F355938

General Info

Members Datasets Scaffolds Average Seq Length
243 183 223 346

Family's Representative Sequence

Representative Sequence 3300048911|Ga0496108_0163723|Ga0496108_0163723_776_1825
Length 339
Sequence MNAPVFRLTSLAHGGGCGCKLAPSVLQQLLAAEPAAQAYRQLLVGTETGDDAAVWQIDKNLCIVATTDFFMPVVDDPYDFGQIAATNAISDVYAMGAKPILALALLLVRAILKGGEAVCASAGIPVAGGHSIDSPEPIYGLAVIGTCRPEQIRRNAETRVGDAIILTKAIGVGVYSAALKKGELSGNAYGEMLQSTTLLNRIGAELADDQAVHAMTDVTGFGLLGHGLEMARGAALSLVIRMSDVPLLSEARRLASEGFVTGASKRNWASYGECVSLPDDLEEWQRHLLTDPQTSGGLLIACAPDRARAILARIIEAGYSSARIVGIAEQGEPRIQIIR

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
3 2643221618 Ensifer sp. Root231 Isolate Unclassified
4 2643221626 Ensifer sp. Root31 Isolate Unclassified
5 2643221655 Ensifer sp. Root1252 Isolate Unclassified
6 2643221659 Ensifer sp. Root127 Isolate Unclassified
7 2643221698 Ensifer sp. Root142 Isolate Unclassified
8 2643221712 Ensifer sp. Root258 Isolate Unclassified
9 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
10 2734482264 Dyella sp. AD052 Isolate Unclassified
11 2738543009 Luteibacter sp. OK325 Isolate Unclassified
12 2739367700 Dyella sp. YR388 Isolate Unclassified
13 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
14 2844163670 Ensifer sp. 1H6 Isolate Unclassified
15 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
16 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
17 2919404418 Luteibacter sp. 3190 Isolate Unclassified
18 2941471342 Luteibacter sp. 621 Isolate Unclassified
19 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
20 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
21 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
22 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
23 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
24 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
25 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
26 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
27 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
28 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
29 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
30 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
31 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
32 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
33 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
34 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
35 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
36 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
37 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
60 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
61 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
62 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
65 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
66 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
70 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
71 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
73 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
74 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
76 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
77 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
78 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
80 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
91 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
92 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
93 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
94 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
95 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
96 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
97 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
98 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
99 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
102 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
103 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
104 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
105 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
106 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
107 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
108 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
109 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
110 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
111 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
112 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
113 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
114 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
115 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
116 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
117 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
118 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
119 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
120 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
121 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
122 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
123 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
124 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
125 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
126 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
127 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
128 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
129 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
130 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
131 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
132 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
133 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
134 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
135 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
136 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
137 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
138 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
139 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
140 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
141 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
142 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
143 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
144 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
145 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
148 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
149 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
150 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
151 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
152 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
153 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
154 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
155 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
156 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
157 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
169 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
170 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
171 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
172 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
174 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
176 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
177 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
178 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
179 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
180 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
181 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
182 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
183 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.53
Metatranscriptomes 1.23
Isolates 8.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.99
Nodule 0
Rhizoplane 3.7
Rhizosphere 65.43
Stem 0
Stem Tuber 0
Unclassified 16.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001962 3300001979 Bacteria 9394
2 JGI24739J22299_10000009 3300001989 Bacteria 55784
3 JGI24737J22298_10029669 3300001990 Bacteria 1714
4 JGI24735J21928_10002206 3300002067 Bacteria 6838
5 JGI24735J21928_10025147 3300002067 Bacteria 1798
6 JGI25156J39149_1006288 3300002705 Bacteria 3266
7 JGI25162J39368_1000028 3300002737 Bacteria 221876
8 JGI25157J39369_1000042 3300002741 Bacteria 123300
9 JGI25163J39215_1000113 3300002771 Bacteria 33750
10 JGI25164J39214_1000012 3300002772 Bacteria 255140
11 JGI25165J46597_1000048 3300003214 Bacteria 254392
12 Ga0006562J51391_1112635 3300003578 Bacteria 5380
13 Ga0006562J51391_1112636 3300003578 Bacteria 3595
14 Ga0006562J51391_1194201 3300003578 Bacteria 3080
15 Ga0055538_1000649 3300003751 Bacteria 11044
16 Ga0055533_1000438 3300003756 Bacteria 15845
17 Ga0055535_1000027 3300003761 Bacteria 202056
18 Ga0055542_1000034 3300003762 Bacteria 231972
19 Ga0055529_1000056 3300003763 Bacteria 196316
20 Ga0070691_10004975 3300005341 Bacteria 6047
21 Ga0070700_100009214 3300005441 Bacteria 5411
22 Ga0070694_100019022 3300005444 Bacteria 4365
23 Ga0070663_100012164 3300005455 Bacteria 5432
24 Ga0070685_10004607 3300005466 Bacteria 6977
25 Ga0068855_100001529 3300005563 Bacteria 29012
26 Ga0068855_100001606 3300005563 Bacteria 28376
27 Ga0068857_100000492 3300005577 Bacteria 28313
28 Ga0068854_100000378 3300005578 Bacteria 28376
29 Ga0068854_100001729 3300005578 Bacteria 13316
30 Ga0068862_100081562 3300005844 Bacteria 2806
31 Ga0081455_10006851 3300005937 Bacteria 12142
32 Ga0081455_10009216 3300005937 Bacteria 10171
33 Ga0081540_1000080 3300005983 Bacteria 103320
34 Ga0075367_10157447 3300006178 Bacteria 1412
35 Ga0105240_10005430 3300009093 Bacteria 19001
36 Ga0105240_10241449 3300009093 Bacteria 2094
37 Ga0111539_10037407 3300009094 Bacteria 5861
38 Ga0111539_10037426 3300009094 Bacteria 5859
39 Ga0105237_10000016 3300009545 Bacteria 256506
40 Ga0105239_10675515 3300010375 Bacteria 1180
41 Ga0157314_1001186 3300012500 Bacteria 1924
42 Ga0157370_10007707 3300013104 Bacteria 11676
43 Ga0157369_10000801 3300013105 Bacteria 40212
44 Ga0163162_10324290 3300013306 Bacteria 1672
45 Ga0157375_10124711 3300013308 Bacteria 2689
46 Ga0157376_10119852 3300014969 Bacteria 2330
47 Ga0182006_1000049 3300015261 Bacteria 184514
48 Ga0182007_10009879 3300015262 Bacteria 3805
49 Ga0182005_1002990 3300015265 Bacteria 5850
50 Ga0182005_1005451 3300015265 Bacteria 3972
51 Ga0183368_1002 3300015687 Bacteria 1865598
52 Ga0163161_10035632 3300017792 Bacteria 3562
53 Ga0213872_10001881 3300021361 Bacteria 12962
54 Ga0213875_10029442 3300021388 Bacteria 2605
55 Ga0209784_100016 3300025224 Bacteria 481036
56 Ga0209674_100014 3300025226 Bacteria 704989
57 Ga0209672_101546 3300025228 Bacteria 7939
58 Ga0209672_109888 3300025228 Bacteria 1317
59 Ga0207427_100019 3300025231 Bacteria 513977
60 Ga0209437_100054 3300025233 Bacteria 366715
61 Ga0209258_100039 3300025242 Bacteria 386366
62 Ga0209258_101162 3300025242 Bacteria 10758
63 Ga0209646_1000217 3300025246 Bacteria 62494
64 Ga0209646_1012700 3300025246 Bacteria 1290
65 Ga0209026_1000012 3300025250 Bacteria 480426
66 Ga0209148_1000001 3300025254 Bacteria 2545271
67 Ga0209759_1000446 3300025256 Bacteria 47871
68 Ga0209129_1000699 3300025258 Bacteria 21991
69 Ga0209129_1002789 3300025258 Bacteria 8137
70 Ga0209233_1000002 3300025261 Bacteria 2501366
71 Ga0209455_1000039 3300025272 Bacteria 437734
72 Ga0209455_1010775 3300025272 Bacteria 2301
73 Ga0209758_1000290 3300025297 Bacteria 98878
74 Ga0209758_1018466 3300025297 Bacteria 3414
75 Ga0209758_1020032 3300025297 Bacteria 3189
76 Ga0209051_1016557 3300025303 Bacteria 3329
77 Ga0207647_10000085 3300025904 Bacteria 71205
78 Ga0207647_10000602 3300025904 Bacteria 28003
79 Ga0207647_10002813 3300025904 Bacteria 13123
80 Ga0207695_10000307 3300025913 Bacteria 118870
81 Ga0207695_10268903 3300025913 Bacteria 1601
82 Ga0207671_10000013 3300025914 Bacteria 478458
83 Ga0207700_10026019 3300025928 Bacteria 4074
84 Ga0207706_10161970 3300025933 Bacteria 1966
85 Ga0207667_10000040 3300025949 Bacteria 275827
86 Ga0207667_10000047 3300025949 Bacteria 240471
87 Ga0207640_10000009 3300025981 Bacteria 283101
88 Ga0207640_10001150 3300025981 Bacteria 14537
89 Ga0207708_10025601 3300026075 Bacteria 4466
90 Ga0207674_10000012 3300026116 Bacteria 193220
91 Ga0207428_10034241 3300027907 Bacteria 4164
92 Ga0265331_10111743 3300031250 Bacteria 1253
93 Ga0373952_0004726 3300035092 Bacteria 2476
94 Ga0373939_0000801 3300035114 Bacteria 7761
95 Ga0373961_0016042 3300035241 Bacteria 1925
96 Ga0373931_0001784 3300035691 Bacteria 9357
97 Ga0395899_0143116 3300037312 Bacteria 1700
98 Ga0395900_0091549 3300037418 Bacteria 3125
99 Ga0395898_0067599 3300037466 Bacteria 3459
100 Ga0436364_0995460 3300037853 Bacteria 9327
101 Ga0395901_0017328 3300038443 Bacteria 7353
102 Ga0395901_0056664 3300038443 Bacteria 4077
103 Ga0436365_0508693 3300039437 Bacteria 2237
104 Ga0436361_0471781 3300039447 Bacteria 5707
105 Ga0436361_0507032 3300039447 Bacteria 49226
106 Ga0439436_0000063 3300041404 Bacteria 29794
107 Ga0439465_0000670 3300041413 Bacteria 10457
108 Ga0451789_0015009 3300041443 Bacteria 1050
109 Ga0450908_000040 3300042184 Bacteria 25605
110 Ga0466969_0061545 3300044656 Bacteria 1823
111 Ga0466972_0059160 3300044658 Bacteria 1839
112 Ga0466982_0000002 3300044672 Bacteria 454900
113 Ga0466964_0035654 3300044706 Bacteria 1990
114 Ga0453684_0040623 3300044712 Bacteria 6312
115 Ga0466971_0005091 3300044719 Bacteria 5695
116 Ga0466970_0029164 3300044765 Bacteria 2903
117 Ga0466957_0179553 3300044842 Bacteria 1382
118 Ga0451576_0056406 3300045051 Bacteria 4108
119 Ga0495617_000019 3300046452 Bacteria 247938
120 Ga0495627_000161 3300046453 Bacteria 76511
121 Ga0495638_0000543 3300046460 Bacteria 43505
122 Ga0495584_0000515 3300046491 Bacteria 26425
123 Ga0495585_0000001 3300046492 Bacteria 609804
124 Ga0495585_0005555 3300046492 Bacteria 7927
125 Ga0495607_0000967 3300046501 Bacteria 26576
126 Ga0495583_0015650 3300046506 Bacteria 4112
127 Ga0495606_0000091 3300046507 Bacteria 153354
128 Ga0495606_0000333 3300046507 Bacteria 81527
129 Ga0495606_0025228 3300046507 Bacteria 4262
130 Ga0495610_0002128 3300046512 Bacteria 16842
131 Ga0495616_0000001 3300046513 Bacteria 780061
132 Ga0495616_0015741 3300046513 Bacteria 4197
133 Ga0495620_0000401 3300046515 Bacteria 28963
134 Ga0495620_0001430 3300046515 Bacteria 14306
135 Ga0495631_0000241 3300046518 Bacteria 37775
136 Ga0495631_0000410 3300046518 Bacteria 29585
137 Ga0495648_0003697 3300046524 Bacteria 13364
138 Ga0495668_0005180 3300046616 Bacteria 8953
139 Ga0495668_0151724 3300046616 Bacteria 1269
140 Ga0495611_0000001 3300046648 Bacteria 2628469
141 Ga0495611_0000008 3300046648 Bacteria 218134
142 Ga0495625_0000001 3300046660 Bacteria 1641829
143 Ga0495625_0070129 3300046660 Bacteria 2461
144 Ga0495661_0000104 3300046665 Bacteria 101211
145 Ga0495670_0004895 3300046691 Bacteria 6580
146 Ga0495670_0015222 3300046691 Bacteria 3782
147 Ga0495671_0000175 3300046692 Bacteria 57098
148 Ga0495649_0004875 3300046694 Bacteria 8667
149 Ga0495589_0000999 3300046794 Bacteria 17183
150 Ga0495660_0000008 3300046810 Bacteria 435769
151 Ga0495660_0000009 3300046810 Bacteria 427395
152 Ga0495683_0001923 3300047323 Bacteria 12961
153 Ga0495679_000001 3300047446 Bacteria 1607568
154 Ga0495673_0000001 3300047469 Bacteria 1630730
155 Ga0495673_0000030 3300047469 Bacteria 468915
156 Ga0495673_0000089 3300047469 Bacteria 188744
157 Ga0495673_0000091 3300047469 Bacteria 187985
158 Ga0495686_0000026 3300047472 Bacteria 383637
159 Ga0495686_0000077 3300047472 Bacteria 205924
160 Ga0495686_0005630 3300047472 Bacteria 9826
161 Ga0496101_0003328 3300048904 Bacteria 10002
162 Ga0496106_0010436 3300048909 Bacteria 6860
163 Ga0496107_0127583 3300048910 Bacteria 1877
164 Ga0496108_0163723 3300048911 Bacteria 1923
165 Ga0496112_0304919 3300048915 Bacteria 1538
166 Ga0496113_0032759 3300048916 Bacteria 3778
167 Ga0496115_0000379 3300048918 Bacteria 36717
168 Ga0496115_0006359 3300048918 Bacteria 8652
169 Ga0496117_0030788 3300048920 Bacteria 4109
170 Ga0496118_0001452 3300048921 Bacteria 35697
171 Ga0496121_0000044 3300048924 Bacteria 337672
172 Ga0496121_0000368 3300048924 Bacteria 92730
173 Ga0496121_0001280 3300048924 Bacteria 43316
174 Ga0496121_0071019 3300048924 Bacteria 2801
175 Ga0496121_0111039 3300048924 Bacteria 2091
176 Ga0496121_0165054 3300048924 Bacteria 1615
177 Ga0496122_0136318 3300048925 Bacteria 1546
178 Ga0496125_0000044 3300048928 Bacteria 296762
179 Ga0496126_0013810 3300048929 Bacteria 8189
180 Ga0496126_0075654 3300048929 Bacteria 2988
181 Ga0496126_0300670 3300048929 Bacteria 1324
182 Ga0495678_000023 3300049459 Bacteria 233463
183 Ga0495678_014803 3300049459 Bacteria 3614
184 Ga0495682_0001675 3300049460 Bacteria 11309
185 Ga0495682_0005967 3300049460 Bacteria 4986
186 Ga0501031_0009982 3300049568 Bacteria 6184
187 Ga0501031_0020967 3300049568 Bacteria 4261
188 Ga0501032_0009376 3300049569 Bacteria 7090
189 Ga0501033_0009371 3300049570 Bacteria 7537
190 Ga0501033_0028195 3300049570 Bacteria 4221
191 Ga0501034_0008571 3300049571 Bacteria 10790
192 Ga0501034_0180458 3300049571 Bacteria 2076
193 Ga0501036_0000511 3300049572 Bacteria 27869
194 Ga0501036_0008069 3300049572 Bacteria 8624
195 Ga0501037_0000741 3300049573 Bacteria 24756
196 Ga0501037_0023073 3300049573 Bacteria 4602
197 Ga0501038_0015652 3300049574 Bacteria 6894
198 Ga0501038_0034131 3300049574 Bacteria 4475
199 Ga0501043_0044061 3300049579 Bacteria 3507
200 Ga0501043_0123079 3300049579 Bacteria 2034
201 Ga0501046_0028650 3300049580 Bacteria 4534
202 Ga0501047_0015943 3300049581 Bacteria 7164
203 Ga0501047_0102987 3300049581 Bacteria 2734
204 Ga0501048_0198956 3300049582 Bacteria 1420
205 Ga0501070_0114413 3300049586 Bacteria 2229
206 Ga0501076_0067503 3300049592 Bacteria 2856
207 Ga0501077_0127822 3300049593 Bacteria 1611
208 Ga0501080_0139444 3300049742 Bacteria 2242
209 Ga0501035_0000512 3300049822 Bacteria 43540
210 Ga0501044_0059350 3300049823 Bacteria 3919
211 Ga0501044_0082251 3300049823 Bacteria 3258
212 nmdc:mga06z11_126002_c1 3300050494 Bacteria 1433
213 nmdc:mga08y16_263206_c1 3300050511 Bacteria 1781
214 nmdc:mga08y16_57659_c1 3300050511 Bacteria 4058
215 nmdc:mga08y16_67266_c1 3300050511 Bacteria 3737
216 Ga0500643_000002 3300053087 Bacteria 1277657
217 Ga0500555_000971 3300053103 Bacteria 9926
218 Ga0500577_0004503 3300053142 Bacteria 3688
219 Ga0500633_0007517 3300053160 Bacteria 2750
220 Ga0500645_001869 3300053730 Bacteria 10071
221 Ga0501084_0203054 3300054114 Bacteria 1673
222 Ga0501082_0184956 3300060353 Bacteria 1813
223 Ga0466962_0002037 3300061719 Bacteria 9551

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049593 Ga0501077_0127822 Ga0501077_0127822_667_1557 294
2 3300013105 Ga0157369_10000801 Ga0157369_1000080126 323
3 3300025904 Ga0207647_10000085 Ga0207647_1000008554 323
4 3300041443 Ga0451789_0015009 Ga0451789_0015009_52_1023 323
5 3300013306 Ga0163162_10324290 Ga0163162_103242901 324
6 3300039447 Ga0436361_0471781 Ga0436361_0471781_507_1481 324
7 3300046452 Ga0495617_000019 Ga0495617_000019_97865_98839 324
8 3300046506 Ga0495583_0015650 Ga0495583_0015650_2551_3525 324
9 3300046507 Ga0495606_0000091 Ga0495606_0000091_88392_89366 324
10 3300046515 Ga0495620_0001430 Ga0495620_0001430_6118_7092 324
11 3300046648 Ga0495611_0000001 Ga0495611_0000001_1030478_1031452 324
12 3300046660 Ga0495625_0000001 Ga0495625_0000001_884586_885560 324
13 3300046660 Ga0495625_0070129 Ga0495625_0070129_123_1097 324
14 3300046691 Ga0495670_0015222 Ga0495670_0015222_1900_2874 324
15 3300046692 Ga0495671_0000175 Ga0495671_0000175_13618_14592 324
16 3300048924 Ga0496121_0071019 Ga0496121_0071019_96_1070 324
17 3300048924 Ga0496121_0111039 Ga0496121_0111039_984_1958 324
18 3300048929 Ga0496126_0300670 Ga0496126_0300670_34_1008 324
19 3300049460 Ga0495682_0005967 Ga0495682_0005967_1784_2758 324
20 3300050511 nmdc:mga08y16_263206_c1 nmdc:mga08y16_263206_c1_487_1461 324
21 3300053087 Ga0500643_000002 Ga0500643_000002_764720_765694 324
22 3300013104 Ga0157370_10007707 Ga0157370_100077072 336
23 3300048911 Ga0496108_0163723 Ga0496108_0163723_776_1825 336
24 3300014969 Ga0157376_10119852 Ga0157376_101198522 341
25 iso_pu_bacteria 2593339239 2595452208 342
26 iso_pu_bacteria 2718218334 2721027549 342
27 iso_pu_bacteria 2734482264 2735836881 342
28 iso_pu_bacteria 2738543009 2739226295 342
29 iso_pu_bacteria 2739367700 2739731850 342
30 iso_pu_bacteria 2842918807 2842920567 342
31 iso_pu_bacteria 2884338543 2884340740 342
32 iso_pu_bacteria 2919404418 2919405647 342
33 iso_pu_bacteria 2941471342 2941471449 342
34 iso_pu_bacteria 2953994433 2953995855 342
35 3300046460 Ga0495638_0000543 Ga0495638_0000543_26534_27565 343
36 3300046501 Ga0495607_0000967 Ga0495607_0000967_23678_24709 343
37 3300046513 Ga0495616_0015741 Ga0495616_0015741_2828_3859 343
38 3300046616 Ga0495668_0151724 Ga0495668_0151724_129_1160 343
39 3300046794 Ga0495589_0000999 Ga0495589_0000999_13367_14398 343
40 3300046810 Ga0495660_0000008 Ga0495660_0000008_249778_250809 343
41 3300047446 Ga0495679_000001 Ga0495679_000001_555504_556535 343
42 3300047469 Ga0495673_0000089 Ga0495673_0000089_161155_162186 343
43 3300049459 Ga0495678_000023 Ga0495678_000023_197139_198170 343
44 3300049460 Ga0495682_0001675 Ga0495682_0001675_6797_7828 343
45 3300053103 Ga0500555_000971 Ga0500555_000971_5866_6897 343
46 iso_pu_bacteria 2510917020 2511123877 343
47 iso_pu_bacteria 2643221618 2644108180 344
48 iso_pu_bacteria 2643221626 2644145893 344
49 iso_pu_bacteria 2643221655 2644307372 344
50 iso_pu_bacteria 2643221659 2644331388 344
51 iso_pu_bacteria 2643221698 2644541404 344
52 iso_pu_bacteria 2643221712 2644613461 344
53 iso_pu_bacteria 2844163670 2844169554 344
54 iso_pu_bacteria 2885383462 2885384298 344
55 iso_pu_bacteria 2941499720 2941502878 344
56 3300031250 Ga0265331_10111743 Ga0265331_101117432 345
57 3300044712 Ga0453684_0040623 Ga0453684_0040623_461_1504 345
58 3300046453 Ga0495627_000161 Ga0495627_000161_6620_7672 345
59 3300047469 Ga0495673_0000091 Ga0495673_0000091_140537_141589 345
60 3300053142 Ga0500577_0004503 Ga0500577_0004503_1960_3012 345
61 3300001979 JGI24740J21852_10001962 JGI24740J21852_1000196211 346
62 3300001989 JGI24739J22299_10000009 JGI24739J22299_1000000935 346
63 3300001990 JGI24737J22298_10029669 JGI24737J22298_100296692 346
64 3300002067 JGI24735J21928_10002206 JGI24735J21928_100022062 346
65 3300002067 JGI24735J21928_10025147 JGI24735J21928_100251472 346
66 3300002705 JGI25156J39149_1006288 JGI25156J39149_10062884 346
67 3300002737 JGI25162J39368_1000028 JGI25162J39368_100002888 346
68 3300002741 JGI25157J39369_1000042 JGI25157J39369_100004291 346
69 3300002771 JGI25163J39215_1000113 JGI25163J39215_100011310 346
70 3300002772 JGI25164J39214_1000012 JGI25164J39214_1000012105 346
71 3300003214 JGI25165J46597_1000048 JGI25165J46597_1000048144 346
72 3300003578 Ga0006562J51391_1112635 Ga0006562J51391_11126352 346
73 3300003578 Ga0006562J51391_1112636 Ga0006562J51391_11126362 346
74 3300003578 Ga0006562J51391_1194201 Ga0006562J51391_11942013 346
75 3300003751 Ga0055538_1000649 Ga0055538_10006499 346
76 3300003756 Ga0055533_1000438 Ga0055533_10004382 346
77 3300003761 Ga0055535_1000027 Ga0055535_1000027132 346
78 3300003762 Ga0055542_1000034 Ga0055542_100003488 346
79 3300003763 Ga0055529_1000056 Ga0055529_100005653 346
80 3300005341 Ga0070691_10004975 Ga0070691_100049756 346
81 3300005441 Ga0070700_100009214 Ga0070700_1000092144 346
82 3300005444 Ga0070694_100019022 Ga0070694_1000190222 346
83 3300005455 Ga0070663_100012164 Ga0070663_1000121645 346
84 3300005466 Ga0070685_10004607 Ga0070685_100046072 346
85 3300005563 Ga0068855_100001529 Ga0068855_10000152919 346
86 3300005563 Ga0068855_100001606 Ga0068855_10000160619 346
87 3300005577 Ga0068857_100000492 Ga0068857_1000004929 346
88 3300005578 Ga0068854_100000378 Ga0068854_10000037819 346
89 3300005578 Ga0068854_100001729 Ga0068854_1000017297 346
90 3300005844 Ga0068862_100081562 Ga0068862_1000815621 346
91 3300005937 Ga0081455_10006851 Ga0081455_100068516 346
92 3300005937 Ga0081455_10009216 Ga0081455_1000921610 346
93 3300005983 Ga0081540_1000080 Ga0081540_100008027 346
94 3300006178 Ga0075367_10157447 Ga0075367_101574471 346
95 3300009093 Ga0105240_10005430 Ga0105240_1000543018 346
96 3300009093 Ga0105240_10241449 Ga0105240_102414492 346
97 3300009094 Ga0111539_10037407 Ga0111539_100374075 346
98 3300009094 Ga0111539_10037426 Ga0111539_100374261 346
99 3300009545 Ga0105237_10000016 Ga0105237_100000169 346
100 3300010375 Ga0105239_10675515 Ga0105239_106755151 346
101 3300012500 Ga0157314_1001186 Ga0157314_10011862 346
102 3300013308 Ga0157375_10124711 Ga0157375_101247113 346
103 3300015261 Ga0182006_1000049 Ga0182006_100004954 346
104 3300015262 Ga0182007_10009879 Ga0182007_100098793 346
105 3300015265 Ga0182005_1002990 Ga0182005_10029903 346
106 3300015265 Ga0182005_1005451 Ga0182005_10054513 346
107 3300015687 Ga0183368_1002 Ga0183368_10021207 346
108 3300017792 Ga0163161_10035632 Ga0163161_100356322 346
109 3300021361 Ga0213872_10001881 Ga0213872_100018819 346
110 3300021388 Ga0213875_10029442 Ga0213875_100294424 346
111 3300025224 Ga0209784_100016 Ga0209784_100016144 346
112 3300025226 Ga0209674_100014 Ga0209674_100014251 346
113 3300025228 Ga0209672_101546 Ga0209672_1015464 346
114 3300025228 Ga0209672_109888 Ga0209672_1098881 346
115 3300025231 Ga0207427_100019 Ga0207427_100019269 346
116 3300025233 Ga0209437_100054 Ga0209437_100054242 346
117 3300025242 Ga0209258_100039 Ga0209258_100039146 346
118 3300025242 Ga0209258_101162 Ga0209258_1011626 346
119 3300025246 Ga0209646_1000217 Ga0209646_10002175 346
120 3300025246 Ga0209646_1012700 Ga0209646_10127002 346
121 3300025250 Ga0209026_1000012 Ga0209026_1000012341 346
122 3300025254 Ga0209148_1000001 Ga0209148_10000011414 346
123 3300025256 Ga0209759_1000446 Ga0209759_10004464 346
124 3300025258 Ga0209129_1000699 Ga0209129_10006991 346
125 3300025258 Ga0209129_1002789 Ga0209129_10027893 346
126 3300025261 Ga0209233_1000002 Ga0209233_1000002816 346
127 3300025272 Ga0209455_1000039 Ga0209455_1000039146 346
128 3300025272 Ga0209455_1010775 Ga0209455_10107752 346
129 3300025297 Ga0209758_1000290 Ga0209758_100029010 346
130 3300025297 Ga0209758_1018466 Ga0209758_10184663 346
131 3300025297 Ga0209758_1020032 Ga0209758_10200323 346
132 3300025303 Ga0209051_1016557 Ga0209051_10165574 346
133 3300025904 Ga0207647_10000602 Ga0207647_1000060221 346
134 3300025904 Ga0207647_10002813 Ga0207647_100028138 346
135 3300025913 Ga0207695_10000307 Ga0207695_1000030792 346
136 3300025913 Ga0207695_10268903 Ga0207695_102689032 346
137 3300025914 Ga0207671_10000013 Ga0207671_10000013117 346
138 3300025928 Ga0207700_10026019 Ga0207700_100260195 346
139 3300025933 Ga0207706_10161970 Ga0207706_101619702 346
140 3300025949 Ga0207667_10000040 Ga0207667_1000004087 346
141 3300025949 Ga0207667_10000047 Ga0207667_1000004749 346
142 3300025981 Ga0207640_10000009 Ga0207640_1000000988 346
143 3300025981 Ga0207640_10001150 Ga0207640_100011508 346
144 3300026075 Ga0207708_10025601 Ga0207708_100256013 346
145 3300026116 Ga0207674_10000012 Ga0207674_1000001215 346
146 3300027907 Ga0207428_10034241 Ga0207428_100342412 346
147 3300035092 Ga0373952_0004726 Ga0373952_0004726_1253_2317 346
148 3300035114 Ga0373939_0000801 Ga0373939_0000801_5955_7019 346
149 3300035241 Ga0373961_0016042 Ga0373961_0016042_549_1613 346
150 3300035691 Ga0373931_0001784 Ga0373931_0001784_443_1507 346
151 3300037312 Ga0395899_0143116 Ga0395899_0143116_552_1598 346
152 3300037418 Ga0395900_0091549 Ga0395900_0091549_1225_2274 346
153 3300037466 Ga0395898_0067599 Ga0395898_0067599_1769_2815 346
154 3300037853 Ga0436364_0995460 Ga0436364_0995460_3892_4938 346
155 3300038443 Ga0395901_0017328 Ga0395901_0017328_3740_4789 346
156 3300038443 Ga0395901_0056664 Ga0395901_0056664_2402_3448 346
157 3300039437 Ga0436365_0508693 Ga0436365_0508693_392_1441 346
158 3300039447 Ga0436361_0507032 Ga0436361_0507032_27719_28765 346
159 3300041404 Ga0439436_0000063 Ga0439436_0000063_15010_16050 346
160 3300041413 Ga0439465_0000670 Ga0439465_0000670_9303_10343 346
161 3300042184 Ga0450908_000040 Ga0450908_000040_15101_16159 346
162 3300044656 Ga0466969_0061545 Ga0466969_0061545_732_1772 346
163 3300044658 Ga0466972_0059160 Ga0466972_0059160_467_1507 346
164 3300044672 Ga0466982_0000002 Ga0466982_0000002_243654_244694 346
165 3300044706 Ga0466964_0035654 Ga0466964_0035654_236_1276 346
166 3300044719 Ga0466971_0005091 Ga0466971_0005091_3877_4917 346
167 3300044765 Ga0466970_0029164 Ga0466970_0029164_1548_2588 346
168 3300044842 Ga0466957_0179553 Ga0466957_0179553_32_1072 346
169 3300045051 Ga0451576_0056406 Ga0451576_0056406_1450_2508 346
170 3300046491 Ga0495584_0000515 Ga0495584_0000515_15910_16950 346
171 3300046492 Ga0495585_0000001 Ga0495585_0000001_195253_196377 346
172 3300046492 Ga0495585_0005555 Ga0495585_0005555_1717_2757 346
173 3300046507 Ga0495606_0000333 Ga0495606_0000333_93_1133 346
174 3300046507 Ga0495606_0025228 Ga0495606_0025228_1046_2086 346
175 3300046512 Ga0495610_0002128 Ga0495610_0002128_14827_15867 346
176 3300046513 Ga0495616_0000001 Ga0495616_0000001_155624_156664 346
177 3300046515 Ga0495620_0000401 Ga0495620_0000401_1026_2066 346
178 3300046518 Ga0495631_0000241 Ga0495631_0000241_5024_6148 346
179 3300046518 Ga0495631_0000410 Ga0495631_0000410_17588_18628 346
180 3300046524 Ga0495648_0003697 Ga0495648_0003697_12295_13335 346
181 3300046616 Ga0495668_0005180 Ga0495668_0005180_7803_8843 346
182 3300046648 Ga0495611_0000008 Ga0495611_0000008_59867_60907 346
183 3300046665 Ga0495661_0000104 Ga0495661_0000104_1786_2910 346
184 3300046691 Ga0495670_0004895 Ga0495670_0004895_3005_4045 346
185 3300046694 Ga0495649_0004875 Ga0495649_0004875_4460_5500 346
186 3300046810 Ga0495660_0000009 Ga0495660_0000009_86565_87605 346
187 3300047323 Ga0495683_0001923 Ga0495683_0001923_5828_6868 346
188 3300047469 Ga0495673_0000001 Ga0495673_0000001_933097_934137 346
189 3300047469 Ga0495673_0000030 Ga0495673_0000030_273041_274081 346
190 3300047472 Ga0495686_0000026 Ga0495686_0000026_169560_170654 346
191 3300047472 Ga0495686_0000077 Ga0495686_0000077_170968_172008 346
192 3300047472 Ga0495686_0005630 Ga0495686_0005630_93_1133 346
193 3300048904 Ga0496101_0003328 Ga0496101_0003328_3080_4120 346
194 3300048909 Ga0496106_0010436 Ga0496106_0010436_3951_5162 346
195 3300048910 Ga0496107_0127583 Ga0496107_0127583_410_1450 346
196 3300048915 Ga0496112_0304919 Ga0496112_0304919_223_1272 346
197 3300048916 Ga0496113_0032759 Ga0496113_0032759_1750_2790 346
198 3300048918 Ga0496115_0000379 Ga0496115_0000379_9818_10858 346
199 3300048918 Ga0496115_0006359 Ga0496115_0006359_3765_4805 346
200 3300048920 Ga0496117_0030788 Ga0496117_0030788_152_1246 346
201 3300048921 Ga0496118_0001452 Ga0496118_0001452_1791_2885 346
202 3300048924 Ga0496121_0000044 Ga0496121_0000044_204930_205982 346
203 3300048924 Ga0496121_0000368 Ga0496121_0000368_17988_19112 346
204 3300048924 Ga0496121_0001280 Ga0496121_0001280_25656_26696 346
205 3300048924 Ga0496121_0165054 Ga0496121_0165054_338_1384 346
206 3300048925 Ga0496122_0136318 Ga0496122_0136318_384_1424 346
207 3300048928 Ga0496125_0000044 Ga0496125_0000044_147271_148311 346
208 3300048929 Ga0496126_0013810 Ga0496126_0013810_4215_5261 346
209 3300048929 Ga0496126_0075654 Ga0496126_0075654_57_1109 346
210 3300049459 Ga0495678_014803 Ga0495678_014803_2494_3534 346
211 3300049568 Ga0501031_0009982 Ga0501031_0009982_4408_5469 346
212 3300049568 Ga0501031_0020967 Ga0501031_0020967_3111_4160 346
213 3300049569 Ga0501032_0009376 Ga0501032_0009376_4619_5680 346
214 3300049570 Ga0501033_0009371 Ga0501033_0009371_2926_3987 346
215 3300049570 Ga0501033_0028195 Ga0501033_0028195_3125_4174 346
216 3300049571 Ga0501034_0008571 Ga0501034_0008571_7179_8240 346
217 3300049571 Ga0501034_0180458 Ga0501034_0180458_778_1824 346
218 3300049572 Ga0501036_0000511 Ga0501036_0000511_19504_20565 346
219 3300049572 Ga0501036_0008069 Ga0501036_0008069_6618_7667 346
220 3300049573 Ga0501037_0000741 Ga0501037_0000741_2551_3612 346
221 3300049573 Ga0501037_0023073 Ga0501037_0023073_549_1598 346
222 3300049574 Ga0501038_0015652 Ga0501038_0015652_1791_2840 346
223 3300049574 Ga0501038_0034131 Ga0501038_0034131_2295_3356 346
224 3300049579 Ga0501043_0044061 Ga0501043_0044061_269_1330 346
225 3300049579 Ga0501043_0123079 Ga0501043_0123079_780_1829 346
226 3300049580 Ga0501046_0028650 Ga0501046_0028650_2057_3118 346
227 3300049581 Ga0501047_0015943 Ga0501047_0015943_4710_5771 346
228 3300049581 Ga0501047_0102987 Ga0501047_0102987_1259_2308 346
229 3300049582 Ga0501048_0198956 Ga0501048_0198956_161_1222 346
230 3300049586 Ga0501070_0114413 Ga0501070_0114413_302_1351 346
231 3300049592 Ga0501076_0067503 Ga0501076_0067503_1073_2119 346
232 3300049742 Ga0501080_0139444 Ga0501080_0139444_156_1205 346
233 3300049822 Ga0501035_0000512 Ga0501035_0000512_33797_34858 346
234 3300049823 Ga0501044_0059350 Ga0501044_0059350_896_1945 346
235 3300049823 Ga0501044_0082251 Ga0501044_0082251_912_1973 346
236 3300050494 nmdc:mga06z11_126002_c1 nmdc:mga06z11_126002_c1_345_1394 346
237 3300050511 nmdc:mga08y16_57659_c1 nmdc:mga08y16_57659_c1_2017_3072 346
238 3300050511 nmdc:mga08y16_67266_c1 nmdc:mga08y16_67266_c1_1413_2462 346
239 3300053160 Ga0500633_0007517 Ga0500633_0007517_1485_2525 346
240 3300053730 Ga0500645_001869 Ga0500645_001869_8434_9558 346
241 3300054114 Ga0501084_0203054 Ga0501084_0203054_554_1630 346
242 3300060353 Ga0501082_0184956 Ga0501082_0184956_310_1356 346
243 3300061719 Ga0466962_0002037 Ga0466962_0002037_7500_8540 346

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00586

AIRS

AIR synthase related protein, N-terminal domain

49

147

0.97

PF02769

AIRS_C

AIR synthase related protein, C-terminal domain

159

338

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zau-assembly1.cif.gz_B-2 crystal structure of an n-terminally truncated selenophosphate synthetase from aquifex aeolicus 0.9443 49 346
2zau-assembly1.cif.gz_C-2 crystal structure of an n-terminally truncated selenophosphate synthetase from aquifex aeolicus 0.9408 47 346
2yye-assembly1.cif.gz_A crystal structure of selenophosphate synthetase from aquifex aeolicus complexed with ampcpp 0.9402 5 346
2zau-assembly1.cif.gz_A-2 crystal structure of an n-terminally truncated selenophosphate synthetase from aquifex aeolicus 0.9402 47 346
2zod-assembly1.cif.gz_B crystal structure of selenophosphate synthetase from aquifex aeolicus 0.9393 6 346
ID Description Score Start End Superfamily
2yydA02 Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain 0.9274 163 346 3.90.650.10
2yydA02 Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain 0.9177 163 346 3.90.650.10
2zauB01 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.9104 49 160 3.30.1330.10
3u0oB02 Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain 0.9054 162 346 3.90.650.10
3u0oA01 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.9034 28 161 3.30.1330.10
ID Description Score Start End GO Terms
AF-A0A529IV71-F1-model_v4 deleted 0.9969 37 346
AF-A0A259PD58-F1-model_v4 Selenide, water dikinase SelD 0.9916 61 346 GO:0004756
GO:0005524
GO:0005737
GO:0016260
AF-A0A2M8EFB7-F1-model_v4 Selenide, water dikinase SelD 0.9878 90 346 GO:0004756
GO:0005524
GO:0005737
GO:0016260
AF-A0A529IV71-F1-model_v4 deleted 0.9873 37 346
AF-A0A259PD58-F1-model_v4 Selenide, water dikinase SelD 0.9848 61 346 GO:0004756
GO:0005524
GO:0005737
GO:0016260

Feature Viewer

pLDDT pTM Quality
90.78 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map