F356954

General Info

Members Datasets Scaffolds Average Seq Length
244 190 239 114

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|640427133|640487821
Length 135
Sequence WPLHAAPPGNTLARQYFEPHPIMPIWLQTAALLCCSNLFMTFAWYGHLKTLNGKPWLVAALISWGIAFFEYMLMVPANRIGYTELSVGQLKIMQEVITLMVFVPFSVLYMQQPLKLDYLWAGLCLVGAVYFIFRS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2643221660 Methylibium sp. Root1272 Isolate Unclassified
3 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
4 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
70 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
108 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
109 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
110 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
111 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
112 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
113 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
114 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
115 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
118 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
119 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
120 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
121 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
122 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
123 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
124 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
125 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
126 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
127 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
134 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
135 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
136 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
137 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
138 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
139 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
140 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
141 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
142 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
145 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
146 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
147 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
150 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
162 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
163 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
164 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
165 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
166 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
167 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
168 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
169 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
170 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
171 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
172 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
173 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
174 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
175 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
176 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
179 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
180 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
181 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
182 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
183 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
184 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
185 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
186 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
187 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
188 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
189 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
190 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.54
Metatranscriptomes 0.41
Isolates 2.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.41
Nodule 0
Rhizoplane 0.82
Rhizosphere 95.49
Stem 0
Stem Tuber 0
Unclassified 3.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2114609 2162886007 Bacteria 1135
2 JGI25406J46586_10036462 3300003203 Bacteria 1784
3 Ga0058862_12725616 3300004803 Viruses 703
4 Ga0065704_10097625 3300005289 Bacteria 2386
5 Ga0070658_10061207 3300005327 Bacteria 3067
6 Ga0070658_10209405 3300005327 Bacteria 1647
7 Ga0070676_10678263 3300005328 Bacteria 751
8 Ga0070690_101607294 3300005330 Bacteria 527
9 Ga0070670_100488544 3300005331 Bacteria 1094
10 Ga0070670_101051051 3300005331 Bacteria 742
11 Ga0070670_102179917 3300005331 Bacteria 511
12 Ga0068869_100048489 3300005334 Unclassified 3071
13 Ga0070680_100198147 3300005336 Bacteria 1693
14 Ga0070680_100470868 3300005336 Bacteria 1074
15 Ga0068868_100310554 3300005338 Unclassified 1341
16 Ga0070660_100418061 3300005339 Bacteria 1110
17 Ga0070689_100844173 3300005340 Bacteria 808
18 Ga0070689_101928246 3300005340 Bacteria 540
19 Ga0070668_100006445 3300005347 Bacteria 8701
20 Ga0070675_100164975 3300005354 Bacteria 1907
21 Ga0070675_101486357 3300005354 Bacteria 625
22 Ga0070671_100101222 3300005355 Bacteria 2417
23 Ga0070674_100065192 3300005356 Bacteria 2556
24 Ga0070673_100265787 3300005364 Bacteria 1500
25 Ga0070667_100047309 3300005367 Bacteria 3619
26 Ga0070714_101455239 3300005435 Bacteria 669
27 Ga0070713_100000026 3300005436 Bacteria 95308
28 Ga0070705_100233298 3300005440 Bacteria 1282
29 Ga0070694_100011316 3300005444 Bacteria 5524
30 Ga0070694_100981432 3300005444 Bacteria 701
31 Ga0070708_100253163 3300005445 Bacteria 1654
32 Ga0070706_100755771 3300005467 Bacteria 901
33 Ga0070679_100089000 3300005530 Bacteria 3074
34 Ga0070697_100111073 3300005536 Bacteria 2284
35 Ga0070697_101709423 3300005536 Bacteria 563
36 Ga0068853_100567730 3300005539 Bacteria 1076
37 Ga0070672_100011905 3300005543 Bacteria 6081
38 Ga0070672_100065093 3300005543 Bacteria 2882
39 Ga0070672_100373828 3300005543 Bacteria 1218
40 Ga0070672_100505605 3300005543 Bacteria 1046
41 Ga0070695_100027132 3300005545 Bacteria 3546
42 Ga0070696_100163202 3300005546 Bacteria 1643
43 Ga0070696_100893179 3300005546 Bacteria 737
44 Ga0070665_100067970 3300005548 Bacteria 3572
45 Ga0068852_100745162 3300005616 Bacteria 992
46 Ga0068859_101012131 3300005617 Bacteria 913
47 Ga0068859_102527873 3300005617 Bacteria 565
48 Ga0068861_100930606 3300005719 Bacteria 825
49 Ga0068863_100051755 3300005841 Bacteria 3892
50 Ga0068863_101035568 3300005841 Bacteria 824
51 Ga0068858_100736671 3300005842 Bacteria 960
52 Ga0068862_100447630 3300005844 Bacteria 1217
53 Ga0081539_10000338 3300005985 Bacteria 103849
54 Ga0097621_100490329 3300006237 Bacteria 1112
55 Ga0068871_101842684 3300006358 Bacteria 575
56 Ga0075428_101920509 3300006844 Bacteria 615
57 Ga0075430_100001429 3300006846 Bacteria 19418
58 Ga0075430_100037191 3300006846 Bacteria 4127
59 Ga0075431_100006677 3300006847 Bacteria 11462
60 Ga0068865_100119824 3300006881 Bacteria 1954
61 Ga0097620_101012175 3300006931 Bacteria 913
62 Ga0097620_102527069 3300006931 Bacteria 565
63 Ga0114129_10689479 3300009147 Bacteria 1314
64 Ga0105243_11089243 3300009148 Unclassified 806
65 Ga0105242_10014290 3300009176 Bacteria 6149
66 Ga0105248_10221639 3300009177 Bacteria 2129
67 Ga0105248_10231224 3300009177 Bacteria 2081
68 Ga0105248_12563573 3300009177 Bacteria 581
69 Ga0105249_10349835 3300009553 Bacteria 1497
70 Ga0105246_10412668 3300011119 Bacteria 1124
71 Ga0157373_10028972 3300013100 Bacteria 3992
72 Ga0157371_10494262 3300013102 Bacteria 903
73 Ga0157370_10647593 3300013104 Bacteria 966
74 Ga0157374_11572413 3300013296 Bacteria 681
75 Ga0157374_12368195 3300013296 Bacteria 558
76 Ga0157374_12864598 3300013296 Bacteria 510
77 Ga0157378_10642130 3300013297 Unclassified 1076
78 Ga0163162_10790963 3300013306 Bacteria 1066
79 Ga0163162_12175154 3300013306 Bacteria 637
80 Ga0157372_10281105 3300013307 Bacteria 1935
81 Ga0157375_10557734 3300013308 Bacteria 1307
82 Ga0157375_10586571 3300013308 Bacteria 1275
83 Ga0157375_11746843 3300013308 Bacteria 737
84 Ga0163163_10214144 3300014325 Bacteria 1975
85 Ga0163163_12429327 3300014325 Bacteria 582
86 Ga0157380_12361164 3300014326 Bacteria 597
87 Ga0157379_10042902 3300014968 Bacteria 4039
88 Ga0157379_10204857 3300014968 Unclassified 1784
89 Ga0157379_11840737 3300014968 Bacteria 595
90 Ga0157376_10017169 3300014969 Bacteria 5513
91 Ga0163161_10744470 3300017792 Bacteria 819
92 Ga0213876_10011929 3300021384 Bacteria 4632
93 Ga0207685_10272263 3300025905 Bacteria 827
94 Ga0207705_10063686 3300025909 Bacteria 2664
95 Ga0207660_11653606 3300025917 Bacteria 515
96 Ga0207662_10373858 3300025918 Bacteria 961
97 Ga0207657_10374850 3300025919 Bacteria 1121
98 Ga0207652_10154124 3300025921 Bacteria 2058
99 Ga0207659_10136195 3300025926 Bacteria 1901
100 Ga0207700_10000375 3300025928 Bacteria 26197
101 Ga0207664_11096171 3300025929 Bacteria 712
102 Ga0207644_10313177 3300025931 Bacteria 1267
103 Ga0207706_11683426 3300025933 Bacteria 511
104 Ga0207670_10091593 3300025936 Bacteria 2150
105 Ga0207670_11682349 3300025936 Bacteria 540
106 Ga0207691_10022154 3300025940 Bacteria 5994
107 Ga0207691_10154892 3300025940 Bacteria 2013
108 Ga0207691_10254483 3300025940 Bacteria 1515
109 Ga0207691_10387371 3300025940 Bacteria 1193
110 Ga0207711_10029551 3300025941 Bacteria 4624
111 Ga0207711_10279475 3300025941 Bacteria 1537
112 Ga0207711_10954175 3300025941 Bacteria 796
113 Ga0207689_10036895 3300025942 Unclassified 4056
114 Ga0207651_10273203 3300025960 Bacteria 1393
115 Ga0207668_10199974 3300025972 Bacteria 1590
116 Ga0207703_11724624 3300026035 Bacteria 602
117 Ga0207639_11123715 3300026041 Bacteria 737
118 Ga0207641_10255912 3300026088 Bacteria 1637
119 Ga0207641_10266694 3300026088 Bacteria 1605
120 Ga0207641_10581527 3300026088 Bacteria 1095
121 Ga0207674_11765773 3300026116 Bacteria 586
122 Ga0207675_100116398 3300026118 Bacteria 2526
123 Ga0207675_100588887 3300026118 Bacteria 1114
124 Ga0209969_1003591 3300027360 Bacteria 2149
125 Ga0209969_1017187 3300027360 Bacteria 1064
126 Ga0209981_1015067 3300027378 Bacteria 1081
127 Ga0209996_1007387 3300027395 Bacteria 1429
128 Ga0209984_1006227 3300027424 Bacteria 1459
129 Ga0210000_1012727 3300027462 Bacteria 1252
130 Ga0209968_1006149 3300027526 Bacteria 1806
131 Ga0210002_1068756 3300027617 Bacteria 623
132 Ga0209983_1008748 3300027665 Bacteria 2066
133 Ga0209971_1005146 3300027682 Bacteria 3105
134 Ga0209966_1081241 3300027695 Bacteria 719
135 Ga0209974_10040008 3300027876 Bacteria 1560
136 Ga0268266_10150546 3300028379 Bacteria 2097
137 Ga0268265_10133844 3300028380 Bacteria 2065
138 Ga0265318_10018347 3300028577 Bacteria 2856
139 Ga0265338_10564524 3300028800 Unclassified 796
140 Ga0265332_10005006 3300031238 Bacteria 6157
141 Ga0265320_10013456 3300031240 Bacteria 4706
142 Ga0265331_10001591 3300031250 Bacteria 16583
143 Ga0265327_10283400 3300031251 Bacteria 732
144 Ga0307408_100292281 3300031548 Bacteria 1361
145 Ga0307408_100624218 3300031548 Bacteria 960
146 Ga0265314_10000609 3300031711 Bacteria 44215
147 Ga0316576_10811628 3300031727 Bacteria 673
148 Ga0307405_10730251 3300031731 Bacteria 823
149 Ga0307405_11138009 3300031731 Bacteria 672
150 Ga0307410_11375166 3300031852 Bacteria 619
151 Ga0307416_100106157 3300032002 Bacteria 2461
152 Ga0307416_100230272 3300032002 Bacteria 1786
153 Ga0307416_100335304 3300032002 Bacteria 1522
154 Ga0307414_10017721 3300032004 Bacteria 4364
155 Ga0307411_11248874 3300032005 Bacteria 675
156 Ga0307411_11535789 3300032005 Bacteria 613
157 Ga0373948_0212663 3300034817 Bacteria 509
158 Ga0373958_0172622 3300034819 Bacteria 553
159 Ga0373940_0113338 3300035088 Bacteria 835
160 Ga0373939_0208522 3300035114 Bacteria 743
161 Ga0373960_0047532 3300035121 Bacteria 1263
162 Ga0373955_0428498 3300035172 Bacteria 805
163 Ga0373961_0246557 3300035241 Bacteria 645
164 Ga0373927_0005885 3300035695 Bacteria 8402
165 Ga0373933_1152784 3300035724 Bacteria 511
166 Ga0373937_1612854 3300036401 Unclassified 596
167 Ga0395900_0005416 3300037418 Bacteria 13371
168 Ga0395900_1037322 3300037418 Bacteria 739
169 Ga0395905_0011958 3300037471 Bacteria 8368
170 Ga0395905_0056576 3300037471 Bacteria 3669
171 Ga0395901_0005626 3300038443 Bacteria 12680
172 Ga0436365_0989924 3300039437 Bacteria 800
173 Ga0436365_1570938 3300039437 Bacteria 4641
174 Ga0436365_1858042 3300039437 Bacteria 805
175 Ga0451855_1835631 3300041511 Bacteria 609
176 Ga0439443_091154 3300042003 Bacteria 576
177 Ga0439450_014085 3300042008 Bacteria 1617
178 Ga0450917_022874 3300042120 Bacteria 566
179 Ga0450891_025514 3300042129 Bacteria 596
180 Ga0439464_0003246 3300042439 Bacteria 4093
181 Ga0439460_0063771 3300042461 Bacteria 1129
182 Ga0451577_0021052 3300042876 Bacteria 5975
183 Ga0451577_0303510 3300042876 Bacteria 1446
184 Ga0453683_0581220 3300044673 Bacteria 730
185 Ga0451576_0471822 3300045051 Bacteria 1318
186 Ga0466967_1412042 3300045976 Bacteria 693
187 Ga0495598_0435932 3300046537 Bacteria 517
188 Ga0495621_0010189 3300046539 Bacteria 2869
189 Ga0495621_0164345 3300046539 Bacteria 879
190 Ga0495657_0147321 3300046675 Bacteria 1464
191 Ga0495636_0184607 3300047318 Bacteria 947
192 Ga0496106_0225762 3300048909 Bacteria 1494
193 Ga0496113_0424619 3300048916 Bacteria 1068
194 Ga0501031_1110739 3300049568 Bacteria 504
195 Ga0501032_0066232 3300049569 Bacteria 2414
196 Ga0501032_1057038 3300049569 Bacteria 509
197 Ga0501034_0077570 3300049571 Bacteria 3328
198 Ga0501034_1012512 3300049571 Bacteria 714
199 Ga0501036_0935078 3300049572 Bacteria 711
200 Ga0501038_0070748 3300049574 Bacteria 2961
201 Ga0501039_0134209 3300049575 Bacteria 1943
202 Ga0501040_0005768 3300049576 Bacteria 8013
203 Ga0501040_0241828 3300049576 Bacteria 1287
204 Ga0501041_0003327 3300049577 Bacteria 9251
205 Ga0501043_0083088 3300049579 Bacteria 2518
206 Ga0501046_0029810 3300049580 Bacteria 4433
207 Ga0501048_0014144 3300049582 Bacteria 5914
208 Ga0501048_0713787 3300049582 Bacteria 720
209 Ga0501068_0071341 3300049584 Bacteria 2120
210 Ga0501071_0018126 3300049587 Bacteria 4869
211 Ga0501072_0005841 3300049588 Bacteria 9377
212 Ga0501073_0101421 3300049589 Bacteria 1999
213 Ga0501074_0056184 3300049590 Bacteria 2837
214 Ga0501075_0017548 3300049591 Bacteria 5169
215 Ga0501076_0004433 3300049592 Bacteria 9984
216 Ga0501077_0064574 3300049593 Bacteria 2322
217 Ga0501202_076709 3300049652 Bacteria 779
218 Ga0501209_000133 3300049656 Bacteria 8060
219 Ga0501233_267669 3300049668 Bacteria 519
220 Ga0501079_0006135 3300049741 Bacteria 9011
221 Ga0501081_0008150 3300049743 Bacteria 6800
222 Ga0501283_020071 3300049779 Bacteria 1062
223 Ga0501045_0075407 3300049824 Bacteria 2484
224 nmdc:mga03683_334697_c1 3300050489 Bacteria 714
225 nmdc:mga05p37_361203_c1 3300050507 Bacteria 1707
226 nmdc:mga09592_1352988_c1 3300050508 Bacteria 584
227 nmdc:mga0qj67_371121_c1 3300050509 Bacteria 1156
228 nmdc:mga0qj67_408_c1 3300050509 Bacteria 29642
229 nmdc:mga06r32_1252980_c1 3300050510 Bacteria 687
230 nmdc:mga06r32_3739_c1 3300050510 Bacteria 13608
231 nmdc:mga08y16_1338752_c1 3300050511 Bacteria 681
232 nmdc:mga08y16_151864_c1 3300050511 Bacteria 2407
233 nmdc:mga0n895_974875_c1 3300050512 Bacteria 830
234 Ga0495601_0109311 3300053077 Bacteria 1790
235 Ga0495619_0541753 3300053085 Unclassified 799
236 Ga0501084_0105444 3300054114 Bacteria 2367
237 Ga0590075_222866 3300059424 Bacteria 500
238 Ga0501082_0007110 3300060353 Bacteria 9657
239 Ga0530510_0000591 3300061734 Bacteria 23339

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005354 Ga0070675_101486357 Ga0070675_1014863571 89
2 3300004803 Ga0058862_12725616 Ga0058862_127256162 94
3 3300005844 Ga0068862_100447630 Ga0068862_1004476302 95
4 3300009148 Ga0105243_11089243 Ga0105243_110892432 95
5 3300009176 Ga0105242_10014290 Ga0105242_100142901 95
6 3300014968 Ga0157379_10204857 Ga0157379_102048571 95
7 3300026118 Ga0207675_100588887 Ga0207675_1005888872 95
8 3300046537 Ga0495598_0435932 Ga0495598_0435932_151_441 95
9 3300036401 Ga0373937_1612854 Ga0373937_1612854_29_328 96
10 3300042120 Ga0450917_022874 Ga0450917_022874_243_539 96
11 3300009147 Ga0114129_10689479 Ga0114129_106894792 106
12 3300005336 Ga0070680_100198147 Ga0070680_1001981473 107
13 3300025917 Ga0207660_11653606 Ga0207660_116536061 107
14 3300003203 JGI25406J46586_10036462 JGI25406J46586_100364624 108
15 3300005328 Ga0070676_10678263 Ga0070676_106782631 108
16 3300005330 Ga0070690_101607294 Ga0070690_1016072941 108
17 3300005331 Ga0070670_102179917 Ga0070670_1021799171 108
18 3300005334 Ga0068869_100048489 Ga0068869_1000484892 108
19 3300005338 Ga0068868_100310554 Ga0068868_1003105542 108
20 3300005340 Ga0070689_100844173 Ga0070689_1008441732 108
21 3300005340 Ga0070689_101928246 Ga0070689_1019282461 108
22 3300005364 Ga0070673_100265787 Ga0070673_1002657873 108
23 3300005367 Ga0070667_100047309 Ga0070667_1000473092 108
24 3300005440 Ga0070705_100233298 Ga0070705_1002332982 108
25 3300005444 Ga0070694_100011316 Ga0070694_1000113167 108
26 3300005444 Ga0070694_100981432 Ga0070694_1009814322 108
27 3300005445 Ga0070708_100253163 Ga0070708_1002531632 108
28 3300005467 Ga0070706_100755771 Ga0070706_1007557712 108
29 3300005536 Ga0070697_100111073 Ga0070697_1001110731 108
30 3300005536 Ga0070697_101709423 Ga0070697_1017094232 108
31 3300005543 Ga0070672_100011905 Ga0070672_1000119052 108
32 3300005543 Ga0070672_100373828 Ga0070672_1003738282 108
33 3300005545 Ga0070695_100027132 Ga0070695_1000271323 108
34 3300005546 Ga0070696_100163202 Ga0070696_1001632023 108
35 3300005546 Ga0070696_100893179 Ga0070696_1008931792 108
36 3300005616 Ga0068852_100745162 Ga0068852_1007451622 108
37 3300005617 Ga0068859_101012131 Ga0068859_1010121312 108
38 3300005841 Ga0068863_101035568 Ga0068863_1010355681 108
39 3300005985 Ga0081539_10000338 Ga0081539_1000033874 108
40 3300006237 Ga0097621_100490329 Ga0097621_1004903291 108
41 3300006844 Ga0075428_101920509 Ga0075428_1019205092 108
42 3300006846 Ga0075430_100001429 Ga0075430_1000014299 108
43 3300006846 Ga0075430_100037191 Ga0075430_1000371915 108
44 3300006847 Ga0075431_100006677 Ga0075431_1000066773 108
45 3300006931 Ga0097620_101012175 Ga0097620_1010121752 108
46 3300009177 Ga0105248_12563573 Ga0105248_125635732 108
47 3300009553 Ga0105249_10349835 Ga0105249_103498352 108
48 3300011119 Ga0105246_10412668 Ga0105246_104126682 108
49 3300013102 Ga0157371_10494262 Ga0157371_104942622 108
50 3300013104 Ga0157370_10647593 Ga0157370_106475932 108
51 3300013296 Ga0157374_11572413 Ga0157374_115724131 108
52 3300013296 Ga0157374_12368195 Ga0157374_123681951 108
53 3300013296 Ga0157374_12864598 Ga0157374_128645982 108
54 3300013297 Ga0157378_10642130 Ga0157378_106421302 108
55 3300013306 Ga0163162_10790963 Ga0163162_107909631 108
56 3300013307 Ga0157372_10281105 Ga0157372_102811053 108
57 3300013308 Ga0157375_10586571 Ga0157375_105865711 108
58 3300014325 Ga0163163_10214144 Ga0163163_102141442 108
59 3300014325 Ga0163163_12429327 Ga0163163_124293271 108
60 3300014326 Ga0157380_12361164 Ga0157380_123611642 108
61 3300014968 Ga0157379_11840737 Ga0157379_118407372 108
62 3300017792 Ga0163161_10744470 Ga0163161_107444702 108
63 3300025905 Ga0207685_10272263 Ga0207685_102722632 108
64 3300025918 Ga0207662_10373858 Ga0207662_103738582 108
65 3300025936 Ga0207670_10091593 Ga0207670_100915933 108
66 3300025936 Ga0207670_11682349 Ga0207670_116823491 108
67 3300025940 Ga0207691_10022154 Ga0207691_100221546 108
68 3300025940 Ga0207691_10154892 Ga0207691_101548922 108
69 3300025941 Ga0207711_10029551 Ga0207711_100295512 108
70 3300025942 Ga0207689_10036895 Ga0207689_100368954 108
71 3300026088 Ga0207641_10255912 Ga0207641_102559123 108
72 3300026116 Ga0207674_11765773 Ga0207674_117657731 108
73 3300027360 Ga0209969_1003591 Ga0209969_10035912 108
74 3300027360 Ga0209969_1017187 Ga0209969_10171872 108
75 3300027378 Ga0209981_1015067 Ga0209981_10150671 108
76 3300027395 Ga0209996_1007387 Ga0209996_10073872 108
77 3300027424 Ga0209984_1006227 Ga0209984_10062273 108
78 3300027462 Ga0210000_1012727 Ga0210000_10127272 108
79 3300027526 Ga0209968_1006149 Ga0209968_10061493 108
80 3300027617 Ga0210002_1068756 Ga0210002_10687561 108
81 3300027665 Ga0209983_1008748 Ga0209983_10087482 108
82 3300027682 Ga0209971_1005146 Ga0209971_10051463 108
83 3300027695 Ga0209966_1081241 Ga0209966_10812412 108
84 3300027876 Ga0209974_10040008 Ga0209974_100400081 108
85 3300028380 Ga0268265_10133844 Ga0268265_101338442 108
86 3300028577 Ga0265318_10018347 Ga0265318_100183473 108
87 3300028800 Ga0265338_10564524 Ga0265338_105645242 108
88 3300031238 Ga0265332_10005006 Ga0265332_100050064 108
89 3300031240 Ga0265320_10013456 Ga0265320_100134563 108
90 3300031250 Ga0265331_10001591 Ga0265331_100015919 108
91 3300031251 Ga0265327_10283400 Ga0265327_102834001 108
92 3300031548 Ga0307408_100624218 Ga0307408_1006242182 108
93 3300031731 Ga0307405_10730251 Ga0307405_107302512 108
94 3300031852 Ga0307410_11375166 Ga0307410_113751662 108
95 3300032002 Ga0307416_100106157 Ga0307416_1001061574 108
96 3300032002 Ga0307416_100230272 Ga0307416_1002302722 108
97 3300032002 Ga0307416_100335304 Ga0307416_1003353043 108
98 3300032005 Ga0307411_11535789 Ga0307411_115357892 108
99 3300034817 Ga0373948_0212663 Ga0373948_0212663_139_486 108
100 3300035114 Ga0373939_0208522 Ga0373939_0208522_282_629 108
101 3300035695 Ga0373927_0005885 Ga0373927_0005885_3799_4158 108
102 3300035724 Ga0373933_1152784 Ga0373933_1152784_31_390 108
103 3300039437 Ga0436365_1858042 Ga0436365_1858042_92_433 108
104 3300041511 Ga0451855_1835631 Ga0451855_1835631_212_571 108
105 3300042003 Ga0439443_091154 Ga0439443_091154_163_504 108
106 3300042129 Ga0450891_025514 Ga0450891_025514_191_562 108
107 3300044673 Ga0453683_0581220 Ga0453683_0581220_372_713 108
108 3300045051 Ga0451576_0471822 Ga0451576_0471822_746_1093 108
109 3300047318 Ga0495636_0184607 Ga0495636_0184607_172_519 108
110 3300048909 Ga0496106_0225762 Ga0496106_0225762_419_778 108
111 3300048916 Ga0496113_0424619 Ga0496113_0424619_344_685 108
112 3300049568 Ga0501031_1110739 Ga0501031_1110739_127_474 108
113 3300049569 Ga0501032_0066232 Ga0501032_0066232_969_1310 108
114 3300049569 Ga0501032_1057038 Ga0501032_1057038_148_495 108
115 3300049571 Ga0501034_0077570 Ga0501034_0077570_1767_2108 108
116 3300049571 Ga0501034_1012512 Ga0501034_1012512_276_617 108
117 3300049572 Ga0501036_0935078 Ga0501036_0935078_124_471 108
118 3300049574 Ga0501038_0070748 Ga0501038_0070748_1576_1923 108
119 3300049575 Ga0501039_0134209 Ga0501039_0134209_1023_1370 108
120 3300049576 Ga0501040_0005768 Ga0501040_0005768_1393_1740 108
121 3300049576 Ga0501040_0241828 Ga0501040_0241828_358_705 108
122 3300049577 Ga0501041_0003327 Ga0501041_0003327_5762_6109 108
123 3300049579 Ga0501043_0083088 Ga0501043_0083088_207_554 108
124 3300049580 Ga0501046_0029810 Ga0501046_0029810_1006_1353 108
125 3300049582 Ga0501048_0014144 Ga0501048_0014144_1926_2273 108
126 3300049582 Ga0501048_0713787 Ga0501048_0713787_202_549 108
127 3300049584 Ga0501068_0071341 Ga0501068_0071341_1526_1873 108
128 3300049587 Ga0501071_0018126 Ga0501071_0018126_2802_3149 108
129 3300049588 Ga0501072_0005841 Ga0501072_0005841_2668_3015 108
130 3300049589 Ga0501073_0101421 Ga0501073_0101421_159_506 108
131 3300049590 Ga0501074_0056184 Ga0501074_0056184_516_863 108
132 3300049591 Ga0501075_0017548 Ga0501075_0017548_3925_4272 108
133 3300049592 Ga0501076_0004433 Ga0501076_0004433_4853_5200 108
134 3300049593 Ga0501077_0064574 Ga0501077_0064574_463_810 108
135 3300049652 Ga0501202_076709 Ga0501202_076709_246_593 108
136 3300049656 Ga0501209_000133 Ga0501209_000133_4113_4472 108
137 3300049668 Ga0501233_267669 Ga0501233_267669_118_465 108
138 3300049741 Ga0501079_0006135 Ga0501079_0006135_7596_7943 108
139 3300049743 Ga0501081_0008150 Ga0501081_0008150_2171_2518 108
140 3300049779 Ga0501283_020071 Ga0501283_020071_42_389 108
141 3300049824 Ga0501045_0075407 Ga0501045_0075407_1963_2310 108
142 3300050507 nmdc:mga05p37_361203_c1 nmdc:mga05p37_361203_c1_602_952 108
143 3300050508 nmdc:mga09592_1352988_c1 nmdc:mga09592_1352988_c1_225_572 108
144 3300050509 nmdc:mga0qj67_371121_c1 nmdc:mga0qj67_371121_c1_232_579 108
145 3300050509 nmdc:mga0qj67_408_c1 nmdc:mga0qj67_408_c1_8356_8703 108
146 3300050510 nmdc:mga06r32_1252980_c1 nmdc:mga06r32_1252980_c1_101_466 108
147 3300050510 nmdc:mga06r32_3739_c1 nmdc:mga06r32_3739_c1_10241_10588 108
148 3300050511 nmdc:mga08y16_1338752_c1 nmdc:mga08y16_1338752_c1_217_564 108
149 3300050512 nmdc:mga0n895_974875_c1 nmdc:mga0n895_974875_c1_191_538 108
150 3300054114 Ga0501084_0105444 Ga0501084_0105444_1131_1478 108
151 3300060353 Ga0501082_0007110 Ga0501082_0007110_7369_7716 108
152 3300061734 Ga0530510_0000591 Ga0530510_0000591_6306_6653 108
153 iso_pu_bacteria 2808606373 2808903961 108
154 iso_pu_bacteria 640427133 640487821 108
155 iso_pu_bacteria 651053060 651175765 108
156 2162886007 SwRhRL2b_contig_2114609 SwRhRL2b_0211.00003240 109
157 3300005289 Ga0065704_10097625 Ga0065704_100976253 109
158 3300005327 Ga0070658_10061207 Ga0070658_100612073 109
159 3300005327 Ga0070658_10209405 Ga0070658_102094052 109
160 3300005331 Ga0070670_100488544 Ga0070670_1004885443 109
161 3300005331 Ga0070670_101051051 Ga0070670_1010510512 109
162 3300005336 Ga0070680_100470868 Ga0070680_1004708682 109
163 3300005339 Ga0070660_100418061 Ga0070660_1004180612 109
164 3300005347 Ga0070668_100006445 Ga0070668_1000064457 109
165 3300005354 Ga0070675_100164975 Ga0070675_1001649753 109
166 3300005355 Ga0070671_100101222 Ga0070671_1001012223 109
167 3300005356 Ga0070674_100065192 Ga0070674_1000651922 109
168 3300005435 Ga0070714_101455239 Ga0070714_1014552391 109
169 3300005436 Ga0070713_100000026 Ga0070713_10000002621 109
170 3300005530 Ga0070679_100089000 Ga0070679_1000890004 109
171 3300005539 Ga0068853_100567730 Ga0068853_1005677302 109
172 3300005543 Ga0070672_100065093 Ga0070672_1000650932 109
173 3300005543 Ga0070672_100505605 Ga0070672_1005056051 109
174 3300005548 Ga0070665_100067970 Ga0070665_1000679702 109
175 3300005617 Ga0068859_102527873 Ga0068859_1025278732 109
176 3300005719 Ga0068861_100930606 Ga0068861_1009306062 109
177 3300005841 Ga0068863_100051755 Ga0068863_1000517555 109
178 3300005842 Ga0068858_100736671 Ga0068858_1007366711 109
179 3300006358 Ga0068871_101842684 Ga0068871_1018426841 109
180 3300006881 Ga0068865_100119824 Ga0068865_1001198242 109
181 3300006931 Ga0097620_102527069 Ga0097620_1025270692 109
182 3300009177 Ga0105248_10221639 Ga0105248_102216393 109
183 3300009177 Ga0105248_10231224 Ga0105248_102312242 109
184 3300013100 Ga0157373_10028972 Ga0157373_100289723 109
185 3300013306 Ga0163162_12175154 Ga0163162_121751542 109
186 3300013308 Ga0157375_10557734 Ga0157375_105577342 109
187 3300013308 Ga0157375_11746843 Ga0157375_117468432 109
188 3300014968 Ga0157379_10042902 Ga0157379_100429022 109
189 3300014969 Ga0157376_10017169 Ga0157376_100171695 109
190 3300021384 Ga0213876_10011929 Ga0213876_100119292 109
191 3300025909 Ga0207705_10063686 Ga0207705_100636862 109
192 3300025919 Ga0207657_10374850 Ga0207657_103748502 109
193 3300025921 Ga0207652_10154124 Ga0207652_101541243 109
194 3300025926 Ga0207659_10136195 Ga0207659_101361952 109
195 3300025928 Ga0207700_10000375 Ga0207700_1000037516 109
196 3300025929 Ga0207664_11096171 Ga0207664_110961712 109
197 3300025931 Ga0207644_10313177 Ga0207644_103131772 109
198 3300025933 Ga0207706_11683426 Ga0207706_116834261 109
199 3300025940 Ga0207691_10254483 Ga0207691_102544832 109
200 3300025940 Ga0207691_10387371 Ga0207691_103873712 109
201 3300025941 Ga0207711_10279475 Ga0207711_102794751 109
202 3300025941 Ga0207711_10954175 Ga0207711_109541752 109
203 3300025960 Ga0207651_10273203 Ga0207651_102732032 109
204 3300025972 Ga0207668_10199974 Ga0207668_101999742 109
205 3300026035 Ga0207703_11724624 Ga0207703_117246241 109
206 3300026041 Ga0207639_11123715 Ga0207639_111237151 109
207 3300026088 Ga0207641_10266694 Ga0207641_102666943 109
208 3300026088 Ga0207641_10581527 Ga0207641_105815272 109
209 3300026118 Ga0207675_100116398 Ga0207675_1001163982 109
210 3300028379 Ga0268266_10150546 Ga0268266_101505463 109
211 3300031548 Ga0307408_100292281 Ga0307408_1002922812 109
212 3300031711 Ga0265314_10000609 Ga0265314_1000060926 109
213 3300031727 Ga0316576_10811628 Ga0316576_108116281 109
214 3300031731 Ga0307405_11138009 Ga0307405_111380091 109
215 3300032004 Ga0307414_10017721 Ga0307414_100177216 109
216 3300032005 Ga0307411_11248874 Ga0307411_112488742 109
217 3300034819 Ga0373958_0172622 Ga0373958_0172622_139_489 109
218 3300035088 Ga0373940_0113338 Ga0373940_0113338_418_807 109
219 3300035121 Ga0373960_0047532 Ga0373960_0047532_123_473 109
220 3300035172 Ga0373955_0428498 Ga0373955_0428498_51_410 109
221 3300035241 Ga0373961_0246557 Ga0373961_0246557_144_494 109
222 3300037418 Ga0395900_0005416 Ga0395900_0005416_12617_12970 109
223 3300037418 Ga0395900_1037322 Ga0395900_1037322_45_398 109
224 3300037471 Ga0395905_0011958 Ga0395905_0011958_336_689 109
225 3300037471 Ga0395905_0056576 Ga0395905_0056576_547_900 109
226 3300038443 Ga0395901_0005626 Ga0395901_0005626_7826_8179 109
227 3300039437 Ga0436365_0989924 Ga0436365_0989924_104_457 109
228 3300039437 Ga0436365_1570938 Ga0436365_1570938_2376_2729 109
229 3300042008 Ga0439450_014085 Ga0439450_014085_1086_1445 109
230 3300042439 Ga0439464_0003246 Ga0439464_0003246_1044_1403 109
231 3300042461 Ga0439460_0063771 Ga0439460_0063771_121_480 109
232 3300042876 Ga0451577_0021052 Ga0451577_0021052_313_663 109
233 3300042876 Ga0451577_0303510 Ga0451577_0303510_64_396 109
234 3300045976 Ga0466967_1412042 Ga0466967_1412042_58_411 109
235 3300046539 Ga0495621_0010189 Ga0495621_0010189_671_1027 109
236 3300046539 Ga0495621_0164345 Ga0495621_0164345_461_811 109
237 3300046675 Ga0495657_0147321 Ga0495657_0147321_329_676 109
238 3300050489 nmdc:mga03683_334697_c1 nmdc:mga03683_334697_c1_222_572 109
239 3300050511 nmdc:mga08y16_151864_c1 nmdc:mga08y16_151864_c1_287_643 109
240 3300053077 Ga0495601_0109311 Ga0495601_0109311_417_779 109
241 3300053085 Ga0495619_0541753 Ga0495619_0541753_296_652 109
242 3300059424 Ga0590075_222866 Ga0590075_222866_26_361 109
243 iso_pu_bacteria 2643221660 2644338783 109
244 iso_pu_bacteria 2990196909 2990199198 109

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04342

DMT_6

Putative member of DMT superfamily (DUF486)

29

133

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8tgy-assembly1.cif.gz_E crystal structure of gdx-clo from small multidrug resistance family of transporters in complex with guanylurea 0.731 3 103
7ssu-assembly1.cif.gz_B structure of emre-d3 mutant in complex with monobody l10 and methyltriphenylphosphonium 0.7127 3 107
7mgx-assembly1.cif.gz_B structure of emre-d3 mutant in complex with monobody l10 and methyl viologen 0.7016 3 107
8tgy-assembly1.cif.gz_E crystal structure of gdx-clo from small multidrug resistance family of transporters in complex with guanylurea 0.6852 3 103
7ssu-assembly1.cif.gz_B structure of emre-d3 mutant in complex with monobody l10 and methyltriphenylphosphonium 0.6845 3 107
ID Description Score Start End Superfamily
af_P69210_8_109_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.7956 3 105 1.10.3730.20
af_Q3C1C7_10_111_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.7926 4 104 1.10.3730.20
af_I1KSB6_13_116_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.7823 3 104 1.10.3730.20
af_P69212_3_109_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.7772 3 108 1.10.3730.20
af_Q47377_2_110_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.7767 3 105 1.10.3730.20
ID Description Score Start End GO Terms
AF-A0A3N7GG36-F1-model_v4 DMT family protein 0.9834 2 88 GO:0016020
AF-A0A3D2SS65-F1-model_v4 DMT family protein 0.9817 1 106 GO:0016020
AF-A0A7Y6TX72-F1-model_v4 DMT family protein 0.9809 2 106 GO:0016020
AF-A0A0U2JDX8-F1-model_v4 DMT family protein 0.9792 1 78 GO:0016020
AF-A0A645I2G2-F1-model_v4 Uncharacterized protein 0.9773 2 90 GO:0016020

Feature Viewer

pLDDT pTM Quality
92.45 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map