
74 Ga0114129_10602933 3300009147 Bacteria 1423
75 Ga0105248_10121272 3300009177 Bacteria 2949
76 Ga0105239_10606086 3300010375 Bacteria 1249
77 Ga0105239_10620494 3300010375 Unclassified 1234
78 Ga0157369_10058323 3300013105 Bacteria 4164
79 Ga0157369_10259373 3300013105 Bacteria 1813
80 Ga0157369_10530144 3300013105 Unclassified 1218
81 Ga0163162_10324716 3300013306 Bacteria 1671
82 Ga0157372_10332531 3300013307 Bacteria 1769
83 Ga0157372_11128628 3300013307 Bacteria 907
84 Ga0157372_12791735 3300013307 Bacteria 560
85 Ga0157375_10689729 3300013308 Bacteria 1175
86 Ga0163163_11407353 3300014325 Bacteria 759
87 Ga0163163_11508434 3300014325 Bacteria 733
88 Ga0157380_10087855 3300014326 Bacteria 2557
89 Ga0157380_13040877 3300014326 Bacteria 535
90 Ga0213875_10009745 3300021388 Bacteria 4849
91 Ga0207697_10000133 3300025315 Bacteria 35922
92 Ga0207697_10026263 3300025315 Bacteria 2381
93 Ga0207688_10023538 3300025901 Bacteria 3373
94 Ga0207685_10146165 3300025905 Bacteria 1065
95 Ga0207684_11623512 3300025910 Bacteria 523
96 Ga0207657_10278768 3300025919 Bacteria 1328
97 Ga0207649_10101631 3300025920 Bacteria 1904
98 Ga0207652_10097780 3300025921 Bacteria 2588
99 Ga0207646_11720826 3300025922 Bacteria 538
100 Ga0207650_10008741 3300025925 Bacteria 6918
101 Ga0207650_10033799 3300025925 Bacteria 3706
102 Ga0207659_10257163 3300025926 Bacteria 1419
103 Ga0207706_10071679 3300025933 Bacteria 3048
104 Ga0207670_10059419 3300025936 Bacteria 2601
105 Ga0207669_10111278 3300025937 Bacteria 1836
106 Ga0207669_10243828 3300025937 Bacteria 1334
107 Ga0207669_10839151 3300025937 Bacteria 764
108 Ga0207704_11320974 3300025938 Bacteria 617
109 Ga0207691_10170612 3300025940 Bacteria 1905
110 Ga0207711_10971341 3300025941 Bacteria 788
111 Ga0207679_10024174 3300025945 Bacteria 4164
112 Ga0207679_10200998 3300025945 Bacteria 1665
113 Ga0207658_11972725 3300025986 Bacteria 531
114 Ga0207677_10118158 3300026023 Bacteria 1989
115 Ga0207708_10711114 3300026075 Bacteria 859
116 Ga0207676_10102911 3300026095 Bacteria 2372
117 Ga0207674_10041858 3300026116 Bacteria 4735
118 Ga0207683_10493221 3300026121 Bacteria 1131
119 Ga0207698_10143044 3300026142 Bacteria 2064
120 Ga0207698_11060544 3300026142 Bacteria 822
121 Ga0268266_10354871 3300028379 Bacteria 1379
122 Ga0265319_1176305 3300028563 Unclassified 659
123 Ga0265338_10452029 3300028800 Bacteria 909
124 Ga0265324_10019040 3300029957 Bacteria 2474
125 Ga0265332_10008004 3300031238 Bacteria 4761
126 Ga0265339_10055224 3300031249 Bacteria 2155
127 Ga0307408_100007962 3300031548 Bacteria 7007
128 Ga0316576_10231086 3300031727 Bacteria 1391
129 Ga0316576_10958393 3300031727 Bacteria 611
130 Ga0307405_10062725 3300031731 Bacteria 2355
131 Ga0307413_10114824 3300031824 Unclassified 1811
132 Ga0307413_11699094 3300031824 Bacteria 563
133 Ga0307406_10020562 3300031901 Bacteria 3890
134 Ga0307406_10299311 3300031901 Bacteria 1235
135 Ga0307407_10161877 3300031903 Bacteria 1465
136 Ga0307409_100080063 3300031995 Bacteria 2635
137 Ga0307409_100088597 3300031995 Bacteria 2527
138 Ga0307409_100541883 3300031995 Bacteria 1141
139 Ga0307409_101093540 3300031995 Bacteria 818
140 Ga0307416_100371381 3300032002 Unclassified 1456
141 Ga0307416_103365827 3300032002 Bacteria 535
142 Ga0307414_10033312 3300032004 Bacteria 3404
143 Ga0307411_10003264 3300032005 Bacteria 7485
144 Ga0307415_100650599 3300032126 Bacteria 945
145 Ga0316596_1054365 3300033541 Bacteria 1062
146 Ga0373926_0018481 3300035083 Bacteria 2398
147 Ga0373953_0320945 3300035117 Unclassified 677
148 Ga0373956_0248322 3300035119 Bacteria 846
149 Ga0373943_0025583 3300035170 Bacteria 2759
150 Ga0373935_0359230 3300035692 Bacteria 1040
151 Ga0373933_0027135 3300035724 Unclassified 3295
152 Ga0373937_0011685 3300036401 Bacteria 7700
153 Ga0373925_0047499 3300037068 Bacteria 3195
154 Ga0436364_1217511 3300037853 Unclassified 1492
155 Ga0436364_1392744 3300037853 Bacteria 4853
156 Ga0436365_1680445 3300039437 Bacteria 698
157 Ga0439453_0123151 3300041408 Bacteria 596
158 Ga0451807_2490252 3300041486 Bacteria 775
159 Ga0451849_0409898 3300041505 Bacteria 509
160 Ga0439431_0012492 3300041997 Bacteria 1951
161 Ga0439445_0079327 3300042004 Bacteria 916
162 Ga0450921_005230 3300042123 Bacteria 975
163 Ga0439446_0020879 3300042156 Bacteria 1848
164 Ga0439434_0024679 3300042435 Bacteria 1814
165 Ga0439435_0031563 3300042436 Bacteria 1441
166 Ga0439435_0208144 3300042436 Bacteria 647
167 Ga0451577_0115236 3300042876 Bacteria 2406
168 Ga0453684_0490696 3300044712 Bacteria 1361
169 Ga0466958_0454078 3300045836 Bacteria 830
170 Ga0495639_0360331 3300046475 Bacteria 731
171 Ga0495628_0468746 3300046516 Bacteria 913
172 Ga0495674_0803012 3300047319 Bacteria 732
173 Ga0496100_0297161 3300048903 Bacteria 1208
174 Ga0496102_0192642 3300048905 Bacteria 1921
175 Ga0496103_0247460 3300048906 Bacteria 1147
176 Ga0496104_0011026 3300048907 Bacteria 8086
177 Ga0496104_1315636 3300048907 Bacteria 626
178 Ga0496105_0025226 3300048908 Bacteria 4837
179 Ga0496106_1409440 3300048909 Bacteria 538
180 Ga0496107_0315302 3300048910 Bacteria 1164
181 Ga0496108_0339168 3300048911 Bacteria 1311
182 Ga0496109_0001122 3300048912 Bacteria 22259
183 Ga0496109_0392170 3300048912 Bacteria 1312
184 Ga0496109_0735330 3300048912 Bacteria 924
185 Ga0496110_0064769 3300048913 Bacteria 3231
186 Ga0496110_0107941 3300048913 Bacteria 2499
187 Ga0496110_0606915 3300048913 Bacteria 992
188 Ga0496111_0164007 3300048914 Bacteria 1650
189 Ga0496111_0308832 3300048914 Bacteria 1172
190 Ga0496111_0765719 3300048914 Bacteria 700
191 Ga0496112_0020498 3300048915 Bacteria 6268
192 Ga0496112_0312804 3300048915 Bacteria 1515
193 Ga0496113_0108316 3300048916 Bacteria 2160
194 Ga0496113_0584640 3300048916 Bacteria 894
195 Ga0496113_1193902 3300048916 Bacteria 594
196 Ga0496114_1702065 3300048917 Bacteria 519
197 Ga0501040_0068194 3300049576 Bacteria 2453
198 Ga0501043_0977040 3300049579 Unclassified 604
199 Ga0501048_0105599 3300049582 Bacteria 1988
200 Ga0501068_1100648 3300049584 Unclassified 525
201 Ga0501072_0794269 3300049588 Unclassified 741
202 Ga0501076_0448262 3300049592 Unclassified 1062
203 Ga0501076_0892760 3300049592 Bacteria 733
204 Ga0501077_0149393 3300049593 Unclassified 1483
205 Ga0501077_0970104 3300049593 Unclassified 547
206 Ga0501217_141550 3300049661 Bacteria 713
207 Ga0501079_0167111 3300049741 Bacteria 1716
208 Ga0501079_1019182 3300049741 Bacteria 652
209 Ga0501081_0336698 3300049743 Archaea 1111
210 Ga0501045_0401313 3300049824 Unclassified 1020
211 nmdc:mga0yw44_109981_c1 3300050492 Bacteria 1765
212 nmdc:mga0k408_218781_c1 3300050493 Bacteria 1137
213 nmdc:mga06z11_476467_c1 3300050494 Bacteria 755
214 nmdc:mga07m45_243136_c1 3300050496 Bacteria 1047
215 nmdc:mga05p37_189997_c1 3300050507 Bacteria 2494
216 nmdc:mga05p37_710868_c1 3300050507 Bacteria 1114
217 nmdc:mga09592_1232609_c1 3300050508 Bacteria 617
218 nmdc:mga0qj67_975202_c1 3300050509 Bacteria 666
219 nmdc:mga06r32_86852_c1 3300050510 Bacteria 3051
220 nmdc:mga08y16_160216_c1 3300050511 Bacteria 2338
221 nmdc:mga08y16_782316_c1 3300050511 Bacteria 948
222 nmdc:mga0n895_1218424_c1 3300050512 Bacteria 726
223 nmdc:mga0n895_969_c1 3300050512 Bacteria 13990
224 nmdc:mga0rr50_434742_c1 3300050513 Bacteria 1111
225 nmdc:mga0a205_183125_c1 3300050515 Bacteria 1988
226 nmdc:mga0a205_20103_c1 3300050515 Bacteria 6299
227 nmdc:mga0a205_404983_c1 3300050515 Bacteria 1228
228 nmdc:mga0a205_61131_c1 3300050515 Bacteria 3638
229 Ga0495601_0209361 3300053077 Bacteria 1274
230 Ga0495595_0143443 3300053084 Bacteria 1173
231 Ga0500651_0015108 3300053093 Bacteria 4735
232 Ga0500555_000280 3300053103 Bacteria 22110
233 Ga0500592_015607 3300053116 Bacteria 1220
234 Ga0500573_0017273 3300053140 Bacteria 4107
235 Ga0500645_000647 3300053730 Bacteria 22079
236 Ga0500552_000240 3300053733 Bacteria 4996
237 Ga0501084_1303307 3300054114 Bacteria 609
238 Ga0590071_001529 3300059421 Bacteria 6059
239 Ga0590071_010654 3300059421 Bacteria 2151
240 Ga0590075_000273 3300059424 Bacteria 14626
241 Ga0590075_074697 3300059424 Bacteria 877
242 Ga0590077_000232 3300059426 Bacteria 15988
243 Ga0590077_008158 3300059426 Bacteria 2144
244 Ga0590077_150159 3300059426 Bacteria 558
245 Ga0501082_0213460 3300060353 Bacteria 1679
246 Ga0065715_10184897
247 MBSR1b_contig_804242
248 Ga0032354_1021835
249 Ga0065704_10794411
250 Ga0065712_10081216
251 Ga0065712_10092461
252 Ga0065712_10092859
253 Ga0065712_10163388
254 Ga0065715_10195882
255 Ga0065715_10229951
256 Ga0065715_10970702
257 Ga0065707_10533204
258 Ga0070683_101224239
259 Ga0070670_100012012
260 Ga0070670_100025827
261 Ga0070670_100053379
262 Ga0070680_100482823
263 Ga0068868_100116960
264 Ga0070661_100109323
265 Ga0070661_100256760
266 Ga0070668_100404601
267 Ga0070675_100117502
268 Ga0070675_100579943
269 Ga0070671_100075760
270 Ga0070674_100029269
271 Ga0070674_100210145
272 Ga0070688_100204845
273 Ga0070688_101511834
274 Ga0070667_100045711
275 Ga0070709_11571081
276 Ga0070711_101648713
277 Ga0070700_100978273
278 Ga0070663_101468394
279 Ga0070662_101004890
280 Ga0070662_101040839
281 Ga0070679_100126123
282 Ga0070684_100009548
283 Ga0070672_100026860
284 Ga0070686_100594079
285 Ga0070686_100670035
286 Ga0070696_101128358
287 Ga0070664_100033054
288 Ga0070664_100244926
289 Ga0070664_100869967
290 Ga0068857_100016651
291 Ga0068857_101102744
292 Ga0068854_100431199
293 Ga0070702_100998735
294 Ga0068859_101223303
295 Ga0068864_100089055
296 Ga0068864_102001129
297 Ga0068864_102552240
298 Ga0068851_10629670
299 Ga0068862_102510983
300 Ga0075365_10002001
301 Ga0075367_10518967
302 Ga0075366_10211784
303 Ga0075366_10841269
304 Ga0075370_10242986
305 Ga0068871_100390799
306 Ga0075431_100069651
307 Ga0075431_100119872
308 Ga0075433_10042923
309 Ga0075433_10050011
310 Ga0075433_10205170
311 Ga0075434_100048572
312 Ga0068865_100643980
313 Ga0068865_101443843
314 Ga0097620_101223410
315 Ga0075435_101158432
316 Ga0111539_11114612
317 Ga0105247_10767932
318 Ga0114129_10218145
319 Ga0114129_10602933
320 Ga0105248_10121272
321 Ga0105239_10606086
322 Ga0105239_10620494
323 Ga0157369_10058323
324 Ga0157369_10259373
325 Ga0157369_10530144
326 Ga0163162_10324716
327 Ga0157372_10332531
328 Ga0157372_11128628
329 Ga0157372_12791735
330 Ga0157375_10689729
331 Ga0163163_11407353
332 Ga0163163_11508434
333 Ga0157380_10087855
334 Ga0157380_13040877
335 Ga0213875_10009745
336 Ga0207697_10000133
337 Ga0207697_10026263
338 Ga0207688_10023538
339 Ga0207685_10146165
340 Ga0207684_11623512
341 Ga0207657_10278768
342 Ga0207649_10101631
343 Ga0207652_10097780
344 Ga0207646_11720826
345 Ga0207650_10008741
346 Ga0207650_10033799
347 Ga0207659_10257163
348 Ga0207706_10071679
349 Ga0207670_10059419
350 Ga0207669_10111278
351 Ga0207669_10243828
352 Ga0207669_10839151
353 Ga0207704_11320974
354 Ga0207691_10170612
355 Ga0207711_10971341
356 Ga0207679_10024174
357 Ga0207679_10200998
358 Ga0207658_11972725
359 Ga0207677_10118158
360 Ga0207708_10711114
361 Ga0207676_10102911
362 Ga0207674_10041858
363 Ga0207683_10493221
364 Ga0207698_10143044
365 Ga0207698_11060544
366 Ga0268266_10354871
367 Ga0265319_1176305
368 Ga0265338_10452029
369 Ga0265324_10019040
370 Ga0265332_10008004
371 Ga0265339_10055224
372 Ga0307408_100007962
373 Ga0316576_10231086
374 Ga0316576_10958393
375 Ga0307405_10062725
376 Ga0307413_10114824
377 Ga0307413_11699094
378 Ga0307406_10020562
379 Ga0307406_10299311
380 Ga0307407_10161877
381 Ga0307409_100080063
382 Ga0307409_100088597
383 Ga0307409_100541883
384 Ga0307409_101093540
385 Ga0307416_100371381
386 Ga0307416_103365827
387 Ga0307414_10033312
388 Ga0307411_10003264
389 Ga0307415_100650599
390 Ga0316596_1054365
391 Ga0373926_0018481
392 Ga0373953_0320945
393 Ga0373956_0248322
394 Ga0373943_0025583
395 Ga0373935_0359230
396 Ga0373933_0027135
397 Ga0373937_0011685
398 Ga0373925_0047499
399 Ga0436364_1217511
400 Ga0436364_1392744
401 Ga0436365_1680445
402 Ga0439453_0123151
403 Ga0451807_2490252
404 Ga0451849_0409898
405 Ga0439431_0012492
406 Ga0439445_0079327
407 Ga0450921_005230
408 Ga0439446_0020879
409 Ga0439434_0024679
410 Ga0439435_0031563
411 Ga0439435_0208144
412 Ga0451577_0115236
413 Ga0453684_0490696
414 Ga0466958_0454078
415 Ga0495639_0360331
416 Ga0495628_0468746
417 Ga0495674_0803012
418 Ga0496100_0297161
419 Ga0496102_0192642
420 Ga0496103_0247460
421 Ga0496104_0011026
422 Ga0496104_1315636
423 Ga0496105_0025226
424 Ga0496106_1409440
425 Ga0496107_0315302
426 Ga0496108_0339168
427 Ga0496109_0001122
428 Ga0496109_0392170
429 Ga0496109_0735330
430 Ga0496110_0064769
431 Ga0496110_0107941
432 Ga0496110_0606915
433 Ga0496111_0164007
434 Ga0496111_0308832
435 Ga0496111_0765719
436 Ga0496112_0020498
437 Ga0496112_0312804
438 Ga0496113_0108316
439 Ga0496113_0584640
440 Ga0496113_1193902
441 Ga0496114_1702065
442 Ga0501040_0068194
443 Ga0501043_0977040
444 Ga0501048_0105599
445 Ga0501068_1100648
446 Ga0501072_0794269
447 Ga0501076_0448262
448 Ga0501076_0892760
449 Ga0501077_0149393
450 Ga0501077_0970104
451 Ga0501217_141550
452 Ga0501079_0167111
453 Ga0501079_1019182
454 Ga0501081_0336698
455 Ga0501045_0401313
456 nmdc:mga0yw44_109981_c1
457 nmdc:mga0k408_218781_c1
458 nmdc:mga06z11_476467_c1
459 nmdc:mga07m45_243136_c1
460 nmdc:mga05p37_189997_c1
461 nmdc:mga05p37_710868_c1
462 nmdc:mga09592_1232609_c1
463 nmdc:mga0qj67_975202_c1
464 nmdc:mga06r32_86852_c1
465 nmdc:mga08y16_160216_c1
466 nmdc:mga08y16_782316_c1
467 nmdc:mga0n895_1218424_c1
468 nmdc:mga0n895_969_c1
469 nmdc:mga0rr50_434742_c1
470 nmdc:mga0a205_183125_c1
471 nmdc:mga0a205_20103_c1
472 nmdc:mga0a205_404983_c1
473 nmdc:mga0a205_61131_c1
474 Ga0495601_0209361
475 Ga0495595_0143443
476 Ga0500651_0015108
477 Ga0500555_000280
478 Ga0500592_015607
479 Ga0500573_0017273
480 Ga0500645_000647
481 Ga0500552_000240
482 Ga0501084_1303307
483 Ga0590071_001529
484 Ga0590071_010654
485 Ga0590075_000273
486 Ga0590075_074697
487 Ga0590077_000232
488 Ga0590077_008158
489 Ga0590077_150159
490 Ga0501082_0213460

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01588

tRNA_bind

Putative tRNA binding domain

36

132

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2q2i-assembly1.cif.gz_A crystal structure of the protein secretion chaperone csaa from agrobacterium tumefaciens. 0.9907 7 118
2q2i-assembly1.cif.gz_A crystal structure of the protein secretion chaperone csaa from agrobacterium tumefaciens. 0.982 7 118
2q2i-assembly1.cif.gz_B crystal structure of the protein secretion chaperone csaa from agrobacterium tumefaciens. 0.9783 7 118
2q2h-assembly1.cif.gz_B crystal structure of the protein secretion chaperone csaa from agrobacterium tumefaciens with a genetically fused phage-display derived peptide substrate at the n-terminus. 0.9746 8 118
2q2i-assembly1.cif.gz_B crystal structure of the protein secretion chaperone csaa from agrobacterium tumefaciens. 0.9696 7 118
ID Description Score Start End Superfamily
af_Q54B13_2_117_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9802 9 118 2.40.50.140
2q2iB00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9783 7 118 2.40.50.140
2q2iB00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9696 7 118 2.40.50.140
1gd7A00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9646 9 118 2.40.50.140
1gd7A00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.956 9 118 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A0S7X0D5-F1-model_v4 tRNA-binding protein 0.9991 9 118 GO:0000049
AF-A0A235HI33-F1-model_v4 tRNA-binding protein 0.9968 8 118 GO:0000049
AF-A0A1H3F4R2-F1-model_v4 tRNA-binding protein 0.9968 9 118 GO:0000049
AF-A0A443K1Q4-F1-model_v4 tRNA-binding protein 0.9967 8 118 GO:0000049
AF-A0A4D8PEU6-F1-model_v4 tRNA-binding protein 0.9967 8 118 GO:0000049

Map