F356312

General Info

Members Datasets Scaffolds Average Seq Length
244 77 488 133

Family's Representative Sequence

Representative Sequence 3300005543|Ga0070672_101419716|Ga0070672_1014197162
Length 153
Sequence MGFRRVASLAHAPRRMVRGDDHVHTLRIETESQMEMVDLTAGVRRIVKEAGVSRGMCHLYVPHTTAAITINENTDPNVRKDMINELLKTIPLHDDYLHAEGNAAAHILSSLLGSSESVFVENGKLVLGTWQAIYFCEFDGPRSRTVFLRVMAE

Samples

Sample ID Description Type Environment
1 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
2 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
12 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
13 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
14 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
15 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
16 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
17 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
18 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
19 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
20 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
21 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
22 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
23 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
24 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
25 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
26 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
27 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
42 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
43 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
44 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
45 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
46 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
47 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
48 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
49 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
50 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
51 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
52 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
53 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
54 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
55 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
56 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
57 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
58 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
59 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
60 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
61 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
62 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
63 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
64 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
65 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
66 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
67 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
68 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
69 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
70 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
71 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
72 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
73 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
74 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
75 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
76 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
77 2740891818 Desulfofaba hansenii DSM 12642 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.21
Metatranscriptomes 7.38
Isolates 0.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 79.92
Stem 0
Stem Tuber 0
Unclassified 18.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070672_101419716 3300005543 Bacteria 621
2 Ga0070666_10240200 3300005335 Unclassified 1281
3 Ga0070689_100736279 3300005340 Bacteria 863
4 Ga0070668_100285958 3300005347 Unclassified 1379
5 Ga0070673_102182606 3300005364 Unclassified 526
6 Ga0070667_100608838 3300005367 Bacteria 1007
7 Ga0070709_10784261 3300005434 Unclassified 747
8 Ga0070705_100190240 3300005440 Bacteria 1398
9 Ga0070705_100397285 3300005440 Bacteria 1020
10 Ga0070708_101120656 3300005445 Bacteria 737
11 Ga0070708_101350798 3300005445 Unclassified 665
12 Ga0070706_100868735 3300005467 Unclassified 834
13 Ga0070696_101745469 3300005546 Bacteria 537
14 Ga0068858_100524321 3300005842 Unclassified 1146
15 Ga0068860_100250951 3300005843 Unclassified 1723
16 Ga0068862_100944892 3300005844 Bacteria 850
17 Ga0070716_100002636 3300006173 Bacteria 8293
18 Ga0070716_100158805 3300006173 Unclassified 1463
19 Ga0070716_100298580 3300006173 Bacteria 1119
20 Ga0075428_101452869 3300006844 Bacteria 719
21 Ga0075436_100001415 3300006914 Bacteria 16307
22 Ga0075436_100012760 3300006914 Bacteria 5761
23 Ga0075436_100103741 3300006914 Bacteria 1982
24 Ga0099794_10015232 3300007265 Bacteria 3390
25 Ga0099794_10015451 3300007265 Bacteria 3371
26 Ga0099794_10041615 3300007265 Bacteria 2188
27 Ga0099794_10068052 3300007265 Archaea 1741
28 Ga0099795_10271426 3300007788 Unclassified 737
29 Ga0105241_10280227 3300009174 Unclassified 1423
30 Ga0105248_10941670 3300009177 Bacteria 975
31 Ga0157378_10572890 3300013297 Unclassified 1137
32 Ga0163162_10167563 3300013306 Unclassified 2321
33 Ga0157375_10595478 3300013308 Unclassified 1265
34 Ga0157380_10836086 3300014326 Unclassified 941
35 Ga0157379_10334698 3300014968 Unclassified 1384
36 Ga0207680_10258922 3300025903 Unclassified 1204
37 Ga0207699_10982286 3300025906 Unclassified 624
38 Ga0207699_11013024 3300025906 Unclassified 614
39 Ga0207654_10360015 3300025911 Bacteria 1003
40 Ga0207669_11664155 3300025937 Bacteria 545
41 Ga0207704_10664337 3300025938 Unclassified 859
42 Ga0207665_10000086 3300025939 Bacteria 60660
43 Ga0207665_10134356 3300025939 Unclassified 1759
44 Ga0207691_11140493 3300025940 Bacteria 648
45 Ga0207651_11167924 3300025960 Bacteria 691
46 Ga0207668_10105416 3300025972 Unclassified 2104
47 Ga0207658_10395066 3300025986 Bacteria 1214
48 Ga0207658_10831909 3300025986 Bacteria 839
49 Ga0207703_10478450 3300026035 Unclassified 1167
50 Ga0207648_11379308 3300026089 Unclassified 662
51 Ga0209588_1002837 3300027671 Bacteria 4746
52 Ga0209588_1002933 3300027671 Unclassified 4686
53 Ga0209588_1020022 3300027671 Bacteria 2093
54 Ga0268264_10334092 3300028381 Bacteria 1437
55 Ga0316575_10000943 3300031665 Bacteria 8946
56 Ga0316575_10001394 3300031665 Bacteria 7768
57 Ga0316575_10001486 3300031665 Bacteria 7568
58 Ga0316575_10048518 3300031665 Bacteria 1688
59 Ga0316575_10146957 3300031665 Bacteria 971
60 Ga0316575_10200140 3300031665 Bacteria 831
61 Ga0316579_10000282 3300031691 Bacteria 15573
62 Ga0316579_10036299 3300031691 Bacteria 2273
63 Ga0316579_10058876 3300031691 Bacteria 1805
64 Ga0316579_10169016 3300031691 Bacteria 1057
65 Ga0316579_10191183 3300031691 Bacteria 989
66 Ga0316576_10000114 3300031727 Bacteria 30289
67 Ga0316576_10005727 3300031727 Bacteria 7645
68 Ga0316576_10013852 3300031727 Bacteria 5374
69 Ga0316576_10090744 3300031727 Bacteria 2276
70 Ga0316576_10102151 3300031727 Bacteria 2144
71 Ga0316576_10157411 3300031727 Bacteria 1713
72 Ga0316576_10209195 3300031727 Bacteria 1468
73 Ga0316576_10268088 3300031727 Bacteria 1280
74 Ga0316576_10661008 3300031727 Bacteria 759
75 Ga0316576_10899302 3300031727 Bacteria 634
76 Ga0316576_11209191 3300031727 Bacteria 533
77 Ga0316576_11323741 3300031727 Unclassified 506
78 Ga0316578_10000215 3300031728 Bacteria 16628
79 Ga0316578_10000255 3300031728 Bacteria 15959
80 Ga0316578_10005942 3300031728 Bacteria 5976
81 Ga0316578_10006254 3300031728 Bacteria 5860
82 Ga0316578_10014688 3300031728 Bacteria 4190
83 Ga0316578_10031416 3300031728 Bacteria 3025
84 Ga0316578_10065241 3300031728 Bacteria 2150
85 Ga0316578_10070188 3300031728 Bacteria 2073
86 Ga0316578_10084733 3300031728 Bacteria 1889
87 Ga0316578_10105013 3300031728 Bacteria 1695
88 Ga0316578_10180545 3300031728 Bacteria 1272
89 Ga0316578_10286732 3300031728 Bacteria 985
90 Ga0316578_10307699 3300031728 Bacteria 947
91 Ga0316578_10455944 3300031728 Bacteria 755
92 Ga0316578_10499187 3300031728 Bacteria 717
93 Ga0316578_10688885 3300031728 Bacteria 596
94 Ga0316577_10000636 3300031733 Bacteria 14588
95 Ga0316577_10002218 3300031733 Bacteria 9552
96 Ga0316577_10005481 3300031733 Bacteria 6653
97 Ga0316577_10021404 3300031733 Bacteria 3588
98 Ga0316577_10027624 3300031733 Bacteria 3165
99 Ga0316577_10028622 3300031733 Bacteria 3109
100 Ga0316577_10121899 3300031733 Bacteria 1465
101 Ga0316577_10322115 3300031733 Bacteria 876
102 Ga0316577_10379704 3300031733 Unclassified 803
103 Ga0316577_10571029 3300031733 Bacteria 643
104 Ga0316583_10005861 3300032133 Bacteria 4419
105 Ga0316583_10009306 3300032133 Bacteria 3539
106 Ga0316583_10013771 3300032133 Bacteria 2918
107 Ga0316583_10014905 3300032133 Unclassified 2798
108 Ga0316583_10036825 3300032133 Bacteria 1735
109 Ga0316583_10049384 3300032133 Unclassified 1481
110 Ga0316583_10056592 3300032133 Bacteria 1377
111 Ga0316583_10188379 3300032133 Unclassified 717
112 Ga0316585_10002534 3300032137 Bacteria 4935
113 Ga0316585_10003189 3300032137 Bacteria 4480
114 Ga0316585_10010704 3300032137 Bacteria 2695
115 Ga0316585_10026294 3300032137 Bacteria 1809
116 Ga0316585_10046667 3300032137 Bacteria 1386
117 Ga0316585_10145206 3300032137 Bacteria 783
118 Ga0316585_10149258 3300032137 Unclassified 771
119 Ga0316585_10157007 3300032137 Bacteria 751
120 Ga0316585_10228869 3300032137 Bacteria 615
121 Ga0316580_10000102 3300032139 Bacteria 15459
122 Ga0316580_10001758 3300032139 Bacteria 5791
123 Ga0316580_10007131 3300032139 Bacteria 3320
124 Ga0316580_10016657 3300032139 Bacteria 2256
125 Ga0316580_10054106 3300032139 Bacteria 1235
126 Ga0316593_10110669 3300032168 Unclassified 980
127 Ga0316593_10415627 3300032168 Unclassified 521
128 Ga0316592_1001459 3300033524 Bacteria 3812
129 Ga0316592_1028211 3300033524 Bacteria 1215
130 Ga0316592_1034688 3300033524 Bacteria 1105
131 Ga0316592_1157662 3300033524 Bacteria 537
132 Ga0316586_1017533 3300033527 Bacteria 1156
133 Ga0316586_1075024 3300033527 Unclassified 626
134 Ga0316588_1019155 3300033528 Bacteria 1539
135 Ga0316588_1020684 3300033528 Bacteria 1492
136 Ga0316588_1032071 3300033528 Bacteria 1235
137 Ga0316588_1032840 3300033528 Bacteria 1222
138 Ga0316587_1108866 3300033529 Bacteria 537
139 Ga0316596_1010829 3300033541 Bacteria 2217
140 Ga0316596_1020432 3300033541 Bacteria 1683
141 Ga0316596_1033140 3300033541 Bacteria 1345
142 Ga0316596_1038275 3300033541 Bacteria 1257
143 Ga0316596_1087044 3300033541 Bacteria 841
144 Ga0316574_0003107 3300035398 Bacteria 8480
145 Ga0316574_0007758 3300035398 Bacteria 5906
146 Ga0316574_0007794 3300035398 Bacteria 5898
147 Ga0316574_0049529 3300035398 Bacteria 2612
148 Ga0316574_0122062 3300035398 Bacteria 1673
149 Ga0316574_0209014 3300035398 Bacteria 1252
150 Ga0316574_0229136 3300035398 Bacteria 1189
151 Ga0316574_0277235 3300035398 Bacteria 1068
152 Ga0316574_0502932 3300035398 Bacteria 755
153 Ga0373931_0009650 3300035691 Bacteria 4622
154 Ga0316582_0000794 3300036647 Bacteria 12796
155 Ga0316582_0001159 3300036647 Bacteria 11255
156 Ga0316582_0001338 3300036647 Bacteria 10702
157 Ga0316582_0001634 3300036647 Bacteria 10011
158 Ga0316582_0004783 3300036647 Bacteria 6898
159 Ga0316582_0030518 3300036647 Bacteria 3285
160 Ga0316582_0033719 3300036647 Bacteria 3147
161 Ga0316582_0094671 3300036647 Bacteria 1970
162 Ga0316582_0164621 3300036647 Bacteria 1503
163 Ga0316582_0218725 3300036647 Bacteria 1302
164 Ga0316582_0286859 3300036647 Bacteria 1130
165 Ga0316582_0314330 3300036647 Bacteria 1077
166 Ga0316582_0317161 3300036647 Bacteria 1071
167 Ga0316582_0512460 3300036647 Bacteria 826
168 Ga0316584_0003215 3300036712 Bacteria 10578
169 Ga0316584_0017161 3300036712 Bacteria 5199
170 Ga0316584_0020684 3300036712 Bacteria 4774
171 Ga0316584_0033633 3300036712 Bacteria 3798
172 Ga0316584_0066770 3300036712 Bacteria 2695
173 Ga0316584_0098850 3300036712 Bacteria 2185
174 Ga0316584_0139553 3300036712 Bacteria 1808
175 Ga0316584_0164681 3300036712 Bacteria 1646
176 Ga0316584_0170027 3300036712 Bacteria 1617
177 Ga0316584_0236957 3300036712 Bacteria 1336
178 Ga0316584_0241985 3300036712 Unclassified 1320
179 Ga0316584_0304052 3300036712 Bacteria 1154
180 Ga0316584_0325005 3300036712 Bacteria 1109
181 Ga0316584_0352088 3300036712 Bacteria 1057
182 Ga0316584_0375620 3300036712 Bacteria 1017
183 Ga0316584_0375679 3300036712 Bacteria 1016
184 Ga0316581_0057336 3300037588 Bacteria 1194
185 Ga0316581_0107003 3300037588 Bacteria 861
186 Ga0316581_0251200 3300037588 Unclassified 543
187 Ga0400484_09853 3300038725 Unclassified 1640
188 Ga0400484_15176 3300038725 Bacteria 3513
189 Ga0400484_17088 3300038725 Bacteria 7313
190 Ga0400484_43617 3300038725 Bacteria 8749
191 Ga0400490_24199 3300038726 Bacteria 46426
192 Ga0400490_33024 3300038726 Unclassified 1398
193 Ga0400490_36649 3300038726 Bacteria 2005
194 Ga0400490_37816 3300038726 Bacteria 1289
195 Ga0400490_43156 3300038726 Bacteria 2421
196 Ga0400490_44359 3300038726 Bacteria 2332
197 Ga0400490_57291 3300038726 Bacteria 1512
198 Ga0400491_02594 3300038727 Bacteria 2531
199 Ga0400491_18371 3300038727 Bacteria 8285
200 Ga0400491_22669 3300038727 Bacteria 1021
201 Ga0400485_02583 3300038735 Bacteria 28656
202 Ga0400485_05115 3300038735 Bacteria 28593
203 Ga0400485_19623 3300038735 Bacteria 5563
204 Ga0400485_22024 3300038735 Bacteria 3051
205 Ga0400488_06480 3300038741 Bacteria 1153
206 Ga0400488_12633 3300038741 Bacteria 2249
207 Ga0400488_20831 3300038741 Unclassified 1386
208 Ga0400488_26954 3300038741 Bacteria 1064
209 Ga0400488_47274 3300038741 Bacteria 9577
210 Ga0400488_60675 3300038741 Bacteria 6037
211 Ga0400486_04029 3300038742 Bacteria 63930
212 Ga0400486_05035 3300038742 Bacteria 38593
213 Ga0400486_09392 3300038742 Bacteria 9336
214 Ga0400486_14505 3300038742 Bacteria 66302
215 Ga0400486_23241 3300038742 Bacteria 32107
216 Ga0400483_003410 3300039062 Bacteria 1441
217 Ga0400483_095319 3300039062 Bacteria 29855
218 Ga0400483_112477 3300039062 Unclassified 2246
219 Ga0400483_114684 3300039062 Bacteria 2283
220 Ga0400483_146252 3300039062 Bacteria 10988
221 Ga0400483_187254 3300039062 Bacteria 4789
222 Ga0400483_273721 3300039062 Bacteria 14123
223 Ga0400483_274958 3300039062 Unclassified 1202
224 Ga0400483_276281 3300039062 Bacteria 2390
225 Ga0400489_01551 3300039093 Bacteria 26932
226 Ga0400489_26587 3300039093 Bacteria 16557
227 Ga0400489_61543 3300039093 Bacteria 71464
228 Ga0400489_64603 3300039093 Bacteria 19023
229 Ga0400489_72730 3300039093 Bacteria 6165
230 Ga0400487_06876 3300039110 Bacteria 1946
231 Ga0400487_16459 3300039110 Unclassified 4862
232 Ga0400487_17217 3300039110 Bacteria 4715
233 Ga0400487_25326 3300039110 Bacteria 41174
234 Ga0400487_58257 3300039110 Bacteria 1517
235 Ga0451577_0000074 3300042876 Bacteria 232698
236 Ga0451577_1058679 3300042876 Bacteria 727
237 Ga0453684_0000482 3300044712 Bacteria 158296
238 Ga0495639_0305237 3300046475 Unclassified 794
239 Ga0495618_0850794 3300046514 Unclassified 529
240 Ga0495613_0593776 3300046689 Bacteria 737
241 Ga0495581_0212264 3300047315 Bacteria 1132
242 Ga0495674_0408250 3300047319 Bacteria 1096
243 nmdc:mga08x19_8779_c1 3300050514 Bacteria 6030
244 2740993049 2740891818 Bacteria 6711283
245 Ga0070672_101419716
246 Ga0070666_10240200
247 Ga0070689_100736279
248 Ga0070668_100285958
249 Ga0070673_102182606
250 Ga0070667_100608838
251 Ga0070709_10784261
252 Ga0070705_100190240
253 Ga0070705_100397285
254 Ga0070708_101120656
255 Ga0070708_101350798
256 Ga0070706_100868735
257 Ga0070696_101745469
258 Ga0068858_100524321
259 Ga0068860_100250951
260 Ga0068862_100944892
261 Ga0070716_100002636
262 Ga0070716_100158805
263 Ga0070716_100298580
264 Ga0075428_101452869
265 Ga0075436_100001415
266 Ga0075436_100012760
267 Ga0075436_100103741
268 Ga0099794_10015232
269 Ga0099794_10015451
270 Ga0099794_10041615
271 Ga0099794_10068052
272 Ga0099795_10271426
273 Ga0105241_10280227
274 Ga0105248_10941670
275 Ga0157378_10572890
276 Ga0163162_10167563
277 Ga0157375_10595478
278 Ga0157380_10836086
279 Ga0157379_10334698
280 Ga0207680_10258922
281 Ga0207699_10982286
282 Ga0207699_11013024
283 Ga0207654_10360015
284 Ga0207669_11664155
285 Ga0207704_10664337
286 Ga0207665_10000086
287 Ga0207665_10134356
288 Ga0207691_11140493
289 Ga0207651_11167924
290 Ga0207668_10105416
291 Ga0207658_10395066
292 Ga0207658_10831909
293 Ga0207703_10478450
294 Ga0207648_11379308
295 Ga0209588_1002837
296 Ga0209588_1002933
297 Ga0209588_1020022
298 Ga0268264_10334092
299 Ga0316575_10000943
300 Ga0316575_10001394
301 Ga0316575_10001486
302 Ga0316575_10048518
303 Ga0316575_10146957
304 Ga0316575_10200140
305 Ga0316579_10000282
306 Ga0316579_10036299
307 Ga0316579_10058876
308 Ga0316579_10169016
309 Ga0316579_10191183
310 Ga0316576_10000114
311 Ga0316576_10005727
312 Ga0316576_10013852
313 Ga0316576_10090744
314 Ga0316576_10102151
315 Ga0316576_10157411
316 Ga0316576_10209195
317 Ga0316576_10268088
318 Ga0316576_10661008
319 Ga0316576_10899302
320 Ga0316576_11209191
321 Ga0316576_11323741
322 Ga0316578_10000215
323 Ga0316578_10000255
324 Ga0316578_10005942
325 Ga0316578_10006254
326 Ga0316578_10014688
327 Ga0316578_10031416
328 Ga0316578_10065241
329 Ga0316578_10070188
330 Ga0316578_10084733
331 Ga0316578_10105013
332 Ga0316578_10180545
333 Ga0316578_10286732
334 Ga0316578_10307699
335 Ga0316578_10455944
336 Ga0316578_10499187
337 Ga0316578_10688885
338 Ga0316577_10000636
339 Ga0316577_10002218
340 Ga0316577_10005481
341 Ga0316577_10021404
342 Ga0316577_10027624
343 Ga0316577_10028622
344 Ga0316577_10121899
345 Ga0316577_10322115
346 Ga0316577_10379704
347 Ga0316577_10571029
348 Ga0316583_10005861
349 Ga0316583_10009306
350 Ga0316583_10013771
351 Ga0316583_10014905
352 Ga0316583_10036825
353 Ga0316583_10049384
354 Ga0316583_10056592
355 Ga0316583_10188379
356 Ga0316585_10002534
357 Ga0316585_10003189
358 Ga0316585_10010704
359 Ga0316585_10026294
360 Ga0316585_10046667
361 Ga0316585_10145206
362 Ga0316585_10149258
363 Ga0316585_10157007
364 Ga0316585_10228869
365 Ga0316580_10000102
366 Ga0316580_10001758
367 Ga0316580_10007131
368 Ga0316580_10016657
369 Ga0316580_10054106
370 Ga0316593_10110669
371 Ga0316593_10415627
372 Ga0316592_1001459
373 Ga0316592_1028211
374 Ga0316592_1034688
375 Ga0316592_1157662
376 Ga0316586_1017533
377 Ga0316586_1075024
378 Ga0316588_1019155
379 Ga0316588_1020684
380 Ga0316588_1032071
381 Ga0316588_1032840
382 Ga0316587_1108866
383 Ga0316596_1010829
384 Ga0316596_1020432
385 Ga0316596_1033140
386 Ga0316596_1038275
387 Ga0316596_1087044
388 Ga0316574_0003107
389 Ga0316574_0007758
390 Ga0316574_0007794
391 Ga0316574_0049529
392 Ga0316574_0122062
393 Ga0316574_0209014
394 Ga0316574_0229136
395 Ga0316574_0277235
396 Ga0316574_0502932
397 Ga0373931_0009650
398 Ga0316582_0000794
399 Ga0316582_0001159
400 Ga0316582_0001338
401 Ga0316582_0001634
402 Ga0316582_0004783
403 Ga0316582_0030518
404 Ga0316582_0033719
405 Ga0316582_0094671
406 Ga0316582_0164621
407 Ga0316582_0218725
408 Ga0316582_0286859
409 Ga0316582_0314330
410 Ga0316582_0317161
411 Ga0316582_0512460
412 Ga0316584_0003215
413 Ga0316584_0017161
414 Ga0316584_0020684
415 Ga0316584_0033633
416 Ga0316584_0066770
417 Ga0316584_0098850
418 Ga0316584_0139553
419 Ga0316584_0164681
420 Ga0316584_0170027
421 Ga0316584_0236957
422 Ga0316584_0241985
423 Ga0316584_0304052
424 Ga0316584_0325005
425 Ga0316584_0352088
426 Ga0316584_0375620
427 Ga0316584_0375679
428 Ga0316581_0057336
429 Ga0316581_0107003
430 Ga0316581_0251200
431 Ga0400484_09853
432 Ga0400484_15176
433 Ga0400484_17088
434 Ga0400484_43617
435 Ga0400490_24199
436 Ga0400490_33024
437 Ga0400490_36649
438 Ga0400490_37816
439 Ga0400490_43156
440 Ga0400490_44359
441 Ga0400490_57291
442 Ga0400491_02594
443 Ga0400491_18371
444 Ga0400491_22669
445 Ga0400485_02583
446 Ga0400485_05115
447 Ga0400485_19623
448 Ga0400485_22024
449 Ga0400488_06480
450 Ga0400488_12633
451 Ga0400488_20831
452 Ga0400488_26954
453 Ga0400488_47274
454 Ga0400488_60675
455 Ga0400486_04029
456 Ga0400486_05035
457 Ga0400486_09392
458 Ga0400486_14505
459 Ga0400486_23241
460 Ga0400483_003410
461 Ga0400483_095319
462 Ga0400483_112477
463 Ga0400483_114684
464 Ga0400483_146252
465 Ga0400483_187254
466 Ga0400483_273721
467 Ga0400483_274958
468 Ga0400483_276281
469 Ga0400489_01551
470 Ga0400489_26587
471 Ga0400489_61543
472 Ga0400489_64603
473 Ga0400489_72730
474 Ga0400487_06876
475 Ga0400487_16459
476 Ga0400487_17217
477 Ga0400487_25326
478 Ga0400487_58257
479 Ga0451577_0000074
480 Ga0451577_1058679
481 Ga0453684_0000482
482 Ga0495639_0305237
483 Ga0495618_0850794
484 Ga0495613_0593776
485 Ga0495581_0212264
486 Ga0495674_0408250
487 nmdc:mga08x19_8779_c1
488 2740993049

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01894

UPF0047

Uncharacterised protein family UPF0047

38

150

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xbf-assembly1.cif.gz_C x-ray structure northeast structural genomics consortium target car10 from c. acetobutylicum 0.991 7 136
1vmh-assembly1.cif.gz_A crystal structure of an uncharacterized conserved protein yjbq/upf0047 family, ortholog yugu b.subtilis (ca_c0907) from clostridium acetobutylicum at 1.31 a resolution 0.985 9 136
1vmf-assembly1.cif.gz_C crystal structure of a ybjq-like fold protein of unknown function (bh3498) from bacillus halodurans at 1.46 a resolution 0.9835 8 138
1xbf-assembly1.cif.gz_C x-ray structure northeast structural genomics consortium target car10 from c. acetobutylicum 0.9749 7 136
1vmh-assembly1.cif.gz_A crystal structure of an uncharacterized conserved protein yjbq/upf0047 family, ortholog yugu b.subtilis (ca_c0907) from clostridium acetobutylicum at 1.31 a resolution 0.9701 9 136
ID Description Score Start End Superfamily
1xbfB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.989 9 136 2.60.120.460
1xbfB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9662 9 136 2.60.120.460
1vphC00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9622 8 138 2.60.120.460
2p6hB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.956 7 138 2.60.120.460
2cu5A00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9494 8 136 2.60.120.460
ID Description Score Start End GO Terms
AF-A0A535WWF4-F1-model_v4 YjbQ family protein 0.9994 22 137
AF-A0A1M6L7W2-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.9987 7 138
AF-A0A6C1BSV3-F1-model_v4 YjbQ family protein 0.9983 9 138
AF-A0A1Y2JZV3-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.998 11 138
AF-A0A800DFE8-F1-model_v4 YjbQ family protein 0.9978 7 138

Map