F355793

General Info

Members Datasets Scaffolds Average Seq Length
243 138 486 140

Family's Representative Sequence

Representative Sequence 3300038705|Ga0237819_00615|Ga0237819_00615_10397_10864
Length 155
Sequence MKRMRFPFPVEYPMFRRLDDTIAVSPQITADQVAAAAAQGVTMIINNRPEGEEEGQPTGAEIEAAATAAGLAYRAIPVTHAGFSANQLDEMNAALDAAGGPVLAYCRSGTRSTYLWALASAQRGGSPDALSETAASAGYDLGSIRPMLDALSARA

Samples

Sample ID Description Type Environment
1 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
16 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
19 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
20 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
21 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
22 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
23 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
24 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
25 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
26 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
29 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
36 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
37 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
38 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
59 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
60 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
61 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
62 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
63 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
64 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
65 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
66 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
67 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
68 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
69 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
70 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
71 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
72 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
73 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
74 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
75 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
76 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
77 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
78 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
79 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
80 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
81 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
82 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
83 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
84 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
85 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
86 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
87 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
88 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
89 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
90 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
91 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
92 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
93 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
94 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
95 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
96 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
97 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
98 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
99 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
100 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
101 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
102 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
103 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
104 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
105 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
106 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
107 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
108 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
109 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
110 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
111 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
112 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
113 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
114 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
121 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
122 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
123 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
124 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
125 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
126 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
127 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
128 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
129 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
130 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
131 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
132 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
133 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
134 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
135 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
136 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
137 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
138 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0
Isolates 0.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.7
Nodule 0
Rhizoplane 0.82
Rhizosphere 73.66
Stem 0
Stem Tuber 0
Unclassified 2.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0237819_00615 3300038705 Bacteria 11715
2 JGI24034J26672_10084477 3300002239 Bacteria 583
3 Ga0070658_10716038 3300005327 Bacteria 869
4 Ga0070670_100105550 3300005331 Bacteria 2427
5 Ga0070670_100685323 3300005331 Bacteria 921
6 Ga0070666_10009623 3300005335 Bacteria 6032
7 Ga0070666_10429565 3300005335 Bacteria 952
8 Ga0070660_100001049 3300005339 Bacteria 18593
9 Ga0070660_100396579 3300005339 Bacteria 1140
10 Ga0070692_10006549 3300005345 Bacteria 5064
11 Ga0070668_100000011 3300005347 Bacteria 123099
12 Ga0070668_100000190 3300005347 Bacteria 40176
13 Ga0070668_100017232 3300005347 Bacteria 5408
14 Ga0070668_101300980 3300005347 Bacteria 661
15 Ga0070669_100115568 3300005353 Bacteria 2041
16 Ga0070669_100150051 3300005353 Bacteria 1804
17 Ga0070669_100255285 3300005353 Bacteria 1397
18 Ga0070669_101130680 3300005353 Bacteria 675
19 Ga0070671_100000262 3300005355 Bacteria 35350
20 Ga0070667_100000135 3300005367 Bacteria 93968
21 Ga0070667_100081162 3300005367 Bacteria 2775
22 Ga0070667_100372295 3300005367 Bacteria 1296
23 Ga0070672_100981271 3300005543 Bacteria 748
24 Ga0070665_100111739 3300005548 Bacteria 2735
25 Ga0070665_102247715 3300005548 Bacteria 549
26 Ga0068857_100031421 3300005577 Bacteria 4692
27 Ga0068854_100035568 3300005578 Bacteria 3486
28 Ga0068859_100311681 3300005617 Bacteria 1667
29 Ga0068859_101147070 3300005617 Bacteria 855
30 Ga0068863_100000186 3300005841 Bacteria 65963
31 Ga0068863_100000198 3300005841 Bacteria 63987
32 Ga0068860_100003833 3300005843 Bacteria 15465
33 Ga0068860_100554754 3300005843 Bacteria 1151
34 Ga0068862_100007555 3300005844 Bacteria 9009
35 Ga0068862_100047246 3300005844 Bacteria 3673
36 Ga0068862_100196093 3300005844 Bacteria 1819
37 Ga0075364_10112344 3300006051 Bacteria 1819
38 Ga0075362_10134513 3300006177 Bacteria 1178
39 Ga0075369_10126304 3300006186 Bacteria 1160
40 Ga0075366_10030532 3300006195 Bacteria 3168
41 Ga0075370_10037361 3300006353 Bacteria 2730
42 Ga0075370_10099311 3300006353 Bacteria 1684
43 Ga0075430_100027677 3300006846 Bacteria 4816
44 Ga0097620_100311691 3300006931 Bacteria 1667
45 Ga0097620_101147099 3300006931 Bacteria 855
46 Ga0105240_10008817 3300009093 Bacteria 14364
47 Ga0105240_10029784 3300009093 Bacteria 7103
48 Ga0105240_10181370 3300009093 Bacteria 2484
49 Ga0105248_10001821 3300009177 Bacteria 23699
50 Ga0105237_10006115 3300009545 Bacteria 13455
51 Ga0105238_10124209 3300009551 Bacteria 2560
52 Ga0105238_10339983 3300009551 Bacteria 1489
53 Ga0105238_10563882 3300009551 Bacteria 1144
54 Ga0105249_10003057 3300009553 Bacteria 14442
55 Ga0105239_10000271 3300010375 Bacteria 76812
56 Ga0105239_10449211 3300010375 Unclassified 1462
57 Ga0157371_10237114 3300013102 Unclassified 1312
58 Ga0157372_10358344 3300013307 Bacteria 1699
59 Ga0213874_10183249 3300021377 Bacteria 746
60 Ga0213876_10000250 3300021384 Bacteria 51059
61 Ga0213875_10248461 3300021388 Bacteria 839
62 Ga0207680_10005722 3300025903 Bacteria 5956
63 Ga0207705_10302341 3300025909 Bacteria 1227
64 Ga0207695_10022661 3300025913 Bacteria 7120
65 Ga0207695_10029411 3300025913 Bacteria 6071
66 Ga0207671_10000567 3300025914 Bacteria 49547
67 Ga0207657_10006806 3300025919 Bacteria 11799
68 Ga0207657_10126043 3300025919 Bacteria 2103
69 Ga0207681_10001260 3300025923 Bacteria 16344
70 Ga0207681_10196824 3300025923 Bacteria 1545
71 Ga0207681_10249457 3300025923 Bacteria 1385
72 Ga0207694_10005424 3300025924 Bacteria 9812
73 Ga0207694_10056519 3300025924 Bacteria 3048
74 Ga0207694_10156233 3300025924 Bacteria 1840
75 Ga0207650_10102739 3300025925 Bacteria 2203
76 Ga0207650_10406533 3300025925 Bacteria 1127
77 Ga0207644_10000032 3300025931 Bacteria 133759
78 Ga0207709_10269742 3300025935 Bacteria 1252
79 Ga0207711_10020547 3300025941 Bacteria 5508
80 Ga0207711_10021254 3300025941 Bacteria 5421
81 Ga0207667_10000007 3300025949 Bacteria 630590
82 Ga0207668_10000034 3300025972 Bacteria 119274
83 Ga0207668_10000283 3300025972 Bacteria 33396
84 Ga0207668_10013883 3300025972 Bacteria 4973
85 Ga0207668_11175472 3300025972 Bacteria 689
86 Ga0207640_10050498 3300025981 Bacteria 2699
87 Ga0207658_10000101 3300025986 Bacteria 95144
88 Ga0207658_10062765 3300025986 Bacteria 2782
89 Ga0207658_10442523 3300025986 Bacteria 1149
90 Ga0207678_10645761 3300026067 Bacteria 929
91 Ga0207641_10000031 3300026088 Bacteria 224320
92 Ga0207641_10000046 3300026088 Bacteria 180836
93 Ga0268266_10052104 3300028379 Bacteria 3514
94 Ga0268265_10051319 3300028380 Bacteria 3113
95 Ga0268265_10106745 3300028380 Bacteria 2275
96 Ga0268265_10253651 3300028380 Bacteria 1560
97 Ga0268265_11701974 3300028380 Bacteria 636
98 Ga0268264_10000785 3300028381 Bacteria 34613
99 Ga0268264_10003799 3300028381 Bacteria 12954
100 Ga0268264_10151560 3300028381 Bacteria 2079
101 Ga0307405_10431869 3300031731 Bacteria 1039
102 Ga0307405_10765754 3300031731 Bacteria 805
103 Ga0307413_10348070 3300031824 Bacteria 1142
104 Ga0307413_10391224 3300031824 Bacteria 1086
105 Ga0307413_11408318 3300031824 Bacteria 613
106 Ga0307410_10147595 3300031852 Bacteria 1747
107 Ga0307410_10204901 3300031852 Bacteria 1508
108 Ga0307410_10569413 3300031852 Bacteria 941
109 Ga0307410_10698476 3300031852 Bacteria 855
110 Ga0307410_10751139 3300031852 Bacteria 826
111 Ga0307410_11135926 3300031852 Bacteria 678
112 Ga0307406_11274786 3300031901 Bacteria 640
113 Ga0307412_10351642 3300031911 Bacteria 1183
114 Ga0307412_10792486 3300031911 Bacteria 822
115 Ga0307409_100061666 3300031995 Bacteria 2932
116 Ga0307409_100108546 3300031995 Bacteria 2321
117 Ga0307409_100275344 3300031995 Bacteria 1552
118 Ga0307409_101318589 3300031995 Bacteria 747
119 Ga0307416_100367297 3300032002 Bacteria 1464
120 Ga0307416_100370596 3300032002 Bacteria 1458
121 Ga0307416_100614204 3300032002 Bacteria 1168
122 Ga0307416_101439910 3300032002 Bacteria 795
123 Ga0307414_10000359 3300032004 Bacteria 25279
124 Ga0307414_10241012 3300032004 Bacteria 1497
125 Ga0307411_10076649 3300032005 Bacteria 2286
126 Ga0307411_10174321 3300032005 Bacteria 1625
127 Ga0307411_10465344 3300032005 Bacteria 1061
128 Ga0307411_10513538 3300032005 Bacteria 1015
129 Ga0307411_10945611 3300032005 Bacteria 768
130 Ga0307411_12230657 3300032005 Bacteria 514
131 Ga0307415_100182596 3300032126 Bacteria 1647
132 Ga0307415_100482923 3300032126 Bacteria 1079
133 Ga0307415_100694636 3300032126 Bacteria 917
134 Ga0373931_1166589 3300035691 Bacteria 526
135 Ga0395899_0115069 3300037312 Bacteria 1931
136 Ga0395900_1137015 3300037418 Bacteria 697
137 Ga0395900_1145504 3300037418 Bacteria 694
138 Ga0395905_0280774 3300037471 Bacteria 1551
139 Ga0395905_1242783 3300037471 Bacteria 648
140 Ga0436364_1456527 3300037853 Bacteria 732
141 Ga0395901_0029403 3300038443 Bacteria 5658
142 Ga0395901_0088836 3300038443 Bacteria 3233
143 Ga0395901_0302146 3300038443 Bacteria 1659
144 Ga0395901_0389697 3300038443 Bacteria 1433
145 Ga0436365_0062931 3300039437 Bacteria 52276
146 Ga0436363_0070593 3300039450 Bacteria 1358
147 Ga0436362_0605084 3300039453 Unclassified 802
148 Ga0436362_0751286 3300039453 Unclassified 609
149 Ga0451804_0676945 3300041463 Bacteria 1812
150 Ga0451807_1228133 3300041486 Bacteria 724
151 Ga0439443_003909 3300042003 Bacteria 1911
152 Ga0439448_0089069 3300042005 Bacteria 1041
153 Ga0439455_0004715 3300042012 Bacteria 2719
154 Ga0439458_0001653 3300042157 Bacteria 5562
155 Ga0439435_0019339 3300042436 Bacteria 1744
156 Ga0466971_0373722 3300044719 Bacteria 692
157 Ga0466970_0058468 3300044765 Bacteria 2064
158 Ga0466957_0869809 3300044842 Bacteria 643
159 Ga0451576_0000024 3300045051 Bacteria 470499
160 Ga0495617_096034 3300046452 Bacteria 965
161 Ga0495638_0000305 3300046460 Bacteria 63286
162 Ga0495638_0041414 3300046460 Bacteria 2914
163 Ga0495583_0000710 3300046506 Bacteria 42765
164 Ga0495610_0194770 3300046512 Bacteria 834
165 Ga0495631_0223868 3300046518 Bacteria 803
166 Ga0495632_0001534 3300046519 Bacteria 19078
167 Ga0495648_0000235 3300046524 Bacteria 63436
168 Ga0495587_0279496 3300046536 Bacteria 936
169 Ga0495621_0047170 3300046539 Bacteria 1531
170 Ga0495597_0116216 3300046542 Bacteria 1118
171 Ga0495622_0016233 3300046557 Bacteria 3467
172 Ga0495633_0091466 3300046558 Bacteria 1414
173 Ga0495625_0067617 3300046660 Bacteria 2514
174 Ga0495670_0261635 3300046691 Bacteria 923
175 Ga0495671_0000020 3300046692 Bacteria 268306
176 Ga0495673_0000316 3300047469 Bacteria 62814
177 Ga0495673_0010108 3300047469 Bacteria 5159
178 Ga0495673_0082118 3300047469 Bacteria 1333
179 Ga0495686_0000100 3300047472 Bacteria 180492
180 Ga0495686_0000119 3300047472 Bacteria 165244
181 Ga0495686_0097997 3300047472 Bacteria 1772
182 Ga0496117_0004096 3300048920 Bacteria 16336
183 Ga0496117_0033744 3300048920 Bacteria 3865
184 Ga0496117_0169513 3300048920 Bacteria 1269
185 Ga0496117_0192227 3300048920 Bacteria 1161
186 Ga0496117_0214189 3300048920 Bacteria 1077
187 Ga0496117_0490145 3300048920 Bacteria 598
188 Ga0496118_0000743 3300048921 Bacteria 52692
189 Ga0496118_0006863 3300048921 Bacteria 12335
190 Ga0496118_0035628 3300048921 Bacteria 4037
191 Ga0496118_0135207 3300048921 Bacteria 1575
192 Ga0496119_0026609 3300048922 Bacteria 4006
193 Ga0496119_0053894 3300048922 Bacteria 2453
194 Ga0496119_0381002 3300048922 Bacteria 676
195 Ga0496120_0068428 3300048923 Bacteria 1959
196 Ga0496120_0221562 3300048923 Bacteria 903
197 Ga0496121_0002226 3300048924 Bacteria 30274
198 Ga0496121_0002348 3300048924 Bacteria 29182
199 Ga0496121_0054650 3300048924 Bacteria 3334
200 Ga0496121_0088263 3300048924 Bacteria 2432
201 Ga0496121_0225801 3300048924 Bacteria 1315
202 Ga0496122_0002775 3300048925 Bacteria 24137
203 Ga0496122_0053009 3300048925 Bacteria 3062
204 Ga0496122_0238706 3300048925 Bacteria 1027
205 Ga0496123_0002862 3300048926 Bacteria 20314
206 Ga0496123_0011845 3300048926 Bacteria 7504
207 Ga0496123_0049017 3300048926 Bacteria 2836
208 Ga0496125_0046827 3300048928 Bacteria 3623
209 Ga0496126_0142418 3300048929 Bacteria 2062
210 Ga0496126_1093387 3300048929 Bacteria 593
211 Ga0501031_0180009 3300049568 Bacteria 1381
212 Ga0501033_0018646 3300049570 Bacteria 5244
213 Ga0501034_0312388 3300049571 Bacteria 1506
214 Ga0501034_0360117 3300049571 Bacteria 1382
215 Ga0501034_0573329 3300049571 Bacteria 1036
216 Ga0501037_0458014 3300049573 Bacteria 869
217 Ga0501039_0615725 3300049575 Unclassified 851
218 Ga0501047_0262143 3300049581 Bacteria 1576
219 Ga0501074_0743287 3300049590 Bacteria 692
220 Ga0501268_020694 3300049765 Bacteria 1123
221 nmdc:mga03683_109771_c1 3300050489 Bacteria 1219
222 nmdc:mga00v17_6356_c1 3300050491 Bacteria 2656
223 nmdc:mga0k408_2501_c1 3300050493 Bacteria 9775
224 nmdc:mga0k408_349861_c1 3300050493 Bacteria 881
225 nmdc:mga0k408_63991_c1 3300050493 Bacteria 2140
226 nmdc:mga0k408_762387_c1 3300050493 Unclassified 565
227 nmdc:mga07m45_3865_c1 3300050496 Bacteria 5883
228 nmdc:mga0qj67_22317_c1 3300050509 Bacteria 4863
229 nmdc:mga0sz30_52928_c1 3300050516 Bacteria 1724
230 Ga0500643_004640 3300053087 Bacteria 6133
231 Ga0500643_008937 3300053087 Bacteria 3877
232 Ga0500643_026102 3300053087 Bacteria 1833
233 Ga0500646_0009719 3300053090 Bacteria 2462
234 Ga0500594_0012591 3300053118 Bacteria 1997
235 Ga0500559_0089982 3300053136 Bacteria 1404
236 Ga0500559_0342275 3300053136 Bacteria 700
237 Ga0500568_0009480 3300053139 Bacteria 4617
238 Ga0500604_0000013 3300053151 Bacteria 92467
239 Ga0500616_0000161 3300053153 Bacteria 111424
240 Ga0500622_0001891 3300053156 Bacteria 15808
241 Ga0500624_000028 3300053157 Bacteria 106675
242 Ga0590075_079578 3300059424 Unclassified 849
243 2896255983 2896253425 Bacteria 3418029
244 Ga0237819_00615
245 JGI24034J26672_10084477
246 Ga0070658_10716038
247 Ga0070670_100105550
248 Ga0070670_100685323
249 Ga0070666_10009623
250 Ga0070666_10429565
251 Ga0070660_100001049
252 Ga0070660_100396579
253 Ga0070692_10006549
254 Ga0070668_100000011
255 Ga0070668_100000190
256 Ga0070668_100017232
257 Ga0070668_101300980
258 Ga0070669_100115568
259 Ga0070669_100150051
260 Ga0070669_100255285
261 Ga0070669_101130680
262 Ga0070671_100000262
263 Ga0070667_100000135
264 Ga0070667_100081162
265 Ga0070667_100372295
266 Ga0070672_100981271
267 Ga0070665_100111739
268 Ga0070665_102247715
269 Ga0068857_100031421
270 Ga0068854_100035568
271 Ga0068859_100311681
272 Ga0068859_101147070
273 Ga0068863_100000186
274 Ga0068863_100000198
275 Ga0068860_100003833
276 Ga0068860_100554754
277 Ga0068862_100007555
278 Ga0068862_100047246
279 Ga0068862_100196093
280 Ga0075364_10112344
281 Ga0075362_10134513
282 Ga0075369_10126304
283 Ga0075366_10030532
284 Ga0075370_10037361
285 Ga0075370_10099311
286 Ga0075430_100027677
287 Ga0097620_100311691
288 Ga0097620_101147099
289 Ga0105240_10008817
290 Ga0105240_10029784
291 Ga0105240_10181370
292 Ga0105248_10001821
293 Ga0105237_10006115
294 Ga0105238_10124209
295 Ga0105238_10339983
296 Ga0105238_10563882
297 Ga0105249_10003057
298 Ga0105239_10000271
299 Ga0105239_10449211
300 Ga0157371_10237114
301 Ga0157372_10358344
302 Ga0213874_10183249
303 Ga0213876_10000250
304 Ga0213875_10248461
305 Ga0207680_10005722
306 Ga0207705_10302341
307 Ga0207695_10022661
308 Ga0207695_10029411
309 Ga0207671_10000567
310 Ga0207657_10006806
311 Ga0207657_10126043
312 Ga0207681_10001260
313 Ga0207681_10196824
314 Ga0207681_10249457
315 Ga0207694_10005424
316 Ga0207694_10056519
317 Ga0207694_10156233
318 Ga0207650_10102739
319 Ga0207650_10406533
320 Ga0207644_10000032
321 Ga0207709_10269742
322 Ga0207711_10020547
323 Ga0207711_10021254
324 Ga0207667_10000007
325 Ga0207668_10000034
326 Ga0207668_10000283
327 Ga0207668_10013883
328 Ga0207668_11175472
329 Ga0207640_10050498
330 Ga0207658_10000101
331 Ga0207658_10062765
332 Ga0207658_10442523
333 Ga0207678_10645761
334 Ga0207641_10000031
335 Ga0207641_10000046
336 Ga0268266_10052104
337 Ga0268265_10051319
338 Ga0268265_10106745
339 Ga0268265_10253651
340 Ga0268265_11701974
341 Ga0268264_10000785
342 Ga0268264_10003799
343 Ga0268264_10151560
344 Ga0307405_10431869
345 Ga0307405_10765754
346 Ga0307413_10348070
347 Ga0307413_10391224
348 Ga0307413_11408318
349 Ga0307410_10147595
350 Ga0307410_10204901
351 Ga0307410_10569413
352 Ga0307410_10698476
353 Ga0307410_10751139
354 Ga0307410_11135926
355 Ga0307406_11274786
356 Ga0307412_10351642
357 Ga0307412_10792486
358 Ga0307409_100061666
359 Ga0307409_100108546
360 Ga0307409_100275344
361 Ga0307409_101318589
362 Ga0307416_100367297
363 Ga0307416_100370596
364 Ga0307416_100614204
365 Ga0307416_101439910
366 Ga0307414_10000359
367 Ga0307414_10241012
368 Ga0307411_10076649
369 Ga0307411_10174321
370 Ga0307411_10465344
371 Ga0307411_10513538
372 Ga0307411_10945611
373 Ga0307411_12230657
374 Ga0307415_100182596
375 Ga0307415_100482923
376 Ga0307415_100694636
377 Ga0373931_1166589
378 Ga0395899_0115069
379 Ga0395900_1137015
380 Ga0395900_1145504
381 Ga0395905_0280774
382 Ga0395905_1242783
383 Ga0436364_1456527
384 Ga0395901_0029403
385 Ga0395901_0088836
386 Ga0395901_0302146
387 Ga0395901_0389697
388 Ga0436365_0062931
389 Ga0436363_0070593
390 Ga0436362_0605084
391 Ga0436362_0751286
392 Ga0451804_0676945
393 Ga0451807_1228133
394 Ga0439443_003909
395 Ga0439448_0089069
396 Ga0439455_0004715
397 Ga0439458_0001653
398 Ga0439435_0019339
399 Ga0466971_0373722
400 Ga0466970_0058468
401 Ga0466957_0869809
402 Ga0451576_0000024
403 Ga0495617_096034
404 Ga0495638_0000305
405 Ga0495638_0041414
406 Ga0495583_0000710
407 Ga0495610_0194770
408 Ga0495631_0223868
409 Ga0495632_0001534
410 Ga0495648_0000235
411 Ga0495587_0279496
412 Ga0495621_0047170
413 Ga0495597_0116216
414 Ga0495622_0016233
415 Ga0495633_0091466
416 Ga0495625_0067617
417 Ga0495670_0261635
418 Ga0495671_0000020
419 Ga0495673_0000316
420 Ga0495673_0010108
421 Ga0495673_0082118
422 Ga0495686_0000100
423 Ga0495686_0000119
424 Ga0495686_0097997
425 Ga0496117_0004096
426 Ga0496117_0033744
427 Ga0496117_0169513
428 Ga0496117_0192227
429 Ga0496117_0214189
430 Ga0496117_0490145
431 Ga0496118_0000743
432 Ga0496118_0006863
433 Ga0496118_0035628
434 Ga0496118_0135207
435 Ga0496119_0026609
436 Ga0496119_0053894
437 Ga0496119_0381002
438 Ga0496120_0068428
439 Ga0496120_0221562
440 Ga0496121_0002226
441 Ga0496121_0002348
442 Ga0496121_0054650
443 Ga0496121_0088263
444 Ga0496121_0225801
445 Ga0496122_0002775
446 Ga0496122_0053009
447 Ga0496122_0238706
448 Ga0496123_0002862
449 Ga0496123_0011845
450 Ga0496123_0049017
451 Ga0496125_0046827
452 Ga0496126_0142418
453 Ga0496126_1093387
454 Ga0501031_0180009
455 Ga0501033_0018646
456 Ga0501034_0312388
457 Ga0501034_0360117
458 Ga0501034_0573329
459 Ga0501037_0458014
460 Ga0501039_0615725
461 Ga0501047_0262143
462 Ga0501074_0743287
463 Ga0501268_020694
464 nmdc:mga03683_109771_c1
465 nmdc:mga00v17_6356_c1
466 nmdc:mga0k408_2501_c1
467 nmdc:mga0k408_349861_c1
468 nmdc:mga0k408_63991_c1
469 nmdc:mga0k408_762387_c1
470 nmdc:mga07m45_3865_c1
471 nmdc:mga0qj67_22317_c1
472 nmdc:mga0sz30_52928_c1
473 Ga0500643_004640
474 Ga0500643_008937
475 Ga0500643_026102
476 Ga0500646_0009719
477 Ga0500594_0012591
478 Ga0500559_0089982
479 Ga0500559_0342275
480 Ga0500568_0009480
481 Ga0500604_0000013
482 Ga0500616_0000161
483 Ga0500622_0001891
484 Ga0500624_000028
485 Ga0590075_079578
486 2896255983

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04273

BLH_phosphatase

Beta-lactamase hydrolase-like protein, phosphatase-like domain

14

123

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pyh-assembly1.cif.gz_A phospho-glucan bound structure of starch phosphatase starch excess4 reveals the mechanism for c6-specificty 0.8551 1 120
2f46-assembly2.cif.gz_B crystal structure of a putative phosphatase (nma1982) from neisseria meningitidis z2491 at 1.41 a resolution 0.8251 3 138
4kyq-assembly1.cif.gz_A structure of a product bound plant phosphatase 0.8173 1 122
3nme-assembly1.cif.gz_B structure of a plant phosphatase 0.8135 1 125
2f46-assembly2.cif.gz_B crystal structure of a putative phosphatase (nma1982) from neisseria meningitidis z2491 at 1.41 a resolution 0.7994 3 138
ID Description Score Start End Superfamily
2f46B00 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.8246 1 138 3.90.190.10
2f46B00 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.809 1 138 3.90.190.10
af_Q9UAX0_81_234_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.7995 12 139 3.90.190.10
af_I2HA91_27_182_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.7945 1 139 3.90.190.10
af_Q8IIN1_58_216_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.7942 9 136 3.90.190.10
ID Description Score Start End GO Terms
AF-A0A257G5G1-F1-model_v4 TIGR01244 family protein 0.9952 1 139 GO:0016787
AF-A0A2P2ECU6-F1-model_v4 Beta-lactamase hydrolase-like protein 0.9941 2 139 GO:0016787
AF-A0A0B8ZY74-F1-model_v4 Beta-lactamase hydrolase-family protein 0.9919 1 140 GO:0016787
AF-A0A7W6A1M8-F1-model_v4 Uncharacterized protein (TIGR01244 family) 0.9912 1 139 GO:0016787
AF-A0A2D8ML27-F1-model_v4 TIGR01244 family phosphatase 0.9867 1 139 GO:0016787

Map