F356860

General Info

Members Datasets Scaffolds Average Seq Length
244 186 488 177

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0023391|Ga0501047_0023391_1148_1804
Length 218
Sequence MSATDGLVRRSDDDPVSSASPGRHPNVRGRVGAEDPRWEIGRMAKLFFGMNQSLDGYVDHTAFGPCPALFRHFIEQTRGLAGSVYGRGLYEVMRYWDEDDPAWDAAERAFAQAWRRVPKWVVSRSLTSVGPNATLVEGDLETAIRALKAGLAGEIELGGPDLAQGLADLGLVDEYRLYLHPVVLGRGKPLFAGPRPPLRLVANDRIGKDAIRLTYAPA

Samples

Sample ID Description Type Environment
1 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
62 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
63 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
106 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
107 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
108 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
109 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
110 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
111 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
112 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
113 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
114 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
115 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
116 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
117 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
118 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
124 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
125 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
126 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
127 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
128 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
129 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
130 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
131 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
132 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
133 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
134 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
135 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
136 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
137 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
138 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
139 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
140 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
141 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
142 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
143 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
144 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
145 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
146 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
149 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
154 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
155 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
156 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
157 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
158 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
159 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
165 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
166 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
167 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
168 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
169 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
170 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
171 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
172 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
173 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
174 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
175 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
177 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
178 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
179 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
180 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
181 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
182 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
183 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
184 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
185 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
186 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.23
Nodule 0
Rhizoplane 3.28
Rhizosphere 92.21
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501047_0023391 3300049581 Bacteria 5933
2 Ga0065714_10212745 3300005288 Bacteria 859
3 Ga0065712_10006870 3300005290 Bacteria 3879
4 Ga0070658_10271870 3300005327 Bacteria 1441
5 Ga0070683_100173388 3300005329 Bacteria 2048
6 Ga0070670_100138683 3300005331 Bacteria 2103
7 Ga0070670_100799112 3300005331 Bacteria 852
8 Ga0070680_100035913 3300005336 Bacteria 4002
9 Ga0070660_100648007 3300005339 Bacteria 884
10 Ga0070661_100135401 3300005344 Bacteria 1853
11 Ga0070692_10098499 3300005345 Bacteria 1599
12 Ga0070668_100006479 3300005347 Bacteria 8681
13 Ga0070675_100258645 3300005354 Bacteria 1525
14 Ga0070671_100020100 3300005355 Bacteria 5441
15 Ga0070671_100369786 3300005355 Bacteria 1224
16 Ga0070673_100045304 3300005364 Bacteria 3410
17 Ga0070667_100001160 3300005367 Bacteria 23921
18 Ga0070709_10000825 3300005434 Bacteria 17308
19 Ga0070714_100009339 3300005435 Bacteria 7706
20 Ga0070713_100071081 3300005436 Bacteria 2940
21 Ga0070710_10002997 3300005437 Bacteria 8027
22 Ga0070708_100147854 3300005445 Bacteria 2183
23 Ga0070663_100253806 3300005455 Bacteria 1393
24 Ga0070681_10053793 3300005458 Bacteria 4011
25 Ga0070681_10076622 3300005458 Bacteria 3302
26 Ga0070698_100133246 3300005471 Bacteria 2439
27 Ga0070679_100024259 3300005530 Bacteria 5943
28 Ga0070679_100053946 3300005530 Bacteria 4002
29 Ga0070679_100470926 3300005530 Bacteria 1200
30 Ga0068853_100230746 3300005539 Bacteria 1693
31 Ga0068853_100367959 3300005539 Bacteria 1341
32 Ga0070672_100012064 3300005543 Bacteria 6048
33 Ga0070672_100179899 3300005543 Bacteria 1762
34 Ga0070686_100657360 3300005544 Bacteria 832
35 Ga0068855_100308175 3300005563 Bacteria 1752
36 Ga0070664_100001159 3300005564 Bacteria 20903
37 Ga0070664_100034158 3300005564 Bacteria 4266
38 Ga0070664_100109206 3300005564 Bacteria 2413
39 Ga0068856_100000158 3300005614 Bacteria 70033
40 Ga0068856_100855550 3300005614 Bacteria 929
41 Ga0068859_100049136 3300005617 Bacteria 4237
42 Ga0068859_101394826 3300005617 Bacteria 773
43 Ga0068864_100056485 3300005618 Bacteria 3392
44 Ga0068863_100008957 3300005841 Bacteria 9771
45 Ga0068863_100413592 3300005841 Bacteria 1320
46 Ga0068858_101076877 3300005842 Bacteria 789
47 Ga0068860_100021404 3300005843 Bacteria 6261
48 Ga0068860_100238621 3300005843 Bacteria 1768
49 Ga0068862_100003891 3300005844 Bacteria 12692
50 Ga0081455_10005206 3300005937 Bacteria 14308
51 Ga0070716_100005097 3300006173 Bacteria 6343
52 Ga0070712_100062076 3300006175 Bacteria 2642
53 Ga0075366_10129998 3300006195 Bacteria 1519
54 Ga0075428_100351745 3300006844 Bacteria 1581
55 Ga0075431_100075490 3300006847 Bacteria 3479
56 Ga0075433_10556073 3300006852 Bacteria 1008
57 Ga0097620_100049136 3300006931 Bacteria 4237
58 Ga0097620_101394797 3300006931 Bacteria 773
59 Ga0099794_10027758 3300007265 Bacteria 2627
60 Ga0105240_10373480 3300009093 Bacteria 1612
61 Ga0105240_10629522 3300009093 Bacteria 1178
62 Ga0111539_11755161 3300009094 Bacteria 720
63 Ga0114129_12510946 3300009147 Bacteria 616
64 Ga0105248_10015611 3300009177 Bacteria 8372
65 Ga0105248_10075111 3300009177 Bacteria 3799
66 Ga0105248_11077564 3300009177 Bacteria 908
67 Ga0105237_10412486 3300009545 Bacteria 1356
68 Ga0105238_10003930 3300009551 Bacteria 14746
69 Ga0105239_10495204 3300010375 Bacteria 1389
70 Ga0157370_10747213 3300013104 Bacteria 891
71 Ga0157369_10002350 3300013105 Bacteria 22745
72 Ga0157369_10076555 3300013105 Bacteria 3586
73 Ga0163162_10104157 3300013306 Bacteria 2932
74 Ga0157375_10005629 3300013308 Bacteria 10908
75 Ga0157375_10581049 3300013308 Bacteria 1281
76 Ga0163163_10068918 3300014325 Bacteria 3521
77 Ga0182008_10366875 3300014497 Bacteria 767
78 Ga0157379_10433900 3300014968 Bacteria 1211
79 Ga0157379_10630642 3300014968 Bacteria 1002
80 Ga0157376_10014276 3300014969 Bacteria 5957
81 Ga0213873_10000019 3300021358 Bacteria 122085
82 Ga0213876_10000075 3300021384 Bacteria 120068
83 Ga0209051_1033908 3300025303 Bacteria 1921
84 Ga0207692_10001861 3300025898 Bacteria 8027
85 Ga0207680_10239935 3300025903 Bacteria 1249
86 Ga0207685_10001828 3300025905 Bacteria 4652
87 Ga0207699_10011390 3300025906 Bacteria 4490
88 Ga0207705_10033018 3300025909 Bacteria 3699
89 Ga0207684_10001348 3300025910 Bacteria 26914
90 Ga0207707_10000911 3300025912 Bacteria 28830
91 Ga0207707_10017746 3300025912 Bacteria 6209
92 Ga0207707_10032706 3300025912 Bacteria 4552
93 Ga0207695_10252514 3300025913 Bacteria 1662
94 Ga0207695_10749248 3300025913 Bacteria 857
95 Ga0207671_10692594 3300025914 Bacteria 811
96 Ga0207693_10061576 3300025915 Bacteria 2939
97 Ga0207663_10041305 3300025916 Bacteria 2810
98 Ga0207660_10022649 3300025917 Bacteria 4234
99 Ga0207660_10033222 3300025917 Bacteria 3567
100 Ga0207660_10317089 3300025917 Bacteria 1244
101 Ga0207657_10348376 3300025919 Bacteria 1168
102 Ga0207649_10347114 3300025920 Bacteria 1097
103 Ga0207652_10000810 3300025921 Bacteria 29837
104 Ga0207652_10037910 3300025921 Bacteria 4082
105 Ga0207652_10507563 3300025921 Bacteria 1085
106 Ga0207650_10146912 3300025925 Bacteria 1858
107 Ga0207650_10279094 3300025925 Bacteria 1360
108 Ga0207650_10486455 3300025925 Bacteria 1030
109 Ga0207650_10772421 3300025925 Bacteria 814
110 Ga0207700_11039188 3300025928 Bacteria 733
111 Ga0207664_10040232 3300025929 Bacteria 3634
112 Ga0207644_10014474 3300025931 Bacteria 5275
113 Ga0207644_10312453 3300025931 Bacteria 1269
114 Ga0207644_10429300 3300025931 Bacteria 1083
115 Ga0207706_10153915 3300025933 Bacteria 2023
116 Ga0207686_10130334 3300025934 Bacteria 1724
117 Ga0207665_10001277 3300025939 Bacteria 16992
118 Ga0207691_10042936 3300025940 Bacteria 4168
119 Ga0207691_10170312 3300025940 Bacteria 1907
120 Ga0207711_10040459 3300025941 Bacteria 3966
121 Ga0207711_10048249 3300025941 Bacteria 3643
122 Ga0207661_10502896 3300025944 Bacteria 1107
123 Ga0207679_10304620 3300025945 Bacteria 1375
124 Ga0207651_10562497 3300025960 Bacteria 993
125 Ga0207712_10102915 3300025961 Bacteria 2127
126 Ga0207668_10012595 3300025972 Bacteria 5183
127 Ga0207640_10033322 3300025981 Bacteria 3204
128 Ga0207703_10075161 3300026035 Bacteria 2799
129 Ga0207639_10008287 3300026041 Bacteria 7121
130 Ga0207678_11055767 3300026067 Bacteria 719
131 Ga0207702_10000167 3300026078 Bacteria 78662
132 Ga0207702_10549979 3300026078 Bacteria 1129
133 Ga0207641_10076522 3300026088 Bacteria 2893
134 Ga0207648_10627603 3300026089 Bacteria 992
135 Ga0207676_10058311 3300026095 Bacteria 3045
136 Ga0207675_100429973 3300026118 Bacteria 1305
137 Ga0207698_10156227 3300026142 Bacteria 1988
138 Ga0209588_1030467 3300027671 Bacteria 1723
139 Ga0268264_10011248 3300028381 Bacteria 7396
140 Ga0268264_10184207 3300028381 Bacteria 1899
141 Ga0265331_10000002 3300031250 Bacteria 511481
142 Ga0307408_100043981 3300031548 Bacteria 3180
143 Ga0307413_10830075 3300031824 Bacteria 779
144 Ga0307410_10294002 3300031852 Bacteria 1279
145 Ga0307407_10249994 3300031903 Bacteria 1214
146 Ga0307412_10017739 3300031911 Bacteria 4265
147 Ga0307409_101222012 3300031995 Bacteria 775
148 Ga0307414_10002135 3300032004 Bacteria 10325
149 Ga0307414_10799786 3300032004 Bacteria 860
150 Ga0307414_11154084 3300032004 Bacteria 716
151 Ga0307411_10021241 3300032005 Bacteria 3794
152 Ga0307415_101302015 3300032126 Bacteria 688
153 Ga0373926_0111211 3300035083 Bacteria 1029
154 Ga0373927_0394200 3300035695 Bacteria 913
155 Ga0373947_0160158 3300035725 Bacteria 1455
156 Ga0373925_0116757 3300037068 Bacteria 2067
157 Ga0395899_0115414 3300037312 Bacteria 1927
158 Ga0395899_0587163 3300037312 Bacteria 711
159 Ga0395900_0058861 3300037418 Bacteria 3955
160 Ga0395900_0510179 3300037418 Bacteria 1152
161 Ga0395905_0012174 3300037471 Bacteria 8284
162 Ga0395905_0280877 3300037471 Bacteria 1551
163 Ga0395905_0285156 3300037471 Bacteria 1538
164 Ga0395901_0037500 3300038443 Bacteria 5013
165 Ga0395901_0067786 3300038443 Bacteria 3717
166 Ga0395901_0172100 3300038443 Bacteria 2272
167 Ga0395901_0248956 3300038443 Bacteria 1852
168 Ga0436365_0561345 3300039437 Bacteria 61690
169 Ga0436362_0592983 3300039453 Bacteria 296966
170 Ga0466961_0009034 3300044693 Bacteria 6358
171 Ga0466960_0064823 3300044901 Bacteria 1803
172 Ga0495638_0000888 3300046460 Bacteria 30663
173 Ga0495653_0187688 3300046463 Bacteria 1413
174 Ga0495664_0141210 3300046477 Bacteria 1460
175 Ga0495632_0045985 3300046519 Bacteria 2171
176 Ga0495632_0188673 3300046519 Bacteria 942
177 Ga0495640_0024423 3300046533 Bacteria 4397
178 Ga0495587_0084429 3300046536 Bacteria 1839
179 Ga0495621_0016633 3300046539 Bacteria 2363
180 Ga0495668_0002308 3300046616 Bacteria 15974
181 Ga0495625_0010912 3300046660 Bacteria 7463
182 Ga0495635_0115318 3300046663 Bacteria 1834
183 Ga0495659_0003737 3300046664 Bacteria 4842
184 Ga0495623_0092769 3300046679 Bacteria 1850
185 Ga0495658_0071505 3300046683 Bacteria 2016
186 Ga0495669_0063794 3300046684 Bacteria 1671
187 Ga0495671_0139675 3300046692 Bacteria 1180
188 Ga0495600_0052517 3300046809 Bacteria 2662
189 Ga0495600_0169524 3300046809 Bacteria 1409
190 Ga0495604_0064905 3300047317 Bacteria 2781
191 Ga0495674_0054312 3300047319 Bacteria 3518
192 Ga0495676_0222131 3300047321 Bacteria 1301
193 Ga0495684_0111034 3300047471 Bacteria 2069
194 Ga0496104_0378404 3300048907 Bacteria 1328
195 Ga0496105_0153523 3300048908 Bacteria 1892
196 Ga0496107_0467202 3300048910 Bacteria 937
197 Ga0496110_0449461 3300048913 Bacteria 1174
198 Ga0496111_0610329 3300048914 Bacteria 798
199 Ga0496112_0014227 3300048915 Bacteria 7373
200 Ga0496114_0421741 3300048917 Bacteria 1182
201 Ga0496114_1383880 3300048917 Bacteria 591
202 Ga0496118_0207333 3300048921 Bacteria 1154
203 Ga0496121_0086025 3300048924 Bacteria 2472
204 Ga0496121_0264219 3300048924 Bacteria 1186
205 Ga0496124_0343022 3300048927 Bacteria 1060
206 Ga0496125_0418308 3300048928 Bacteria 778
207 Ga0496126_0018869 3300048929 Bacteria 6816
208 Ga0501033_0046746 3300049570 Bacteria 3218
209 Ga0501037_0510643 3300049573 Bacteria 814
210 Ga0501038_0772820 3300049574 Bacteria 715
211 Ga0501041_0111455 3300049577 Bacteria 1697
212 Ga0501042_0495225 3300049578 Bacteria 887
213 Ga0501069_0538577 3300049585 Bacteria 698
214 Ga0501071_0370546 3300049587 Bacteria 1091
215 Ga0501073_0043477 3300049589 Bacteria 3168
216 Ga0501075_0026238 3300049591 Bacteria 4286
217 Ga0501075_0754223 3300049591 Bacteria 741
218 Ga0501076_0117757 3300049592 Bacteria 2150
219 Ga0501077_0174029 3300049593 Bacteria 1368
220 Ga0501077_0454672 3300049593 Bacteria 820
221 Ga0501230_028175 3300049667 Bacteria 1031
222 Ga0501079_0093116 3300049741 Bacteria 2335
223 Ga0501080_0028018 3300049742 Bacteria 5239
224 Ga0501080_0597093 3300049742 Bacteria 980
225 Ga0501081_0014576 3300049743 Bacteria 5187
226 Ga0501081_0509034 3300049743 Bacteria 898
227 Ga0501278_007646 3300049774 Bacteria 824
228 Ga0501035_0036718 3300049822 Bacteria 4440
229 Ga0501044_0001036 3300049823 Bacteria 33479
230 Ga0501044_0047275 3300049823 Bacteria 4451
231 Ga0501044_0639118 3300049823 Bacteria 954
232 nmdc:mga0yw44_502815_c1 3300050492 Bacteria 822
233 nmdc:mga05p37_1494234_c1 3300050507 Bacteria 673
234 nmdc:mga05p37_905221_c1 3300050507 Bacteria 951
235 nmdc:mga0rr50_1045557_c1 3300050513 Bacteria 695
236 nmdc:mga0a205_68665_c1 3300050515 Bacteria 3423
237 Ga0495601_0006789 3300053077 Bacteria 6703
238 Ga0495601_0032870 3300053077 Bacteria 3231
239 Ga0495612_0124539 3300053078 Bacteria 1110
240 Ga0495612_0229330 3300053078 Bacteria 823
241 Ga0495619_0001719 3300053085 Bacteria 14526
242 Ga0590071_007950 3300059421 Bacteria 2505
243 Ga0590074_036573 3300059423 Bacteria 877
244 Ga0501082_0057668 3300060353 Bacteria 3345
245 Ga0501047_0023391
246 Ga0065714_10212745
247 Ga0065712_10006870
248 Ga0070658_10271870
249 Ga0070683_100173388
250 Ga0070670_100138683
251 Ga0070670_100799112
252 Ga0070680_100035913
253 Ga0070660_100648007
254 Ga0070661_100135401
255 Ga0070692_10098499
256 Ga0070668_100006479
257 Ga0070675_100258645
258 Ga0070671_100020100
259 Ga0070671_100369786
260 Ga0070673_100045304
261 Ga0070667_100001160
262 Ga0070709_10000825
263 Ga0070714_100009339
264 Ga0070713_100071081
265 Ga0070710_10002997
266 Ga0070708_100147854
267 Ga0070663_100253806
268 Ga0070681_10053793
269 Ga0070681_10076622
270 Ga0070698_100133246
271 Ga0070679_100024259
272 Ga0070679_100053946
273 Ga0070679_100470926
274 Ga0068853_100230746
275 Ga0068853_100367959
276 Ga0070672_100012064
277 Ga0070672_100179899
278 Ga0070686_100657360
279 Ga0068855_100308175
280 Ga0070664_100001159
281 Ga0070664_100034158
282 Ga0070664_100109206
283 Ga0068856_100000158
284 Ga0068856_100855550
285 Ga0068859_100049136
286 Ga0068859_101394826
287 Ga0068864_100056485
288 Ga0068863_100008957
289 Ga0068863_100413592
290 Ga0068858_101076877
291 Ga0068860_100021404
292 Ga0068860_100238621
293 Ga0068862_100003891
294 Ga0081455_10005206
295 Ga0070716_100005097
296 Ga0070712_100062076
297 Ga0075366_10129998
298 Ga0075428_100351745
299 Ga0075431_100075490
300 Ga0075433_10556073
301 Ga0097620_100049136
302 Ga0097620_101394797
303 Ga0099794_10027758
304 Ga0105240_10373480
305 Ga0105240_10629522
306 Ga0111539_11755161
307 Ga0114129_12510946
308 Ga0105248_10015611
309 Ga0105248_10075111
310 Ga0105248_11077564
311 Ga0105237_10412486
312 Ga0105238_10003930
313 Ga0105239_10495204
314 Ga0157370_10747213
315 Ga0157369_10002350
316 Ga0157369_10076555
317 Ga0163162_10104157
318 Ga0157375_10005629
319 Ga0157375_10581049
320 Ga0163163_10068918
321 Ga0182008_10366875
322 Ga0157379_10433900
323 Ga0157379_10630642
324 Ga0157376_10014276
325 Ga0213873_10000019
326 Ga0213876_10000075
327 Ga0209051_1033908
328 Ga0207692_10001861
329 Ga0207680_10239935
330 Ga0207685_10001828
331 Ga0207699_10011390
332 Ga0207705_10033018
333 Ga0207684_10001348
334 Ga0207707_10000911
335 Ga0207707_10017746
336 Ga0207707_10032706
337 Ga0207695_10252514
338 Ga0207695_10749248
339 Ga0207671_10692594
340 Ga0207693_10061576
341 Ga0207663_10041305
342 Ga0207660_10022649
343 Ga0207660_10033222
344 Ga0207660_10317089
345 Ga0207657_10348376
346 Ga0207649_10347114
347 Ga0207652_10000810
348 Ga0207652_10037910
349 Ga0207652_10507563
350 Ga0207650_10146912
351 Ga0207650_10279094
352 Ga0207650_10486455
353 Ga0207650_10772421
354 Ga0207700_11039188
355 Ga0207664_10040232
356 Ga0207644_10014474
357 Ga0207644_10312453
358 Ga0207644_10429300
359 Ga0207706_10153915
360 Ga0207686_10130334
361 Ga0207665_10001277
362 Ga0207691_10042936
363 Ga0207691_10170312
364 Ga0207711_10040459
365 Ga0207711_10048249
366 Ga0207661_10502896
367 Ga0207679_10304620
368 Ga0207651_10562497
369 Ga0207712_10102915
370 Ga0207668_10012595
371 Ga0207640_10033322
372 Ga0207703_10075161
373 Ga0207639_10008287
374 Ga0207678_11055767
375 Ga0207702_10000167
376 Ga0207702_10549979
377 Ga0207641_10076522
378 Ga0207648_10627603
379 Ga0207676_10058311
380 Ga0207675_100429973
381 Ga0207698_10156227
382 Ga0209588_1030467
383 Ga0268264_10011248
384 Ga0268264_10184207
385 Ga0265331_10000002
386 Ga0307408_100043981
387 Ga0307413_10830075
388 Ga0307410_10294002
389 Ga0307407_10249994
390 Ga0307412_10017739
391 Ga0307409_101222012
392 Ga0307414_10002135
393 Ga0307414_10799786
394 Ga0307414_11154084
395 Ga0307411_10021241
396 Ga0307415_101302015
397 Ga0373926_0111211
398 Ga0373927_0394200
399 Ga0373947_0160158
400 Ga0373925_0116757
401 Ga0395899_0115414
402 Ga0395899_0587163
403 Ga0395900_0058861
404 Ga0395900_0510179
405 Ga0395905_0012174
406 Ga0395905_0280877
407 Ga0395905_0285156
408 Ga0395901_0037500
409 Ga0395901_0067786
410 Ga0395901_0172100
411 Ga0395901_0248956
412 Ga0436365_0561345
413 Ga0436362_0592983
414 Ga0466961_0009034
415 Ga0466960_0064823
416 Ga0495638_0000888
417 Ga0495653_0187688
418 Ga0495664_0141210
419 Ga0495632_0045985
420 Ga0495632_0188673
421 Ga0495640_0024423
422 Ga0495587_0084429
423 Ga0495621_0016633
424 Ga0495668_0002308
425 Ga0495625_0010912
426 Ga0495635_0115318
427 Ga0495659_0003737
428 Ga0495623_0092769
429 Ga0495658_0071505
430 Ga0495669_0063794
431 Ga0495671_0139675
432 Ga0495600_0052517
433 Ga0495600_0169524
434 Ga0495604_0064905
435 Ga0495674_0054312
436 Ga0495676_0222131
437 Ga0495684_0111034
438 Ga0496104_0378404
439 Ga0496105_0153523
440 Ga0496107_0467202
441 Ga0496110_0449461
442 Ga0496111_0610329
443 Ga0496112_0014227
444 Ga0496114_0421741
445 Ga0496114_1383880
446 Ga0496118_0207333
447 Ga0496121_0086025
448 Ga0496121_0264219
449 Ga0496124_0343022
450 Ga0496125_0418308
451 Ga0496126_0018869
452 Ga0501033_0046746
453 Ga0501037_0510643
454 Ga0501038_0772820
455 Ga0501041_0111455
456 Ga0501042_0495225
457 Ga0501069_0538577
458 Ga0501071_0370546
459 Ga0501073_0043477
460 Ga0501075_0026238
461 Ga0501075_0754223
462 Ga0501076_0117757
463 Ga0501077_0174029
464 Ga0501077_0454672
465 Ga0501230_028175
466 Ga0501079_0093116
467 Ga0501080_0028018
468 Ga0501080_0597093
469 Ga0501081_0014576
470 Ga0501081_0509034
471 Ga0501278_007646
472 Ga0501035_0036718
473 Ga0501044_0001036
474 Ga0501044_0047275
475 Ga0501044_0639118
476 nmdc:mga0yw44_502815_c1
477 nmdc:mga05p37_1494234_c1
478 nmdc:mga05p37_905221_c1
479 nmdc:mga0rr50_1045557_c1
480 nmdc:mga0a205_68665_c1
481 Ga0495601_0006789
482 Ga0495601_0032870
483 Ga0495612_0124539
484 Ga0495612_0229330
485 Ga0495619_0001719
486 Ga0590071_007950
487 Ga0590074_036573
488 Ga0501082_0057668

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

44

211

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vdr-assembly1.cif.gz_A dihydrofolate reductase 0.7673 3 176
1vdr-assembly1.cif.gz_A dihydrofolate reductase 0.763 3 176
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.7548 2 176
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.7507 2 176
3fl9-assembly8.cif.gz_H crystal structure of b. anthracis dihydrofolate reductase (dhfr) with trimethoprim 0.7454 3 176
ID Description Score Start End Superfamily
1vdrA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7673 3 176 3.40.430.10
1vdrA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.763 3 176 3.40.430.10
3fl9F00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7426 3 176 3.40.430.10
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7413 2 176 3.40.430.10
af_A0A0R0KAP7_457_568_3.30.70.240 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7279 156 175 3.30.70.240
ID Description Score Start End GO Terms
AF-A0A435HEI2-F1-model_v4 Dihydrofolate reductase 0.9835 1 130
AF-A0A5C4SWX9-F1-model_v4 Dihydrofolate reductase 0.9779 21 176 GO:0008703
GO:0009231
AF-A0A435HEI2-F1-model_v4 Dihydrofolate reductase 0.9761 1 130
AF-A0A249P3I0-F1-model_v4 Dihydrofolate reductase 0.9711 1 176 GO:0008703
GO:0009231
AF-A0A2A6I880-F1-model_v4 deleted 0.9682 1 176

Map