F356010

General Info

Members Datasets Scaffolds Average Seq Length
243 165 486 253

Family's Representative Sequence

Representative Sequence 3300049742|Ga0501080_0030917|Ga0501080_0030917_3079_3909
Length 276
Sequence MVAPNLTTHQKVGPVAISTSISDHVAQVVVDAPPVNALTVAGWFELAEAIXXXXQNADVGAVVLAAEGKGFNAGVDIKEMQTTEGFTALLGANAGCAAAFAAVYDCEVPVVAAVNGFCLGGGIGLVGNADVIVASEDATFGLPEVKQGALGAATHLARLVPQHRMRQMVYTTERATAQELAAYGSVLKVVPRAELRATALEVAAQIATIDPTVIRAAKASLNGIDPVDVKRSYRFEQGFTFELNLSGVADKSRDSFVEKRDAWAKPSTAEPKDETN

Samples

Sample ID Description Type Environment
1 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
12 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
13 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
14 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
15 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
16 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
17 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
18 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
19 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
20 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
21 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
23 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
24 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
25 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
26 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
27 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
28 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
29 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
30 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
31 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
32 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
34 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
56 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
58 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
59 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
60 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
61 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
62 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
63 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
64 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
65 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
66 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
67 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
68 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
69 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
70 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
71 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
72 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
73 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
74 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
75 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
76 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
77 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
78 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
79 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
80 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
81 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
82 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
83 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
84 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
85 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
86 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
87 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
88 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
89 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
90 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
91 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
92 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
93 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
94 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
95 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
96 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
97 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
98 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
99 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
100 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
101 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
102 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
103 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
104 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
105 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
106 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
107 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
108 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
109 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
110 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
111 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
112 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
113 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
114 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
115 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
116 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
117 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
118 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
119 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
131 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
132 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
133 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
134 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
135 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
136 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
137 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
138 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
139 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
140 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
141 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
142 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
143 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
145 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
146 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
147 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
148 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
149 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
150 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
151 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
152 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
153 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
154 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
155 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
156 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
157 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
158 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
159 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
160 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
161 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
162 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
163 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
164 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
165 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.71
Metatranscriptomes 1.23
Isolates 2.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.53
Nodule 0
Rhizoplane 2.88
Rhizosphere 87.65
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501080_0030917 3300049742 Bacteria 4990
2 JGI25407J50210_10000081 3300003373 Bacteria 12363
3 Ga0070658_10080157 3300005327 Bacteria 2681
4 Ga0068868_100325583 3300005338 Bacteria 1310
5 Ga0070668_100556573 3300005347 Bacteria 999
6 Ga0070675_100273429 3300005354 Bacteria 1483
7 Ga0070671_100018659 3300005355 Bacteria 5636
8 Ga0070706_100156300 3300005467 Bacteria 2129
9 Ga0068853_100182006 3300005539 Bacteria 1906
10 Ga0068855_100055368 3300005563 Bacteria 4659
11 Ga0068854_100001357 3300005578 Bacteria 14768
12 Ga0068852_100043663 3300005616 Bacteria 3803
13 Ga0068858_100017337 3300005842 Bacteria 6755
14 Ga0068858_100380208 3300005842 Bacteria 1355
15 Ga0081455_10246414 3300005937 Bacteria 1310
16 Ga0081538_10000315 3300005981 Bacteria 55243
17 Ga0081538_10000932 3300005981 Bacteria 31558
18 Ga0075365_10053763 3300006038 Bacteria 2668
19 Ga0075363_100013145 3300006048 Bacteria 4003
20 Ga0075431_100037157 3300006847 Bacteria 5019
21 Ga0105240_10104444 3300009093 Bacteria 3441
22 Ga0111539_10023318 3300009094 Bacteria 7603
23 Ga0111539_10036801 3300009094 Bacteria 5914
24 Ga0114129_10099336 3300009147 Bacteria 4028
25 Ga0114129_10315297 3300009147 Bacteria 2080
26 Ga0105241_10010060 3300009174 Bacteria 6943
27 Ga0105248_10843186 3300009177 Bacteria 1034
28 Ga0105237_10016632 3300009545 Bacteria 7639
29 Ga0105237_10416827 3300009545 Bacteria 1348
30 Ga0105237_10588340 3300009545 Bacteria 1120
31 Ga0105237_10743726 3300009545 Bacteria 987
32 Ga0105238_10055261 3300009551 Bacteria 3986
33 Ga0105239_10171809 3300010375 Bacteria 2424
34 Ga0157374_10061903 3300013296 Bacteria 3506
35 Ga0157374_10255244 3300013296 Bacteria 1726
36 Ga0157378_10035689 3300013297 Bacteria 4399
37 Ga0157375_10438986 3300013308 Bacteria 1471
38 Ga0157380_10984078 3300014326 Bacteria 876
39 Ga0206354_11188559 3300020081 Bacteria 2073
40 Ga0206353_10704812 3300020082 Bacteria 4350
41 Ga0213876_10002138 3300021384 Bacteria 11683
42 Ga0224712_10023458 3300022467 Bacteria 2142
43 Ga0207647_10017730 3300025904 Bacteria 4835
44 Ga0207705_10121432 3300025909 Bacteria 1939
45 Ga0207684_10135830 3300025910 Bacteria 2112
46 Ga0207654_10006431 3300025911 Bacteria 5914
47 Ga0207695_10004226 3300025913 Bacteria 19740
48 Ga0207671_10000058 3300025914 Bacteria 180670
49 Ga0207694_10000381 3300025924 Bacteria 41347
50 Ga0207659_10213006 3300025926 Bacteria 1549
51 Ga0207687_10102270 3300025927 Bacteria 2111
52 Ga0207687_10169112 3300025927 Bacteria 1684
53 Ga0207644_10004945 3300025931 Bacteria 8696
54 Ga0207686_10282024 3300025934 Bacteria 1227
55 Ga0207709_10198547 3300025935 Bacteria 1431
56 Ga0207667_10177274 3300025949 Bacteria 2189
57 Ga0207668_10344635 3300025972 Bacteria 1244
58 Ga0207658_10322002 3300025986 Bacteria 1339
59 Ga0207703_10011685 3300026035 Bacteria 6829
60 Ga0207702_10029266 3300026078 Bacteria 4583
61 Ga0207648_10656868 3300026089 Bacteria 969
62 Ga0207683_10568993 3300026121 Bacteria 1048
63 Ga0207698_10027635 3300026142 Bacteria 4031
64 Ga0207428_10018841 3300027907 Bacteria 5888
65 Ga0207428_10052335 3300027907 Bacteria 3261
66 Ga0268266_10786583 3300028379 Bacteria 919
67 Ga0265334_10095964 3300028573 Bacteria 1078
68 Ga0265338_10068788 3300028800 Bacteria 3048
69 Ga0265327_10003572 3300031251 Bacteria 14713
70 Ga0316576_10092795 3300031727 Bacteria 2250
71 Ga0307413_10052415 3300031824 Bacteria 2464
72 Ga0307410_10044452 3300031852 Bacteria 2951
73 Ga0307407_10079369 3300031903 Bacteria 1980
74 Ga0307409_100002630 3300031995 Bacteria 9448
75 Ga0307409_100044637 3300031995 Bacteria 3340
76 Ga0307416_100139696 3300032002 Bacteria 2199
77 Ga0307414_10286335 3300032004 Bacteria 1387
78 Ga0307411_10045404 3300032005 Bacteria 2826
79 Ga0307411_10427079 3300032005 Bacteria 1102
80 Ga0307415_100008630 3300032126 Bacteria 5661
81 Ga0307415_100268736 3300032126 Bacteria 1396
82 Ga0373961_0130206 3300035241 Bacteria 842
83 Ga0316574_0198636 3300035398 Bacteria 1289
84 Ga0395900_0311265 3300037418 Bacteria 1558
85 Ga0436365_0229625 3300039437 Bacteria 76076
86 Ga0436365_0293167 3300039437 Bacteria 1870
87 Ga0436365_0558344 3300039437 Bacteria 2531
88 Ga0436365_1785122 3300039437 Bacteria 5371
89 Ga0451837_1185061 3300041494 Bacteria 1283
90 Ga0451843_0351736 3300041509 Bacteria 2896
91 Ga0439448_0017226 3300042005 Bacteria 2205
92 Ga0439450_000437 3300042008 Bacteria 5402
93 Ga0439455_0011767 3300042012 Bacteria 1952
94 Ga0439463_010119 3300042016 Bacteria 2317
95 Ga0439446_0048164 3300042156 Bacteria 1269
96 Ga0439434_0014726 3300042435 Bacteria 2328
97 Ga0439464_0016281 3300042439 Bacteria 2009
98 Ga0439460_0002951 3300042461 Bacteria 4099
99 Ga0439440_0014066 3300042993 Bacteria 1723
100 Ga0466961_0062425 3300044693 Bacteria 2368
101 Ga0466963_0007783 3300044694 Bacteria 6406
102 Ga0466971_0005614 3300044719 Bacteria 5455
103 Ga0466957_0031340 3300044842 Bacteria 3177
104 Ga0466958_0007162 3300045836 Bacteria 6115
105 Ga0466958_0304720 3300045836 Bacteria 1023
106 Ga0466967_0026693 3300045976 Bacteria 4789
107 Ga0466967_0235666 3300045976 Bacteria 1744
108 Ga0495651_0009007 3300046462 Bacteria 7663
109 Ga0495651_0137755 3300046462 Bacteria 1774
110 Ga0495653_0342959 3300046463 Bacteria 962
111 Ga0495582_0075013 3300046473 Bacteria 1873
112 Ga0495662_0075587 3300046476 Bacteria 1635
113 Ga0495618_0014476 3300046514 Bacteria 4807
114 Ga0495628_0005893 3300046516 Bacteria 10725
115 Ga0495630_0217480 3300046517 Bacteria 1458
116 Ga0495630_0264082 3300046517 Bacteria 1315
117 Ga0495652_0001194 3300046529 Bacteria 29170
118 Ga0495652_0069267 3300046529 Bacteria 2954
119 Ga0495652_0148451 3300046529 Bacteria 1835
120 Ga0495652_0167588 3300046529 Bacteria 1698
121 Ga0495640_0022993 3300046533 Bacteria 4551
122 Ga0495586_0015426 3300046535 Bacteria 4065
123 Ga0495587_0014610 3300046536 Bacteria 4919
124 Ga0495622_0030770 3300046557 Bacteria 2509
125 Ga0495667_0177295 3300046559 Bacteria 1368
126 Ga0495634_0001856 3300046642 Bacteria 18168
127 Ga0495657_0014628 3300046675 Bacteria 5759
128 Ga0495623_0010834 3300046679 Bacteria 5901
129 Ga0495613_0000275 3300046689 Bacteria 47915
130 Ga0495600_0072559 3300046809 Bacteria 2248
131 Ga0495581_0071790 3300047315 Bacteria 2003
132 Ga0495604_0036532 3300047317 Bacteria 3873
133 Ga0495604_0061363 3300047317 Bacteria 2876
134 Ga0495604_0105630 3300047317 Bacteria 2061
135 Ga0495604_0204011 3300047317 Bacteria 1370
136 Ga0495604_0262811 3300047317 Bacteria 1172
137 Ga0495680_0083151 3300047322 Bacteria 2414
138 Ga0495680_0097527 3300047322 Bacteria 2194
139 Ga0495680_0228344 3300047322 Bacteria 1326
140 Ga0495593_0088041 3300047673 Bacteria 1601
141 Ga0495602_0186715 3300048088 Bacteria 1593
142 Ga0496102_0492091 3300048905 Bacteria 1148
143 Ga0496106_0460450 3300048909 Bacteria 1022
144 Ga0496108_0284749 3300048911 Bacteria 1439
145 Ga0496109_0032053 3300048912 Bacteria 4721
146 Ga0496109_0261438 3300048912 Bacteria 1630
147 Ga0496114_0573031 3300048917 Bacteria 996
148 Ga0496115_0064740 3300048918 Bacteria 2952
149 Ga0501032_0029153 3300049569 Bacteria 3790
150 Ga0501034_0001930 3300049571 Bacteria 26274
151 Ga0501034_0508952 3300049571 Bacteria 1117
152 Ga0501036_0008278 3300049572 Bacteria 8524
153 Ga0501036_0187510 3300049572 Bacteria 1741
154 Ga0501036_0412635 3300049572 Bacteria 1126
155 Ga0501037_0034943 3300049573 Bacteria 3708
156 Ga0501037_0070119 3300049573 Bacteria 2551
157 Ga0501038_0264295 3300049574 Bacteria 1359
158 Ga0501039_0015315 3300049575 Bacteria 5869
159 Ga0501040_0002808 3300049576 Bacteria 11233
160 Ga0501040_0125747 3300049576 Bacteria 1801
161 Ga0501041_0025243 3300049577 Bacteria 3572
162 Ga0501043_0042660 3300049579 Bacteria 3565
163 Ga0501046_0143073 3300049580 Bacteria 1808
164 Ga0501048_0052353 3300049582 Bacteria 2905
165 Ga0501048_0459259 3300049582 Bacteria 912
166 Ga0501068_0003015 3300049584 Bacteria 8984
167 Ga0501068_0007232 3300049584 Bacteria 6145
168 Ga0501069_0011872 3300049585 Bacteria 4619
169 Ga0501069_0229736 3300049585 Bacteria 1080
170 Ga0501070_0001268 3300049586 Bacteria 22674
171 Ga0501070_0001734 3300049586 Bacteria 19273
172 Ga0501070_0004650 3300049586 Bacteria 11756
173 Ga0501070_0010529 3300049586 Bacteria 7819
174 Ga0501070_0022380 3300049586 Bacteria 5294
175 Ga0501070_0054853 3300049586 Bacteria 3305
176 Ga0501070_0271040 3300049586 Bacteria 1386
177 Ga0501070_0496211 3300049586 Bacteria 981
178 Ga0501071_0034309 3300049587 Bacteria 3610
179 Ga0501071_0045794 3300049587 Bacteria 3140
180 Ga0501071_0049617 3300049587 Bacteria 3022
181 Ga0501071_0329342 3300049587 Bacteria 1161
182 Ga0501072_0002546 3300049588 Bacteria 13662
183 Ga0501072_0005083 3300049588 Bacteria 10015
184 Ga0501072_0141823 3300049588 Bacteria 1916
185 Ga0501072_0304490 3300049588 Bacteria 1267
186 Ga0501073_0002927 3300049589 Bacteria 12809
187 Ga0501073_0163918 3300049589 Bacteria 1539
188 Ga0501073_0181426 3300049589 Bacteria 1457
189 Ga0501073_0245588 3300049589 Bacteria 1236
190 Ga0501074_0012362 3300049590 Bacteria 6205
191 Ga0501074_0107983 3300049590 Bacteria 1992
192 Ga0501075_0004986 3300049591 Bacteria 9056
193 Ga0501075_0242229 3300049591 Bacteria 1375
194 Ga0501076_0013218 3300049592 Bacteria 6187
195 Ga0501076_0019002 3300049592 Bacteria 5243
196 Ga0501077_0004059 3300049593 Bacteria 8837
197 Ga0501079_0010206 3300049741 Bacteria 7131
198 Ga0501079_0051809 3300049741 Bacteria 3170
199 Ga0501079_0107629 3300049741 Bacteria 2164
200 Ga0501080_0001406 3300049742 Bacteria 20162
201 Ga0501080_0002610 3300049742 Bacteria 15781
202 Ga0501080_0004180 3300049742 Bacteria 12801
203 Ga0501080_0020653 3300049742 Bacteria 6100
204 Ga0501080_0043519 3300049742 Bacteria 4181
205 Ga0501080_0066130 3300049742 Bacteria 3362
206 Ga0501080_0237871 3300049742 Bacteria 1663
207 Ga0501081_0006128 3300049743 Bacteria 7795
208 Ga0501083_0003829 3300049744 Bacteria 10566
209 Ga0501083_0006046 3300049744 Bacteria 8573
210 Ga0501083_0539595 3300049744 Bacteria 759
211 Ga0501044_0016656 3300049823 Bacteria 7893
212 Ga0501044_0070762 3300049823 Bacteria 3548
213 Ga0501045_0017891 3300049824 Bacteria 5032
214 Ga0501045_0162276 3300049824 Bacteria 1664
215 nmdc:mga03n38_21185_c1 3300050490 Bacteria 2612
216 nmdc:mga00v17_108047_c1 3300050491 Bacteria 1763
217 nmdc:mga00v17_404262_c1 3300050491 Bacteria 887
218 nmdc:mga00v17_5889_c1 3300050491 Bacteria 6475
219 nmdc:mga06z11_234479_c1 3300050494 Bacteria 1076
220 nmdc:mga05p37_644332_c1 3300050507 Bacteria 1188
221 nmdc:mga09592_285827_c1 3300050508 Bacteria 1430
222 nmdc:mga06r32_209785_c1 3300050510 Bacteria 1936
223 nmdc:mga08y16_12949_c1 3300050511 Bacteria 8775
224 nmdc:mga08y16_14400_c1 3300050511 Bacteria 8322
225 Ga0495601_0045024 3300053077 Bacteria 2774
226 Ga0495601_0399905 3300053077 Bacteria 891
227 Ga0495619_0127718 3300053085 Bacteria 1746
228 Ga0500646_0000947 3300053090 Bacteria 7973
229 Ga0500566_0010808 3300053094 Bacteria 5380
230 Ga0500604_0034227 3300053151 Bacteria 1506
231 Ga0500616_0003713 3300053153 Bacteria 11401
232 Ga0501084_0000010 3300054114 Bacteria 187712
233 Ga0501084_0005928 3300054114 Bacteria 10065
234 Ga0501084_0233497 3300054114 Bacteria 1552
235 Ga0466962_0006524 3300061719 Bacteria 5601
236 Ga0466962_0176292 3300061719 Bacteria 1042
237 Ga0530510_0015475 3300061734 Bacteria 5392
238 Ga0530510_0017793 3300061734 Bacteria 5038
239 2774395639 2773857762 Bacteria 5971770
240 2809198967 2808606439 Bacteria 5952208
241 2812348273 2811994878 Bacteria 5992952
242 2891974036 2891968417 Bacteria 5821697
243 3003008783 3002998708 Bacteria 11715108
244 Ga0501080_0030917
245 JGI25407J50210_10000081
246 Ga0070658_10080157
247 Ga0068868_100325583
248 Ga0070668_100556573
249 Ga0070675_100273429
250 Ga0070671_100018659
251 Ga0070706_100156300
252 Ga0068853_100182006
253 Ga0068855_100055368
254 Ga0068854_100001357
255 Ga0068852_100043663
256 Ga0068858_100017337
257 Ga0068858_100380208
258 Ga0081455_10246414
259 Ga0081538_10000315
260 Ga0081538_10000932
261 Ga0075365_10053763
262 Ga0075363_100013145
263 Ga0075431_100037157
264 Ga0105240_10104444
265 Ga0111539_10023318
266 Ga0111539_10036801
267 Ga0114129_10099336
268 Ga0114129_10315297
269 Ga0105241_10010060
270 Ga0105248_10843186
271 Ga0105237_10016632
272 Ga0105237_10416827
273 Ga0105237_10588340
274 Ga0105237_10743726
275 Ga0105238_10055261
276 Ga0105239_10171809
277 Ga0157374_10061903
278 Ga0157374_10255244
279 Ga0157378_10035689
280 Ga0157375_10438986
281 Ga0157380_10984078
282 Ga0206354_11188559
283 Ga0206353_10704812
284 Ga0213876_10002138
285 Ga0224712_10023458
286 Ga0207647_10017730
287 Ga0207705_10121432
288 Ga0207684_10135830
289 Ga0207654_10006431
290 Ga0207695_10004226
291 Ga0207671_10000058
292 Ga0207694_10000381
293 Ga0207659_10213006
294 Ga0207687_10102270
295 Ga0207687_10169112
296 Ga0207644_10004945
297 Ga0207686_10282024
298 Ga0207709_10198547
299 Ga0207667_10177274
300 Ga0207668_10344635
301 Ga0207658_10322002
302 Ga0207703_10011685
303 Ga0207702_10029266
304 Ga0207648_10656868
305 Ga0207683_10568993
306 Ga0207698_10027635
307 Ga0207428_10018841
308 Ga0207428_10052335
309 Ga0268266_10786583
310 Ga0265334_10095964
311 Ga0265338_10068788
312 Ga0265327_10003572
313 Ga0316576_10092795
314 Ga0307413_10052415
315 Ga0307410_10044452
316 Ga0307407_10079369
317 Ga0307409_100002630
318 Ga0307409_100044637
319 Ga0307416_100139696
320 Ga0307414_10286335
321 Ga0307411_10045404
322 Ga0307411_10427079
323 Ga0307415_100008630
324 Ga0307415_100268736
325 Ga0373961_0130206
326 Ga0316574_0198636
327 Ga0395900_0311265
328 Ga0436365_0229625
329 Ga0436365_0293167
330 Ga0436365_0558344
331 Ga0436365_1785122
332 Ga0451837_1185061
333 Ga0451843_0351736
334 Ga0439448_0017226
335 Ga0439450_000437
336 Ga0439455_0011767
337 Ga0439463_010119
338 Ga0439446_0048164
339 Ga0439434_0014726
340 Ga0439464_0016281
341 Ga0439460_0002951
342 Ga0439440_0014066
343 Ga0466961_0062425
344 Ga0466963_0007783
345 Ga0466971_0005614
346 Ga0466957_0031340
347 Ga0466958_0007162
348 Ga0466958_0304720
349 Ga0466967_0026693
350 Ga0466967_0235666
351 Ga0495651_0009007
352 Ga0495651_0137755
353 Ga0495653_0342959
354 Ga0495582_0075013
355 Ga0495662_0075587
356 Ga0495618_0014476
357 Ga0495628_0005893
358 Ga0495630_0217480
359 Ga0495630_0264082
360 Ga0495652_0001194
361 Ga0495652_0069267
362 Ga0495652_0148451
363 Ga0495652_0167588
364 Ga0495640_0022993
365 Ga0495586_0015426
366 Ga0495587_0014610
367 Ga0495622_0030770
368 Ga0495667_0177295
369 Ga0495634_0001856
370 Ga0495657_0014628
371 Ga0495623_0010834
372 Ga0495613_0000275
373 Ga0495600_0072559
374 Ga0495581_0071790
375 Ga0495604_0036532
376 Ga0495604_0061363
377 Ga0495604_0105630
378 Ga0495604_0204011
379 Ga0495604_0262811
380 Ga0495680_0083151
381 Ga0495680_0097527
382 Ga0495680_0228344
383 Ga0495593_0088041
384 Ga0495602_0186715
385 Ga0496102_0492091
386 Ga0496106_0460450
387 Ga0496108_0284749
388 Ga0496109_0032053
389 Ga0496109_0261438
390 Ga0496114_0573031
391 Ga0496115_0064740
392 Ga0501032_0029153
393 Ga0501034_0001930
394 Ga0501034_0508952
395 Ga0501036_0008278
396 Ga0501036_0187510
397 Ga0501036_0412635
398 Ga0501037_0034943
399 Ga0501037_0070119
400 Ga0501038_0264295
401 Ga0501039_0015315
402 Ga0501040_0002808
403 Ga0501040_0125747
404 Ga0501041_0025243
405 Ga0501043_0042660
406 Ga0501046_0143073
407 Ga0501048_0052353
408 Ga0501048_0459259
409 Ga0501068_0003015
410 Ga0501068_0007232
411 Ga0501069_0011872
412 Ga0501069_0229736
413 Ga0501070_0001268
414 Ga0501070_0001734
415 Ga0501070_0004650
416 Ga0501070_0010529
417 Ga0501070_0022380
418 Ga0501070_0054853
419 Ga0501070_0271040
420 Ga0501070_0496211
421 Ga0501071_0034309
422 Ga0501071_0045794
423 Ga0501071_0049617
424 Ga0501071_0329342
425 Ga0501072_0002546
426 Ga0501072_0005083
427 Ga0501072_0141823
428 Ga0501072_0304490
429 Ga0501073_0002927
430 Ga0501073_0163918
431 Ga0501073_0181426
432 Ga0501073_0245588
433 Ga0501074_0012362
434 Ga0501074_0107983
435 Ga0501075_0004986
436 Ga0501075_0242229
437 Ga0501076_0013218
438 Ga0501076_0019002
439 Ga0501077_0004059
440 Ga0501079_0010206
441 Ga0501079_0051809
442 Ga0501079_0107629
443 Ga0501080_0001406
444 Ga0501080_0002610
445 Ga0501080_0004180
446 Ga0501080_0020653
447 Ga0501080_0043519
448 Ga0501080_0066130
449 Ga0501080_0237871
450 Ga0501081_0006128
451 Ga0501083_0003829
452 Ga0501083_0006046
453 Ga0501083_0539595
454 Ga0501044_0016656
455 Ga0501044_0070762
456 Ga0501045_0017891
457 Ga0501045_0162276
458 nmdc:mga03n38_21185_c1
459 nmdc:mga00v17_108047_c1
460 nmdc:mga00v17_404262_c1
461 nmdc:mga00v17_5889_c1
462 nmdc:mga06z11_234479_c1
463 nmdc:mga05p37_644332_c1
464 nmdc:mga09592_285827_c1
465 nmdc:mga06r32_209785_c1
466 nmdc:mga08y16_12949_c1
467 nmdc:mga08y16_14400_c1
468 Ga0495601_0045024
469 Ga0495601_0399905
470 Ga0495619_0127718
471 Ga0500646_0000947
472 Ga0500566_0010808
473 Ga0500604_0034227
474 Ga0500616_0003713
475 Ga0501084_0000010
476 Ga0501084_0005928
477 Ga0501084_0233497
478 Ga0466962_0006524
479 Ga0466962_0176292
480 Ga0530510_0015475
481 Ga0530510_0017793
482 2774395639
483 2809198967
484 2812348273
485 2891974036
486 3003008783

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

20

266

0.91

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

29

242

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ysw-assembly2.cif.gz_A e. coli anaerobic trifunctional enzyme subunit-alpha in complex with coenzyme a 0.8409 4 173
3pea-assembly2.cif.gz_F crystal structure of enoyl-coa hydratase from bacillus anthracis str. 'ames ancestor' 0.8331 4 227
3p5m-assembly1.cif.gz_B crystal structure of an enoyl-coa hydratase/isomerase from mycobacterium avium 0.828 3 227
6iun-assembly2.cif.gz_A crystal structure of enoyl-coa hydratase (ech) from ralstonia eutropha h16 in complex with nad 0.8216 4 168
3p5m-assembly1.cif.gz_D crystal structure of an enoyl-coa hydratase/isomerase from mycobacterium avium 0.8166 3 227
ID Description Score Start End Superfamily
af_I6Y3U6_5_247_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8935 11 227 3.90.226.10
5jbwA01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8804 1 173 3.90.226.10
3p5mE01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8781 3 174 3.90.226.10
af_Q9VL67_22_219_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8746 4 173 3.90.226.10
af_Q3MIE0_45_243_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8736 2 173 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A7C7U5P0-F1-model_v4 Enoyl-CoA hydratase family protein 0.9517 1 173
AF-A0A382BUK3-F1-model_v4 Enoyl-CoA hydratase 0.9473 1 173
AF-A0A7C7U5P0-F1-model_v4 Enoyl-CoA hydratase family protein 0.9463 1 173
AF-A0A6N6T342-F1-model_v4 Enoyl-CoA hydratase 0.9009 1 164 GO:0006631
GO:0016836
AF-A0A355W6R5-F1-model_v4 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase 0.8955 3 129 GO:0016853

Map