F356559

General Info

Members Datasets Scaffolds Average Seq Length
244 143 488 117

Family's Representative Sequence

Representative Sequence 3300025918|Ga0207662_10113461|Ga0207662_101134613
Length 136
Sequence MVSVSRRLDITIFLEISYGAMKIPAVIAALGALAHEYRLAVYRLLVERGPEGLPAGIIGERVGLVPSSLTFHLQALQRAGLIRQTRASRQLIYSADYAVMNELVGYLTDNCCGASGGACDAACGPATRSPKRGRAA

Samples

Sample ID Description Type Environment
1 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
99 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
100 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
102 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
103 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
104 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
105 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
106 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
107 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
111 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
112 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
113 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
114 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
115 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
116 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
117 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
118 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
119 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
120 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
121 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
122 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
123 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
124 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
125 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
126 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
127 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
128 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
129 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
130 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
131 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
132 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
133 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
134 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
135 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
136 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
137 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
138 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
139 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
140 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
141 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
142 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
143 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0.41
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.64
Nodule 0
Rhizoplane 5.74
Rhizosphere 86.07
Stem 0
Stem Tuber 0
Unclassified 22.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207662_10113461 3300025918 Bacteria 1692
2 SwRhRL3b_contig_1194850 2162886006 Unclassified 805
3 rootL2_10001353 3300003322 Bacteria 5986
4 Ga0065707_10082306 3300005295 Bacteria 17058
5 Ga0070658_10231617 3300005327 Bacteria 1564
6 Ga0070677_10796765 3300005333 Bacteria 539
7 Ga0068869_100208811 3300005334 Bacteria 1543
8 Ga0070682_100039194 3300005337 Bacteria 2910
9 Ga0068868_100372125 3300005338 Bacteria 1228
10 Ga0068868_100420770 3300005338 Bacteria 1157
11 Ga0070660_101193071 3300005339 Bacteria 645
12 Ga0070687_100350900 3300005343 Bacteria 952
13 Ga0070668_100281216 3300005347 Bacteria 1390
14 Ga0070668_100319929 3300005347 Bacteria 1306
15 Ga0070669_100082849 3300005353 Bacteria 2392
16 Ga0070669_100393192 3300005353 Bacteria 1133
17 Ga0070669_100867552 3300005353 Bacteria 770
18 Ga0070675_100033922 3300005354 Bacteria 4139
19 Ga0070675_100178171 3300005354 Bacteria 1837
20 Ga0070671_100352624 3300005355 Unclassified 1256
21 Ga0070674_100058063 3300005356 Bacteria 2688
22 Ga0070674_100080964 3300005356 Bacteria 2320
23 Ga0070674_100118093 3300005356 Bacteria 1959
24 Ga0070673_100317448 3300005364 Bacteria 1375
25 Ga0070673_100626623 3300005364 Bacteria 983
26 Ga0070673_101217030 3300005364 Bacteria 706
27 Ga0070688_100502326 3300005365 Bacteria 915
28 Ga0070659_101635505 3300005366 Unclassified 575
29 Ga0070667_100043869 3300005367 Bacteria 3754
30 Ga0070667_100520032 3300005367 Unclassified 1092
31 Ga0070667_100702328 3300005367 Bacteria 936
32 Ga0070701_10756689 3300005438 Bacteria 659
33 Ga0070700_100057271 3300005441 Bacteria 2445
34 Ga0070700_100324129 3300005441 Bacteria 1133
35 Ga0070700_100517639 3300005441 Bacteria 921
36 Ga0070663_100817002 3300005455 Bacteria 800
37 Ga0070663_101214180 3300005455 Unclassified 663
38 Ga0070678_100145799 3300005456 Bacteria 1900
39 Ga0070678_100147388 3300005456 Bacteria 1891
40 Ga0068867_100453108 3300005459 Bacteria 1094
41 Ga0068867_100594416 3300005459 Bacteria 964
42 Ga0068867_101738681 3300005459 Unclassified 585
43 Ga0070685_10145362 3300005466 Bacteria 1497
44 Ga0070685_10577747 3300005466 Unclassified 806
45 Ga0070685_10767947 3300005466 Unclassified 708
46 Ga0070699_100434585 3300005518 Bacteria 1189
47 Ga0068853_101522691 3300005539 Unclassified 648
48 Ga0070672_100001599 3300005543 Bacteria 14059
49 Ga0070672_100010623 3300005543 Bacteria 6392
50 Ga0070672_101291504 3300005543 Bacteria 651
51 Ga0070686_100259037 3300005544 Bacteria 1274
52 Ga0070686_100376304 3300005544 Unclassified 1074
53 Ga0070695_101548799 3300005545 Bacteria 552
54 Ga0070665_100012769 3300005548 Bacteria 8461
55 Ga0070665_102453668 3300005548 Unclassified 523
56 Ga0070664_101056529 3300005564 Unclassified 764
57 Ga0070664_101897196 3300005564 Bacteria 565
58 Ga0068857_100587445 3300005577 Bacteria 1052
59 Ga0068854_100417258 3300005578 Bacteria 1114
60 Ga0070702_100749364 3300005615 Bacteria 750
61 Ga0068852_100824260 3300005616 Bacteria 943
62 Ga0068859_100112985 3300005617 Bacteria 2780
63 Ga0068859_100909090 3300005617 Unclassified 965
64 Ga0068859_101043440 3300005617 Bacteria 898
65 Ga0068864_102039520 3300005618 Unclassified 580
66 Ga0068866_10231080 3300005718 Bacteria 1122
67 Ga0068861_100098505 3300005719 Bacteria 2321
68 Ga0068861_100345139 3300005719 Bacteria 1304
69 Ga0068861_101321933 3300005719 Bacteria 702
70 Ga0068851_10139831 3300005834 Bacteria 1316
71 Ga0068870_10454864 3300005840 Unclassified 845
72 Ga0068863_100639600 3300005841 Bacteria 1054
73 Ga0068863_101180955 3300005841 Bacteria 771
74 Ga0068863_101590884 3300005841 Unclassified 662
75 Ga0068860_101009933 3300005843 Bacteria 850
76 Ga0068862_100754574 3300005844 Bacteria 947
77 Ga0097621_100310211 3300006237 Bacteria 1395
78 Ga0097621_101007185 3300006237 Unclassified 779
79 Ga0097621_101505605 3300006237 Unclassified 638
80 Ga0068871_100311217 3300006358 Bacteria 1384
81 Ga0068871_100710144 3300006358 Bacteria 922
82 Ga0075430_100493636 3300006846 Bacteria 1010
83 Ga0075434_100267941 3300006871 Bacteria 1727
84 Ga0068865_100217996 3300006881 Bacteria 1490
85 Ga0068865_100410345 3300006881 Unclassified 1111
86 Ga0068865_100445704 3300006881 Bacteria 1069
87 Ga0068865_101711901 3300006881 Unclassified 567
88 Ga0097620_100112981 3300006931 Bacteria 2780
89 Ga0097620_100909008 3300006931 Unclassified 965
90 Ga0097620_101043433 3300006931 Bacteria 898
91 Ga0111539_10067860 3300009094 Bacteria 4211
92 Ga0105243_10905158 3300009148 Unclassified 878
93 Ga0105242_10100238 3300009176 Bacteria 2453
94 Ga0105248_10515151 3300009177 Bacteria 1349
95 Ga0099796_10502482 3300010159 Bacteria 543
96 Ga0157374_10377918 3300013296 Bacteria 1411
97 Ga0157374_10924502 3300013296 Bacteria 890
98 Ga0157378_10341789 3300013297 Bacteria 1460
99 Ga0163162_10107767 3300013306 Bacteria 2882
100 Ga0163162_10183046 3300013306 Bacteria 2221
101 Ga0157375_10022577 3300013308 Bacteria 5793
102 Ga0157375_10981767 3300013308 Bacteria 985
103 Ga0157375_12811065 3300013308 Unclassified 582
104 Ga0163163_10536151 3300014325 Bacteria 1233
105 Ga0163163_10579238 3300014325 Bacteria 1185
106 Ga0157380_10036708 3300014326 Bacteria 3793
107 Ga0157380_10050250 3300014326 Bacteria 3293
108 Ga0157380_10097683 3300014326 Bacteria 2438
109 Ga0157380_10157196 3300014326 Bacteria 1972
110 Ga0157380_10223422 3300014326 Bacteria 1686
111 Ga0157380_11046425 3300014326 Unclassified 852
112 Ga0157379_10430910 3300014968 Bacteria 1215
113 Ga0157376_10106575 3300014969 Bacteria 2459
114 Ga0157376_10457883 3300014969 Bacteria 1246
115 Ga0157376_10817156 3300014969 Bacteria 946
116 Ga0163161_10927045 3300017792 Bacteria 739
117 Ga0209564_1078539 3300025295 Bacteria 654
118 Ga0207682_10031355 3300025893 Bacteria 2133
119 Ga0207642_10343271 3300025899 Bacteria 879
120 Ga0207688_10150226 3300025901 Unclassified 1376
121 Ga0207688_10682147 3300025901 Bacteria 649
122 Ga0207680_10066880 3300025903 Bacteria 2212
123 Ga0207705_11326826 3300025909 Unclassified 549
124 Ga0207681_10374651 3300025923 Bacteria 1145
125 Ga0207681_10624330 3300025923 Bacteria 892
126 Ga0207650_10171478 3300025925 Bacteria 1725
127 Ga0207650_10290772 3300025925 Bacteria 1332
128 Ga0207650_10999981 3300025925 Bacteria 711
129 Ga0207659_10113999 3300025926 Bacteria 2060
130 Ga0207686_10480848 3300025934 Bacteria 960
131 Ga0207670_10194324 3300025936 Bacteria 1537
132 Ga0207669_10029255 3300025937 Bacteria 3044
133 Ga0207669_10275947 3300025937 Bacteria 1265
134 Ga0207704_10163727 3300025938 Bacteria 1586
135 Ga0207704_10265714 3300025938 Bacteria 1296
136 Ga0207691_10022017 3300025940 Bacteria 6015
137 Ga0207691_10038541 3300025940 Bacteria 4423
138 Ga0207691_10451929 3300025940 Bacteria 1093
139 Ga0207691_10469182 3300025940 Bacteria 1070
140 Ga0207691_10498056 3300025940 Bacteria 1035
141 Ga0207711_10372048 3300025941 Bacteria 1325
142 Ga0207689_10013302 3300025942 Bacteria 7020
143 Ga0207689_10769902 3300025942 Bacteria 812
144 Ga0207679_10496226 3300025945 Bacteria 1089
145 Ga0207679_10895587 3300025945 Bacteria 811
146 Ga0207651_10235134 3300025960 Bacteria 1490
147 Ga0207651_10291039 3300025960 Bacteria 1354
148 Ga0207668_10285814 3300025972 Bacteria 1355
149 Ga0207658_11222053 3300025986 Bacteria 687
150 Ga0207677_10262449 3300026023 Bacteria 1409
151 Ga0207703_12188888 3300026035 Unclassified 529
152 Ga0207678_10875339 3300026067 Bacteria 794
153 Ga0207678_10876328 3300026067 Unclassified 793
154 Ga0207678_11167984 3300026067 Unclassified 682
155 Ga0207708_10071896 3300026075 Bacteria 2650
156 Ga0207708_10172316 3300026075 Bacteria 1715
157 Ga0207648_10141833 3300026089 Bacteria 2118
158 Ga0207674_10619611 3300026116 Bacteria 1045
159 Ga0207675_100034927 3300026118 Bacteria 4688
160 Ga0207675_100093881 3300026118 Unclassified 2822
161 Ga0207675_100291595 3300026118 Bacteria 1587
162 Ga0207683_10098983 3300026121 Bacteria 2602
163 Ga0207683_10143569 3300026121 Bacteria 2152
164 Ga0207698_10360925 3300026142 Bacteria 1376
165 Ga0268266_10078285 3300028379 Bacteria 2876
166 Ga0268266_10116991 3300028379 Bacteria 2368
167 Ga0268266_10790103 3300028379 Unclassified 917
168 Ga0268266_12329854 3300028379 Unclassified 507
169 Ga0268265_10052567 3300028380 Bacteria 3082
170 Ga0268265_10194377 3300028380 Bacteria 1755
171 Ga0268265_10506312 3300028380 Bacteria 1139
172 Ga0268265_12192620 3300028380 Bacteria 559
173 Ga0265338_10003995 3300028800 Bacteria 20275
174 Ga0307511_10117930 3300030521 Bacteria 1655
175 Ga0265760_10104253 3300031090 Unclassified 899
176 Ga0307513_10013059 3300031456 Bacteria 10214
177 Ga0307513_10013933 3300031456 Bacteria 9853
178 Ga0307513_10015954 3300031456 Bacteria 9086
179 Ga0307513_10060194 3300031456 Bacteria 4026
180 Ga0307513_10211987 3300031456 Bacteria 1767
181 Ga0307513_10217420 3300031456 Bacteria 1736
182 Ga0307513_10388514 3300031456 Bacteria 1133
183 Ga0307509_10301846 3300031507 Bacteria 1349
184 Ga0307509_10599754 3300031507 Unclassified 774
185 Ga0307408_101507895 3300031548 Bacteria 636
186 Ga0307516_10582143 3300031730 Unclassified 773
187 Ga0307516_10751316 3300031730 Bacteria 635
188 Ga0307405_10017716 3300031731 Bacteria 3916
189 Ga0307413_11770210 3300031824 Bacteria 552
190 Ga0307410_10032394 3300031852 Bacteria 3363
191 Ga0307409_100015698 3300031995 Bacteria 4981
192 Ga0307409_100830589 3300031995 Bacteria 933
193 Ga0307416_100188003 3300032002 Unclassified 1944
194 Ga0307416_101291928 3300032002 Unclassified 835
195 Ga0307411_10045568 3300032005 Bacteria 2821
196 Ga0307411_10652855 3300032005 Unclassified 911
197 Ga0307415_100010719 3300032126 Bacteria 5206
198 Ga0307415_100048433 3300032126 Bacteria 2868
199 Ga0307415_100471728 3300032126 Bacteria 1090
200 Ga0307415_100815797 3300032126 Unclassified 853
201 Ga0451787_536712 3300041441 Bacteria 1325
202 Ga0451789_1268426 3300041443 Unclassified 952
203 Ga0451791_0765615 3300041451 Unclassified 1136
204 Ga0451791_1339925 3300041451 Unclassified 686
205 Ga0451797_0993769 3300041453 Bacteria 663
206 Ga0451798_1040272 3300041458 Unclassified 1062
207 Ga0451800_0365244 3300041459 Bacteria 1168
208 Ga0451802_0484604 3300041460 Bacteria 1733
209 Ga0451802_1382615 3300041460 Bacteria 1196
210 Ga0451802_1874478 3300041460 Unclassified 507
211 Ga0451804_0563871 3300041463 Bacteria 1637
212 Ga0451807_2200983 3300041486 Bacteria 2224
213 Ga0451807_2753688 3300041486 Bacteria 714
214 Ga0451837_1848715 3300041494 Bacteria 605
215 Ga0451849_0464688 3300041505 Bacteria 652
216 Ga0451853_1155565 3300041512 Unclassified 530
217 Ga0439441_153194 3300042001 Bacteria 544
218 Ga0450921_028174 3300042123 Bacteria 563
219 Ga0439444_0083377 3300042437 Unclassified 703
220 Ga0439460_0047962 3300042461 Unclassified 1273
221 Ga0466972_0272272 3300044658 Unclassified 791
222 Ga0495638_0003178 3300046460 Bacteria 12987
223 Ga0495638_0006875 3300046460 Bacteria 8212
224 Ga0495638_0542551 3300046460 Unclassified 579
225 Ga0495638_0661389 3300046460 Unclassified 507
226 Ga0495616_0009379 3300046513 Bacteria 5733
227 Ga0495616_0013196 3300046513 Bacteria 4668
228 Ga0495621_0113249 3300046539 Bacteria 1042
229 Ga0495625_0002827 3300046660 Bacteria 18279
230 Ga0495649_0005071 3300046694 Bacteria 8459
231 Ga0495649_0549201 3300046694 Unclassified 572
232 Ga0495686_0159770 3300047472 Bacteria 1317
233 Ga0495686_0177272 3300047472 Unclassified 1237
234 Ga0495686_0701303 3300047472 Unclassified 516
235 Ga0496108_0961961 3300048911 Bacteria 731
236 Ga0501067_0149609 3300049583 Bacteria 1301
237 Ga0501073_0617695 3300049589 Bacteria 748
238 Ga0501081_0941079 3300049743 Bacteria 652
239 nmdc:mga08y16_237596_c1 3300050511 Bacteria 1884
240 nmdc:mga0n895_1770027_c1 3300050512 Unclassified 579
241 Ga0500572_214546 3300053111 Unclassified 630
242 Ga0500637_0068362 3300053178 Bacteria 2041
243 Ga0500637_0395761 3300053178 Bacteria 719
244 Ga0501082_0003744 3300060353 Bacteria 13294
245 Ga0207662_10113461
246 SwRhRL3b_contig_1194850
247 rootL2_10001353
248 Ga0065707_10082306
249 Ga0070658_10231617
250 Ga0070677_10796765
251 Ga0068869_100208811
252 Ga0070682_100039194
253 Ga0068868_100372125
254 Ga0068868_100420770
255 Ga0070660_101193071
256 Ga0070687_100350900
257 Ga0070668_100281216
258 Ga0070668_100319929
259 Ga0070669_100082849
260 Ga0070669_100393192
261 Ga0070669_100867552
262 Ga0070675_100033922
263 Ga0070675_100178171
264 Ga0070671_100352624
265 Ga0070674_100058063
266 Ga0070674_100080964
267 Ga0070674_100118093
268 Ga0070673_100317448
269 Ga0070673_100626623
270 Ga0070673_101217030
271 Ga0070688_100502326
272 Ga0070659_101635505
273 Ga0070667_100043869
274 Ga0070667_100520032
275 Ga0070667_100702328
276 Ga0070701_10756689
277 Ga0070700_100057271
278 Ga0070700_100324129
279 Ga0070700_100517639
280 Ga0070663_100817002
281 Ga0070663_101214180
282 Ga0070678_100145799
283 Ga0070678_100147388
284 Ga0068867_100453108
285 Ga0068867_100594416
286 Ga0068867_101738681
287 Ga0070685_10145362
288 Ga0070685_10577747
289 Ga0070685_10767947
290 Ga0070699_100434585
291 Ga0068853_101522691
292 Ga0070672_100001599
293 Ga0070672_100010623
294 Ga0070672_101291504
295 Ga0070686_100259037
296 Ga0070686_100376304
297 Ga0070695_101548799
298 Ga0070665_100012769
299 Ga0070665_102453668
300 Ga0070664_101056529
301 Ga0070664_101897196
302 Ga0068857_100587445
303 Ga0068854_100417258
304 Ga0070702_100749364
305 Ga0068852_100824260
306 Ga0068859_100112985
307 Ga0068859_100909090
308 Ga0068859_101043440
309 Ga0068864_102039520
310 Ga0068866_10231080
311 Ga0068861_100098505
312 Ga0068861_100345139
313 Ga0068861_101321933
314 Ga0068851_10139831
315 Ga0068870_10454864
316 Ga0068863_100639600
317 Ga0068863_101180955
318 Ga0068863_101590884
319 Ga0068860_101009933
320 Ga0068862_100754574
321 Ga0097621_100310211
322 Ga0097621_101007185
323 Ga0097621_101505605
324 Ga0068871_100311217
325 Ga0068871_100710144
326 Ga0075430_100493636
327 Ga0075434_100267941
328 Ga0068865_100217996
329 Ga0068865_100410345
330 Ga0068865_100445704
331 Ga0068865_101711901
332 Ga0097620_100112981
333 Ga0097620_100909008
334 Ga0097620_101043433
335 Ga0111539_10067860
336 Ga0105243_10905158
337 Ga0105242_10100238
338 Ga0105248_10515151
339 Ga0099796_10502482
340 Ga0157374_10377918
341 Ga0157374_10924502
342 Ga0157378_10341789
343 Ga0163162_10107767
344 Ga0163162_10183046
345 Ga0157375_10022577
346 Ga0157375_10981767
347 Ga0157375_12811065
348 Ga0163163_10536151
349 Ga0163163_10579238
350 Ga0157380_10036708
351 Ga0157380_10050250
352 Ga0157380_10097683
353 Ga0157380_10157196
354 Ga0157380_10223422
355 Ga0157380_11046425
356 Ga0157379_10430910
357 Ga0157376_10106575
358 Ga0157376_10457883
359 Ga0157376_10817156
360 Ga0163161_10927045
361 Ga0209564_1078539
362 Ga0207682_10031355
363 Ga0207642_10343271
364 Ga0207688_10150226
365 Ga0207688_10682147
366 Ga0207680_10066880
367 Ga0207705_11326826
368 Ga0207681_10374651
369 Ga0207681_10624330
370 Ga0207650_10171478
371 Ga0207650_10290772
372 Ga0207650_10999981
373 Ga0207659_10113999
374 Ga0207686_10480848
375 Ga0207670_10194324
376 Ga0207669_10029255
377 Ga0207669_10275947
378 Ga0207704_10163727
379 Ga0207704_10265714
380 Ga0207691_10022017
381 Ga0207691_10038541
382 Ga0207691_10451929
383 Ga0207691_10469182
384 Ga0207691_10498056
385 Ga0207711_10372048
386 Ga0207689_10013302
387 Ga0207689_10769902
388 Ga0207679_10496226
389 Ga0207679_10895587
390 Ga0207651_10235134
391 Ga0207651_10291039
392 Ga0207668_10285814
393 Ga0207658_11222053
394 Ga0207677_10262449
395 Ga0207703_12188888
396 Ga0207678_10875339
397 Ga0207678_10876328
398 Ga0207678_11167984
399 Ga0207708_10071896
400 Ga0207708_10172316
401 Ga0207648_10141833
402 Ga0207674_10619611
403 Ga0207675_100034927
404 Ga0207675_100093881
405 Ga0207675_100291595
406 Ga0207683_10098983
407 Ga0207683_10143569
408 Ga0207698_10360925
409 Ga0268266_10078285
410 Ga0268266_10116991
411 Ga0268266_10790103
412 Ga0268266_12329854
413 Ga0268265_10052567
414 Ga0268265_10194377
415 Ga0268265_10506312
416 Ga0268265_12192620
417 Ga0265338_10003995
418 Ga0307511_10117930
419 Ga0265760_10104253
420 Ga0307513_10013059
421 Ga0307513_10013933
422 Ga0307513_10015954
423 Ga0307513_10060194
424 Ga0307513_10211987
425 Ga0307513_10217420
426 Ga0307513_10388514
427 Ga0307509_10301846
428 Ga0307509_10599754
429 Ga0307408_101507895
430 Ga0307516_10582143
431 Ga0307516_10751316
432 Ga0307405_10017716
433 Ga0307413_11770210
434 Ga0307410_10032394
435 Ga0307409_100015698
436 Ga0307409_100830589
437 Ga0307416_100188003
438 Ga0307416_101291928
439 Ga0307411_10045568
440 Ga0307411_10652855
441 Ga0307415_100010719
442 Ga0307415_100048433
443 Ga0307415_100471728
444 Ga0307415_100815797
445 Ga0451787_536712
446 Ga0451789_1268426
447 Ga0451791_0765615
448 Ga0451791_1339925
449 Ga0451797_0993769
450 Ga0451798_1040272
451 Ga0451800_0365244
452 Ga0451802_0484604
453 Ga0451802_1382615
454 Ga0451802_1874478
455 Ga0451804_0563871
456 Ga0451807_2200983
457 Ga0451807_2753688
458 Ga0451837_1848715
459 Ga0451849_0464688
460 Ga0451853_1155565
461 Ga0439441_153194
462 Ga0450921_028174
463 Ga0439444_0083377
464 Ga0439460_0047962
465 Ga0466972_0272272
466 Ga0495638_0003178
467 Ga0495638_0006875
468 Ga0495638_0542551
469 Ga0495638_0661389
470 Ga0495616_0009379
471 Ga0495616_0013196
472 Ga0495621_0113249
473 Ga0495625_0002827
474 Ga0495649_0005071
475 Ga0495649_0549201
476 Ga0495686_0159770
477 Ga0495686_0177272
478 Ga0495686_0701303
479 Ga0496108_0961961
480 Ga0501067_0149609
481 Ga0501073_0617695
482 Ga0501081_0941079
483 nmdc:mga08y16_237596_c1
484 nmdc:mga0n895_1770027_c1
485 Ga0500572_214546
486 Ga0500637_0068362
487 Ga0500637_0395761
488 Ga0501082_0003744

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12840

HTH_20

Helix-turn-helix domain

33

85

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6j05-assembly1.cif.gz_B structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9531 1 89
6j05-assembly1.cif.gz_B structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9328 1 89
8cll-assembly1.cif.gz_F structural insights into human tfiiic promoter recognition 0.9205 14 77
6j0e-assembly1.cif.gz_B structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9186 3 84
2dk5-assembly1.cif.gz_A solution structure of winged-helix domain in rna polymerase iii 39kda polypeptide 0.9045 14 75
ID Description Score Start End Superfamily
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9593 15 74 1.10.10.10
af_Q9VD25_77_142_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9574 15 75 1.10.10.10
af_P32910_88_152_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9525 17 75 1.10.10.10
af_Q69XJ1_51_114_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9494 15 74 1.10.10.10
af_O94553_84_149_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9492 15 75 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A496WWI5-F1-model_v4 Transcriptional regulator 0.9942 1 89 GO:0003700
AF-A0A1Q3KJB1-F1-model_v4 Transcriptional regulator 0.9934 1 89 GO:0003700
AF-Q3J2U9-F1-model_v4 Transcriptional regulator, ArsR family 0.9879 1 95 GO:0003700
AF-A0A4Q3AQJ9-F1-model_v4 ArsR family transcriptional regulator 0.9875 1 84 GO:0003700
AF-A0A529P702-F1-model_v4 Helix-turn-helix transcriptional regulator 0.987 1 91 GO:0003700

Map