F355714

General Info

Members Datasets Scaffolds Average Seq Length
243 156 242 323

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10014737|Ga0265338_100147373
Length 358
Sequence MLVGPLDFVHLRDRSSPLGIAGGAGWKHLDFHFQMKVVFITGAAGFIGSNLVERLLADGKTVVGWDNFSTGQKKFLAAAAGNLQFKFVAGDNLDLPALTKAMAGCDTVFHLAANADIRFGLEHPSKDFQQNTVATFNVLEAMRANGIKRIAFSSTGSVYGEADVIPTPENAPFPVQTSLYAASKVAGECLIQSYCEGFGFEGYLFRFVSILGERYTHGHIFDFYRQLLEHPDRLNVLGDGTQRKSYLYIGDCVDAMLQVIQMQTALKAKHRVEIYNLGADEYVRVNDSIRFICQMLNLNPRIEYSGGNKGWVGDNPFIFLDTKKIRATGWNNQFSIQRGIIRTLEWLQQNRWVYEKRK

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 2786546517 Verrucomicrobia bacterium LW23 Isolate Rhizoplane
4 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
99 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
100 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
101 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
102 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
103 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
104 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
105 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
106 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
107 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
108 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
109 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
110 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
111 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
112 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
113 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
114 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
115 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
116 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
117 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
118 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
119 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
120 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
121 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
122 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
123 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
124 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
125 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
126 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
127 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
133 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
134 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
135 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
136 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
137 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
138 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
139 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
140 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
141 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
142 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
143 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
144 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
145 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
153 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
156 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0
Isolates 0.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.41
Nodule 0
Rhizoplane 5.35
Rhizosphere 91.77
Stem 0
Stem Tuber 0
Unclassified 2.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_949179 2162886011 Bacteria 2099
2 MBSR1b_contig_1554511 2162886012 Bacteria 2065
3 CNXas_1002585 3300000545 Unclassified 1260
4 rootH2_10015099 3300003320 Bacteria 23718
5 rootH1_10007259 3300003323 Bacteria 61283
6 Ga0065712_10006858 3300005290 Unclassified 3187
7 Ga0065715_10001501 3300005293 Bacteria 16194
8 Ga0070690_100048809 3300005330 Bacteria 2697
9 Ga0070666_10001983 3300005335 Bacteria 12444
10 Ga0070682_100039687 3300005337 Bacteria 2894
11 Ga0068868_100013997 3300005338 Bacteria 5901
12 Ga0068868_100111170 3300005338 Bacteria 2227
13 Ga0070689_100004843 3300005340 Eukaryota 9134
14 Ga0070689_100246406 3300005340 Bacteria 1473
15 Ga0070689_100431073 3300005340 Bacteria 1119
16 Ga0070691_10089833 3300005341 Bacteria 1513
17 Ga0070668_100026413 3300005347 Bacteria 4406
18 Ga0070669_100001783 3300005353 Bacteria 15484
19 Ga0070675_100007834 3300005354 Bacteria 8276
20 Ga0070671_100031201 3300005355 Bacteria 4401
21 Ga0070674_100002849 3300005356 Bacteria 9559
22 Ga0070688_100011009 3300005365 Bacteria 5013
23 Ga0070667_100017597 3300005367 Bacteria 5922
24 Ga0070709_10001454 3300005434 Bacteria 12751
25 Ga0070714_100004773 3300005435 Bacteria 10267
26 Ga0070714_100016985 3300005435 Bacteria 5888
27 Ga0070714_100024700 3300005435 Unclassified 4953
28 Ga0070714_100162427 3300005435 Bacteria 2022
29 Ga0070713_100002612 3300005436 Bacteria 11768
30 Ga0070710_10001045 3300005437 Bacteria 13169
31 Ga0070701_10057806 3300005438 Bacteria 2034
32 Ga0070711_100030335 3300005439 Bacteria 3578
33 Ga0070705_100072435 3300005440 Bacteria 2087
34 Ga0070700_100015788 3300005441 Bacteria 4289
35 Ga0070694_100134175 3300005444 Bacteria 1792
36 Ga0070678_100107436 3300005456 Bacteria 2177
37 Ga0070662_100004789 3300005457 Bacteria 8572
38 Ga0070681_10035986 3300005458 Bacteria 4973
39 Ga0070685_10004316 3300005466 Bacteria 7175
40 Ga0070685_10164870 3300005466 Unclassified 1415
41 Ga0070706_100001975 3300005467 Bacteria 21145
42 Ga0070707_100002532 3300005468 Bacteria 17383
43 Ga0070707_100006920 3300005468 Bacteria 10509
44 Ga0070707_100111816 3300005468 Unclassified 2649
45 Ga0070698_100004232 3300005471 Bacteria 15773
46 Ga0070699_100060713 3300005518 Plasmid 3276
47 Ga0070684_100096414 3300005535 Bacteria 2636
48 Ga0070697_100005320 3300005536 Bacteria 9890
49 Ga0070697_100030525 3300005536 Unclassified 4330
50 Ga0070697_100134673 3300005536 Bacteria 2074
51 Ga0070672_100003809 3300005543 Bacteria 9820
52 Ga0070686_100014394 3300005544 Bacteria 4561
53 Ga0070696_100051373 3300005546 Bacteria 2867
54 Ga0070665_100250430 3300005548 Bacteria 1772
55 Ga0070704_100016596 3300005549 Bacteria 4657
56 Ga0070704_100044918 3300005549 Unclassified 3073
57 Ga0068857_100113051 3300005577 Unclassified 2441
58 Ga0068856_100000770 3300005614 Bacteria 34817
59 Ga0068856_100022417 3300005614 Bacteria 6140
60 Ga0068856_100122709 3300005614 Bacteria 2600
61 Ga0068856_100391042 3300005614 Bacteria 1410
62 Ga0068859_100062255 3300005617 Unclassified 3761
63 Ga0068859_100242177 3300005617 Bacteria 1893
64 Ga0068864_100067767 3300005618 Bacteria 3100
65 Ga0068866_10014942 3300005718 Bacteria 3439
66 Ga0070717_10011950 3300006028 Bacteria 6608
67 Ga0070717_10054430 3300006028 Bacteria 3300
68 Ga0070715_10009500 3300006163 Bacteria 3431
69 Ga0070716_100000376 3300006173 Bacteria 18255
70 Ga0097620_100062255 3300006931 Unclassified 3761
71 Ga0097620_100242169 3300006931 Bacteria 1893
72 Ga0099795_10025709 3300007788 Unclassified 1977
73 Ga0105240_10000007 3300009093 Bacteria 619357
74 Ga0105240_10041616 3300009093 Bacteria 5863
75 Ga0105240_10100053 3300009093 Unclassified 3528
76 Ga0111539_10048108 3300009094 Bacteria 5093
77 Ga0111539_10429775 3300009094 Unclassified 1538
78 Ga0105245_10044336 3300009098 Bacteria 3969
79 Ga0114129_10653186 3300009147 Bacteria 1357
80 Ga0105242_10127980 3300009176 Bacteria 2188
81 Ga0105238_10007987 3300009551 Bacteria 10586
82 Ga0105239_10231755 3300010375 Bacteria 2072
83 Ga0157370_10017323 3300013104 Bacteria 7272
84 Ga0157374_10013311 3300013296 Bacteria 7178
85 Ga0163162_10010460 3300013306 Bacteria 9020
86 Ga0157372_10424023 3300013307 Bacteria 1550
87 Ga0157375_10001237 3300013308 Bacteria 22079
88 Ga0157375_10068062 3300013308 Bacteria 3561
89 Ga0163163_10113512 3300014325 Bacteria 2740
90 Ga0157377_10008171 3300014745 Bacteria 5090
91 Ga0157376_10008174 3300014969 Bacteria 7528
92 Ga0163161_10001138 3300017792 Bacteria 20005
93 Ga0213876_10025034 3300021384 Bacteria 3150
94 Ga0207697_10000196 3300025315 Bacteria 32121
95 Ga0207688_10066556 3300025901 Bacteria 2038
96 Ga0207645_10000461 3300025907 Bacteria 33685
97 Ga0207684_10003458 3300025910 Bacteria 15402
98 Ga0207695_10000061 3300025913 Bacteria 359827
99 Ga0207695_10003898 3300025913 Bacteria 20640
100 Ga0207693_10002016 3300025915 Bacteria 17828
101 Ga0207663_10049032 3300025916 Bacteria 2617
102 Ga0207694_10004858 3300025924 Bacteria 10435
103 Ga0207694_10050239 3300025924 Unclassified 3229
104 Ga0207659_10720927 3300025926 Bacteria 854
105 Ga0207687_10145788 3300025927 Bacteria 1801
106 Ga0207664_10019930 3300025929 Unclassified 4965
107 Ga0207664_10036297 3300025929 Bacteria 3809
108 Ga0207644_10004188 3300025931 Bacteria 9359
109 Ga0207706_10061780 3300025933 Bacteria 3299
110 Ga0207670_10020935 3300025936 Bacteria 4026
111 Ga0207670_10252848 3300025936 Bacteria 1363
112 Ga0207669_10032748 3300025937 Bacteria 2923
113 Ga0207704_10185569 3300025938 Bacteria 1507
114 Ga0207665_10004455 3300025939 Bacteria 9299
115 Ga0207658_10258331 3300025986 Bacteria 1483
116 Ga0207677_10028360 3300026023 Bacteria 3539
117 Ga0207677_10036464 3300026023 Bacteria 3205
118 Ga0207703_10031971 3300026035 Bacteria 4163
119 Ga0207703_10062540 3300026035 Unclassified 3049
120 Ga0207708_10001165 3300026075 Bacteria 19807
121 Ga0207702_10000155 3300026078 Bacteria 80813
122 Ga0207702_10009798 3300026078 Bacteria 8036
123 Ga0207702_10224829 3300026078 Bacteria 1751
124 Ga0207641_10436637 3300026088 Bacteria 1263
125 Ga0207674_10381781 3300026116 Bacteria 1362
126 Ga0207683_10002988 3300026121 Bacteria 14764
127 Ga0265337_1000525 3300028556 Bacteria 20349
128 Ga0265337_1001860 3300028556 Bacteria 10075
129 Ga0265337_1005689 3300028556 Bacteria 4908
130 Ga0265326_10003311 3300028558 Bacteria 5311
131 Ga0265319_1007652 3300028563 Bacteria 4824
132 Ga0265319_1008392 3300028563 Bacteria 4534
133 Ga0265319_1009160 3300028563 Bacteria 4245
134 Ga0265319_1011710 3300028563 Bacteria 3573
135 Ga0265334_10029836 3300028573 Bacteria 2185
136 Ga0265323_10000242 3300028653 Bacteria 32174
137 Ga0265323_10002049 3300028653 Bacteria 9461
138 Ga0265323_10003137 3300028653 Bacteria 7361
139 Ga0265323_10003370 3300028653 Bacteria 7075
140 Ga0265323_10006094 3300028653 Bacteria 5089
141 Ga0265323_10026918 3300028653 Bacteria 2164
142 Ga0265323_10031583 3300028653 Bacteria 1968
143 Ga0265323_10035593 3300028653 Bacteria 1835
144 Ga0265322_10000832 3300028654 Bacteria 11021
145 Ga0265322_10002144 3300028654 Bacteria 6157
146 Ga0265336_10001669 3300028666 Bacteria 9814
147 Ga0265338_10000101 3300028800 Bacteria 159323
148 Ga0265338_10000184 3300028800 Bacteria 116834
149 Ga0265338_10000200 3300028800 Bacteria 113123
150 Ga0265338_10000263 3300028800 Bacteria 95638
151 Ga0265338_10000528 3300028800 Bacteria 67191
152 Ga0265338_10001285 3300028800 Bacteria 41182
153 Ga0265338_10002137 3300028800 Bacteria 30371
154 Ga0265338_10014737 3300028800 Bacteria 8660
155 Ga0265338_10079036 3300028800 Bacteria 2770
156 Ga0265338_10117077 3300028800 Bacteria 2133
157 Ga0265338_10133494 3300028800 Bacteria 1956
158 Ga0265338_10149068 3300028800 Bacteria 1820
159 Ga0265338_10169762 3300028800 Bacteria 1675
160 Ga0265324_10000886 3300029957 Bacteria 19060
161 Ga0265324_10001354 3300029957 Bacteria 14300
162 Ga0265324_10010587 3300029957 Bacteria 3548
163 Ga0265330_10006928 3300031235 Bacteria 5568
164 Ga0265330_10024434 3300031235 Bacteria 2741
165 Ga0265330_10110491 3300031235 Bacteria 1174
166 Ga0265332_10089047 3300031238 Bacteria 1306
167 Ga0265320_10000259 3300031240 Bacteria 43696
168 Ga0265320_10000389 3300031240 Bacteria 35533
169 Ga0265320_10022299 3300031240 Unclassified 3389
170 Ga0265320_10027187 3300031240 Bacteria 2986
171 Ga0265325_10013474 3300031241 Bacteria 4654
172 Ga0265325_10079699 3300031241 Bacteria 1629
173 Ga0265340_10000287 3300031247 Bacteria 26530
174 Ga0265340_10018685 3300031247 Bacteria 3574
175 Ga0265339_10010650 3300031249 Bacteria 5699
176 Ga0265327_10009235 3300031251 Bacteria 7149
177 Ga0265327_10032971 3300031251 Bacteria 2894
178 Ga0265327_10053865 3300031251 Bacteria 2085
179 Ga0265316_10003170 3300031344 Bacteria 16723
180 Ga0265316_10011756 3300031344 Bacteria 7874
181 Ga0265316_10038345 3300031344 Unclassified 3861
182 Ga0265316_10077680 3300031344 Bacteria 2549
183 Ga0265316_10125140 3300031344 Bacteria 1939
184 Ga0265316_10130680 3300031344 Bacteria 1891
185 Ga0265316_10379800 3300031344 Bacteria 1019
186 Ga0265313_10003260 3300031595 Bacteria 13336
187 Ga0265313_10003373 3300031595 Bacteria 13001
188 Ga0265314_10175883 3300031711 Bacteria 1287
189 Ga0265342_10039258 3300031712 Bacteria 2878
190 Ga0265342_10092878 3300031712 Unclassified 1728
191 Ga0265342_10095679 3300031712 Bacteria 1697
192 Ga0265342_10122126 3300031712 Bacteria 1466
193 Ga0307409_100408032 3300031995 Bacteria 1300
194 Ga0373928_0000707 3300035084 Bacteria 6543
195 Ga0373944_0000208 3300035089 Bacteria 12635
196 Ga0373949_0012152 3300035090 Unclassified 1901
197 Ga0373951_0002541 3300035091 Bacteria 4586
198 Ga0373932_0000008 3300035112 Bacteria 167879
199 Ga0373945_0062024 3300035116 Unclassified 1397
200 Ga0373931_0000011 3300035691 Bacteria 304643
201 Ga0373935_0074126 3300035692 Unclassified 2200
202 Ga0373927_0020751 3300035695 Bacteria 4307
203 Ga0373927_0164882 3300035695 Unclassified 1452
204 Ga0373925_0003657 3300037068 Bacteria 11837
205 Ga0395899_0000032 3300037312 Bacteria 312705
206 Ga0436364_1200300 3300037853 Unclassified 3111
207 Ga0436365_0352376 3300039437 Unclassified 1109
208 Ga0436360_0342185 3300039438 Unclassified 3698
209 Ga0451577_0005583 3300042876 Bacteria 12808
210 Ga0451577_0016812 3300042876 Bacteria 6766
211 Ga0451577_0342569 3300042876 Bacteria 1356
212 Ga0466969_0012209 3300044656 Unclassified 4539
213 Ga0453683_0000298 3300044673 Bacteria 63091
214 Ga0453684_0002857 3300044712 Bacteria 40610
215 Ga0453684_0010442 3300044712 Bacteria 15882
216 Ga0453684_0079512 3300044712 Bacteria 4099
217 Ga0453684_0336347 3300044712 Unclassified 1706
218 Ga0451576_0000441 3300045051 Bacteria 94687
219 Ga0451576_0067130 3300045051 Unclassified 3733
220 Ga0451576_0160503 3300045051 Bacteria 2346
221 Ga0466958_0095956 3300045836 Bacteria 1839
222 Ga0495630_0011330 3300046517 Bacteria 6452
223 Ga0495652_0198241 3300046529 Unclassified 1526
224 Ga0495658_0088900 3300046683 Bacteria 1826
225 Ga0496101_0016114 3300048904 Bacteria 5046
226 Ga0496104_0037409 3300048907 Bacteria 4539
227 Ga0496105_0140757 3300048908 Bacteria 1986
228 Ga0496106_0043534 3300048909 Bacteria 3368
229 Ga0496107_0008031 3300048910 Bacteria 7286
230 Ga0496108_0078394 3300048911 Bacteria 2796
231 Ga0496110_0214531 3300048913 Bacteria 1750
232 Ga0496111_0148090 3300048914 Bacteria 1741
233 Ga0496112_0042832 3300048915 Bacteria 4430
234 Ga0496112_0150754 3300048915 Bacteria 2292
235 Ga0496115_0024721 3300048918 Bacteria 4671
236 Ga0496115_0102965 3300048918 Unclassified 2341
237 Ga0496119_0001857 3300048922 Bacteria 24381
238 Ga0501033_0211680 3300049570 Unclassified 1382
239 Ga0501046_0002376 3300049580 Bacteria 17691
240 Ga0501047_0077979 3300049581 Unclassified 3186
241 Ga0501047_0128024 3300049581 Bacteria 2419
242 Ga0500568_0009994 3300053139 Bacteria 4476

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025926 Ga0207659_10720927 Ga0207659_107209271 273
2 3300035695 Ga0373927_0164882 Ga0373927_0164882_524_1399 290
3 3300005468 Ga0070707_100006920 Ga0070707_1000069201 293
4 3300005438 Ga0070701_10057806 Ga0070701_100578062 296
5 3300039437 Ga0436365_0352376 Ga0436365_0352376_201_1094 296
6 3300037853 Ga0436364_1200300 Ga0436364_1200300_1891_2790 298
7 3300007788 Ga0099795_10025709 Ga0099795_100257092 302
8 3300048914 Ga0496111_0148090 Ga0496111_0148090_692_1612 306
9 3300005338 Ga0068868_100111170 Ga0068868_1001111703 313
10 3300005340 Ga0070689_100431073 Ga0070689_1004310731 313
11 3300005341 Ga0070691_10089833 Ga0070691_100898332 313
12 3300005441 Ga0070700_100015788 Ga0070700_1000157884 313
13 3300005444 Ga0070694_100134175 Ga0070694_1001341751 313
14 3300005456 Ga0070678_100107436 Ga0070678_1001074361 313
15 3300005535 Ga0070684_100096414 Ga0070684_1000964142 313
16 3300005614 Ga0068856_100122709 Ga0068856_1001227093 313
17 3300005618 Ga0068864_100067767 Ga0068864_1000677673 313
18 3300009098 Ga0105245_10044336 Ga0105245_100443364 313
19 3300013308 Ga0157375_10068062 Ga0157375_100680622 313
20 3300014745 Ga0157377_10008171 Ga0157377_100081715 313
21 3300025927 Ga0207687_10145788 Ga0207687_101457882 313
22 3300025933 Ga0207706_10061780 Ga0207706_100617802 313
23 3300026023 Ga0207677_10036464 Ga0207677_100364643 313
24 3300026075 Ga0207708_10001165 Ga0207708_100011659 313
25 3300028800 Ga0265338_10169762 Ga0265338_101697622 313
26 3300048911 Ga0496108_0078394 Ga0496108_0078394_1091_2035 313
27 3300048915 Ga0496112_0150754 Ga0496112_0150754_1065_2009 313
28 3300045836 Ga0466958_0095956 Ga0466958_0095956_506_1465 316
29 3300005435 Ga0070714_100016985 Ga0070714_1000169852 317
30 3300005458 Ga0070681_10035986 Ga0070681_100359863 317
31 3300005468 Ga0070707_100002532 Ga0070707_1000025326 317
32 3300031995 Ga0307409_100408032 Ga0307409_1004080321 317
33 3300044656 Ga0466969_0012209 Ga0466969_0012209_2305_3297 317
34 3300048922 Ga0496119_0001857 Ga0496119_0001857_15839_16813 317
35 3300005337 Ga0070682_100039687 Ga0070682_1000396872 318
36 3300005548 Ga0070665_100250430 Ga0070665_1002504302 318
37 iso_pu_bacteria 2786546517 2787436626 318
38 3300005544 Ga0070686_100014394 Ga0070686_1000143943 320
39 3300039438 Ga0436360_0342185 Ga0436360_0342185_1421_2470 320
40 3300009093 Ga0105240_10000007 Ga0105240_1000000795 321
41 3300025913 Ga0207695_10000061 Ga0207695_10000061187 321
42 3300028653 Ga0265323_10006094 Ga0265323_100060942 321
43 3300028654 Ga0265322_10000832 Ga0265322_100008322 321
44 2162886011 MRS1b_contig_949179 MRS1b_0354.00000590 322
45 2162886012 MBSR1b_contig_1554511 MBSR1b_0278.00006680 322
46 3300000545 CNXas_1002585 CNXas_10025851 322
47 3300003320 rootH2_10015099 rootH2_1001509910 322
48 3300003323 rootH1_10007259 rootH1_1000725936 322
49 3300005290 Ga0065712_10006858 Ga0065712_100068583 322
50 3300005293 Ga0065715_10001501 Ga0065715_1000150112 322
51 3300005330 Ga0070690_100048809 Ga0070690_1000488092 322
52 3300005335 Ga0070666_10001983 Ga0070666_100019833 322
53 3300005338 Ga0068868_100013997 Ga0068868_1000139974 322
54 3300005340 Ga0070689_100004843 Ga0070689_1000048437 322
55 3300005340 Ga0070689_100246406 Ga0070689_1002464061 322
56 3300005347 Ga0070668_100026413 Ga0070668_1000264132 322
57 3300005353 Ga0070669_100001783 Ga0070669_10000178314 322
58 3300005354 Ga0070675_100007834 Ga0070675_1000078344 322
59 3300005355 Ga0070671_100031201 Ga0070671_1000312012 322
60 3300005356 Ga0070674_100002849 Ga0070674_1000028493 322
61 3300005365 Ga0070688_100011009 Ga0070688_1000110094 322
62 3300005367 Ga0070667_100017597 Ga0070667_1000175973 322
63 3300005434 Ga0070709_10001454 Ga0070709_100014545 322
64 3300005435 Ga0070714_100004773 Ga0070714_1000047732 322
65 3300005435 Ga0070714_100024700 Ga0070714_1000247002 322
66 3300005435 Ga0070714_100162427 Ga0070714_1001624272 322
67 3300005436 Ga0070713_100002612 Ga0070713_1000026124 322
68 3300005437 Ga0070710_10001045 Ga0070710_1000104510 322
69 3300005439 Ga0070711_100030335 Ga0070711_1000303352 322
70 3300005440 Ga0070705_100072435 Ga0070705_1000724352 322
71 3300005457 Ga0070662_100004789 Ga0070662_1000047893 322
72 3300005466 Ga0070685_10004316 Ga0070685_100043164 322
73 3300005466 Ga0070685_10164870 Ga0070685_101648702 322
74 3300005467 Ga0070706_100001975 Ga0070706_1000019755 322
75 3300005468 Ga0070707_100111816 Ga0070707_1001118162 322
76 3300005471 Ga0070698_100004232 Ga0070698_10000423210 322
77 3300005518 Ga0070699_100060713 Ga0070699_1000607132 322
78 3300005536 Ga0070697_100005320 Ga0070697_1000053205 322
79 3300005536 Ga0070697_100030525 Ga0070697_1000305255 322
80 3300005536 Ga0070697_100134673 Ga0070697_1001346732 322
81 3300005543 Ga0070672_100003809 Ga0070672_1000038094 322
82 3300005546 Ga0070696_100051373 Ga0070696_1000513732 322
83 3300005549 Ga0070704_100016596 Ga0070704_1000165964 322
84 3300005549 Ga0070704_100044918 Ga0070704_1000449183 322
85 3300005577 Ga0068857_100113051 Ga0068857_1001130511 322
86 3300005614 Ga0068856_100000770 Ga0068856_10000077022 322
87 3300005614 Ga0068856_100022417 Ga0068856_1000224173 322
88 3300005614 Ga0068856_100391042 Ga0068856_1003910422 322
89 3300005617 Ga0068859_100062255 Ga0068859_1000622554 322
90 3300005617 Ga0068859_100242177 Ga0068859_1002421772 322
91 3300005718 Ga0068866_10014942 Ga0068866_100149423 322
92 3300006028 Ga0070717_10011950 Ga0070717_100119504 322
93 3300006028 Ga0070717_10054430 Ga0070717_100544302 322
94 3300006163 Ga0070715_10009500 Ga0070715_100095003 322
95 3300006173 Ga0070716_100000376 Ga0070716_10000037615 322
96 3300006931 Ga0097620_100062255 Ga0097620_1000622554 322
97 3300006931 Ga0097620_100242169 Ga0097620_1002421692 322
98 3300009093 Ga0105240_10041616 Ga0105240_100416164 322
99 3300009093 Ga0105240_10100053 Ga0105240_101000533 322
100 3300009094 Ga0111539_10048108 Ga0111539_100481084 322
101 3300009094 Ga0111539_10429775 Ga0111539_104297751 322
102 3300009147 Ga0114129_10653186 Ga0114129_106531862 322
103 3300009176 Ga0105242_10127980 Ga0105242_101279802 322
104 3300009551 Ga0105238_10007987 Ga0105238_1000798712 322
105 3300010375 Ga0105239_10231755 Ga0105239_102317551 322
106 3300013104 Ga0157370_10017323 Ga0157370_100173236 322
107 3300013296 Ga0157374_10013311 Ga0157374_100133112 322
108 3300013306 Ga0163162_10010460 Ga0163162_100104604 322
109 3300013307 Ga0157372_10424023 Ga0157372_104240231 322
110 3300013308 Ga0157375_10001237 Ga0157375_100012374 322
111 3300014325 Ga0163163_10113512 Ga0163163_101135122 322
112 3300014969 Ga0157376_10008174 Ga0157376_100081743 322
113 3300017792 Ga0163161_10001138 Ga0163161_1000113817 322
114 3300021384 Ga0213876_10025034 Ga0213876_100250343 322
115 3300025315 Ga0207697_10000196 Ga0207697_100001963 322
116 3300025901 Ga0207688_10066556 Ga0207688_100665562 322
117 3300025907 Ga0207645_10000461 Ga0207645_1000046121 322
118 3300025910 Ga0207684_10003458 Ga0207684_100034589 322
119 3300025913 Ga0207695_10003898 Ga0207695_100038989 322
120 3300025915 Ga0207693_10002016 Ga0207693_1000201614 322
121 3300025916 Ga0207663_10049032 Ga0207663_100490322 322
122 3300025924 Ga0207694_10004858 Ga0207694_100048582 322
123 3300025924 Ga0207694_10050239 Ga0207694_100502392 322
124 3300025929 Ga0207664_10019930 Ga0207664_100199305 322
125 3300025929 Ga0207664_10036297 Ga0207664_100362972 322
126 3300025931 Ga0207644_10004188 Ga0207644_100041883 322
127 3300025936 Ga0207670_10020935 Ga0207670_100209351 322
128 3300025936 Ga0207670_10252848 Ga0207670_102528481 322
129 3300025937 Ga0207669_10032748 Ga0207669_100327482 322
130 3300025938 Ga0207704_10185569 Ga0207704_101855692 322
131 3300025939 Ga0207665_10004455 Ga0207665_100044554 322
132 3300025986 Ga0207658_10258331 Ga0207658_102583312 322
133 3300026023 Ga0207677_10028360 Ga0207677_100283602 322
134 3300026035 Ga0207703_10031971 Ga0207703_100319713 322
135 3300026035 Ga0207703_10062540 Ga0207703_100625403 322
136 3300026078 Ga0207702_10000155 Ga0207702_1000015551 322
137 3300026078 Ga0207702_10009798 Ga0207702_100097985 322
138 3300026078 Ga0207702_10224829 Ga0207702_102248292 322
139 3300026088 Ga0207641_10436637 Ga0207641_104366372 322
140 3300026116 Ga0207674_10381781 Ga0207674_103817811 322
141 3300026121 Ga0207683_10002988 Ga0207683_100029882 322
142 3300028556 Ga0265337_1000525 Ga0265337_10005255 322
143 3300028556 Ga0265337_1001860 Ga0265337_10018603 322
144 3300028556 Ga0265337_1005689 Ga0265337_10056893 322
145 3300028558 Ga0265326_10003311 Ga0265326_100033114 322
146 3300028563 Ga0265319_1007652 Ga0265319_10076522 322
147 3300028563 Ga0265319_1008392 Ga0265319_10083922 322
148 3300028563 Ga0265319_1009160 Ga0265319_10091601 322
149 3300028563 Ga0265319_1011710 Ga0265319_10117103 322
150 3300028573 Ga0265334_10029836 Ga0265334_100298362 322
151 3300028653 Ga0265323_10000242 Ga0265323_100002426 322
152 3300028653 Ga0265323_10002049 Ga0265323_100020493 322
153 3300028653 Ga0265323_10003137 Ga0265323_100031375 322
154 3300028653 Ga0265323_10003370 Ga0265323_100033704 322
155 3300028653 Ga0265323_10026918 Ga0265323_100269182 322
156 3300028653 Ga0265323_10031583 Ga0265323_100315831 322
157 3300028653 Ga0265323_10035593 Ga0265323_100355931 322
158 3300028654 Ga0265322_10002144 Ga0265322_100021442 322
159 3300028666 Ga0265336_10001669 Ga0265336_100016697 322
160 3300028800 Ga0265338_10000101 Ga0265338_1000010178 322
161 3300028800 Ga0265338_10000184 Ga0265338_1000018444 322
162 3300028800 Ga0265338_10000200 Ga0265338_1000020051 322
163 3300028800 Ga0265338_10000263 Ga0265338_1000026343 322
164 3300028800 Ga0265338_10000528 Ga0265338_1000052811 322
165 3300028800 Ga0265338_10001285 Ga0265338_1000128515 322
166 3300028800 Ga0265338_10002137 Ga0265338_1000213722 322
167 3300028800 Ga0265338_10014737 Ga0265338_100147373 322
168 3300028800 Ga0265338_10079036 Ga0265338_100790362 322
169 3300028800 Ga0265338_10117077 Ga0265338_101170772 322
170 3300028800 Ga0265338_10133494 Ga0265338_101334942 322
171 3300028800 Ga0265338_10149068 Ga0265338_101490682 322
172 3300029957 Ga0265324_10000886 Ga0265324_1000088610 322
173 3300029957 Ga0265324_10001354 Ga0265324_100013546 322
174 3300029957 Ga0265324_10010587 Ga0265324_100105873 322
175 3300031235 Ga0265330_10006928 Ga0265330_100069284 322
176 3300031235 Ga0265330_10024434 Ga0265330_100244343 322
177 3300031235 Ga0265330_10110491 Ga0265330_101104911 322
178 3300031238 Ga0265332_10089047 Ga0265332_100890471 322
179 3300031240 Ga0265320_10000259 Ga0265320_1000025934 322
180 3300031240 Ga0265320_10000389 Ga0265320_1000038931 322
181 3300031240 Ga0265320_10022299 Ga0265320_100222992 322
182 3300031240 Ga0265320_10027187 Ga0265320_100271872 322
183 3300031241 Ga0265325_10013474 Ga0265325_100134743 322
184 3300031241 Ga0265325_10079699 Ga0265325_100796991 322
185 3300031247 Ga0265340_10000287 Ga0265340_1000028725 322
186 3300031247 Ga0265340_10018685 Ga0265340_100186851 322
187 3300031249 Ga0265339_10010650 Ga0265339_100106504 322
188 3300031251 Ga0265327_10009235 Ga0265327_100092353 322
189 3300031251 Ga0265327_10032971 Ga0265327_100329712 322
190 3300031251 Ga0265327_10053865 Ga0265327_100538652 322
191 3300031344 Ga0265316_10003170 Ga0265316_100031709 322
192 3300031344 Ga0265316_10011756 Ga0265316_100117566 322
193 3300031344 Ga0265316_10038345 Ga0265316_100383453 322
194 3300031344 Ga0265316_10077680 Ga0265316_100776802 322
195 3300031344 Ga0265316_10125140 Ga0265316_101251401 322
196 3300031344 Ga0265316_10130680 Ga0265316_101306802 322
197 3300031344 Ga0265316_10379800 Ga0265316_103798001 322
198 3300031595 Ga0265313_10003260 Ga0265313_100032602 322
199 3300031595 Ga0265313_10003373 Ga0265313_100033734 322
200 3300031711 Ga0265314_10175883 Ga0265314_101758831 322
201 3300031712 Ga0265342_10039258 Ga0265342_100392583 322
202 3300031712 Ga0265342_10092878 Ga0265342_100928782 322
203 3300031712 Ga0265342_10095679 Ga0265342_100956792 322
204 3300031712 Ga0265342_10122126 Ga0265342_101221262 322
205 3300035084 Ga0373928_0000707 Ga0373928_0000707_2414_3388 322
206 3300035089 Ga0373944_0000208 Ga0373944_0000208_4065_5039 322
207 3300035090 Ga0373949_0012152 Ga0373949_0012152_793_1767 322
208 3300035091 Ga0373951_0002541 Ga0373951_0002541_1692_2666 322
209 3300035112 Ga0373932_0000008 Ga0373932_0000008_159311_160285 322
210 3300035116 Ga0373945_0062024 Ga0373945_0062024_191_1165 322
211 3300035691 Ga0373931_0000011 Ga0373931_0000011_294530_295504 322
212 3300035692 Ga0373935_0074126 Ga0373935_0074126_80_1054 322
213 3300035695 Ga0373927_0020751 Ga0373927_0020751_2960_3934 322
214 3300037068 Ga0373925_0003657 Ga0373925_0003657_6429_7403 322
215 3300037312 Ga0395899_0000032 Ga0395899_0000032_147851_148822 322
216 3300042876 Ga0451577_0005583 Ga0451577_0005583_7965_8939 322
217 3300042876 Ga0451577_0016812 Ga0451577_0016812_5510_6484 322
218 3300042876 Ga0451577_0342569 Ga0451577_0342569_29_1006 322
219 3300044673 Ga0453683_0000298 Ga0453683_0000298_14791_15768 322
220 3300044712 Ga0453684_0002857 Ga0453684_0002857_2675_3649 322
221 3300044712 Ga0453684_0010442 Ga0453684_0010442_4408_5379 322
222 3300044712 Ga0453684_0079512 Ga0453684_0079512_605_1582 322
223 3300044712 Ga0453684_0336347 Ga0453684_0336347_686_1660 322
224 3300045051 Ga0451576_0000441 Ga0451576_0000441_48441_49415 322
225 3300045051 Ga0451576_0067130 Ga0451576_0067130_775_1749 322
226 3300045051 Ga0451576_0160503 Ga0451576_0160503_1243_2217 322
227 3300046517 Ga0495630_0011330 Ga0495630_0011330_2689_3663 322
228 3300046529 Ga0495652_0198241 Ga0495652_0198241_480_1454 322
229 3300046683 Ga0495658_0088900 Ga0495658_0088900_593_1570 322
230 3300048904 Ga0496101_0016114 Ga0496101_0016114_3051_4019 322
231 3300048907 Ga0496104_0037409 Ga0496104_0037409_666_1634 322
232 3300048908 Ga0496105_0140757 Ga0496105_0140757_869_1837 322
233 3300048909 Ga0496106_0043534 Ga0496106_0043534_609_1577 322
234 3300048910 Ga0496107_0008031 Ga0496107_0008031_6174_7142 322
235 3300048913 Ga0496110_0214531 Ga0496110_0214531_61_1029 322
236 3300048915 Ga0496112_0042832 Ga0496112_0042832_2854_3822 322
237 3300048918 Ga0496115_0024721 Ga0496115_0024721_3095_4063 322
238 3300048918 Ga0496115_0102965 Ga0496115_0102965_1165_2139 322
239 3300049570 Ga0501033_0211680 Ga0501033_0211680_157_1131 322
240 3300049580 Ga0501046_0002376 Ga0501046_0002376_14448_15419 322
241 3300049581 Ga0501047_0077979 Ga0501047_0077979_1257_2243 322
242 3300049581 Ga0501047_0128024 Ga0501047_0128024_532_1503 322
243 3300053139 Ga0500568_0009994 Ga0500568_0009994_2841_3842 322

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

38

278

0.96

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

39

276

0.84

PF04321

RmlD_sub_bind

RmlD substrate binding domain

35

304

0.82

PF07993

NAD_binding_4

Male sterility protein

88

230

0.81

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

39

343

0.78

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

38

310

0.71

PF13460

NAD_binding_10

NAD(P)H-binding

42

194

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ehe-assembly1.cif.gz_A crystal structure of udp-glucose 4 epimerase (gale-1) from archaeoglobus fulgidus 0.95 3 316
3icp-assembly1.cif.gz_A-2 crystal structure of udp-galactose 4-epimerase 0.9406 1 317
3icp-assembly1.cif.gz_A-2 crystal structure of udp-galactose 4-epimerase 0.9375 1 317
3ehe-assembly1.cif.gz_A crystal structure of udp-glucose 4 epimerase (gale-1) from archaeoglobus fulgidus 0.9374 3 316
3ko8-assembly1.cif.gz_A-2 crystal structure of udp-galactose 4-epimerase 0.9284 1 317
ID Description Score Start End Superfamily
3aw9B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9262 1 243 3.40.50.720
3aw9B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9215 1 243 3.40.50.720
3eheB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9197 3 243 3.40.50.720
af_Q4CM81_8_135_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9167 1 112 3.40.50.720
2c20A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9163 1 243 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A521Y9S2-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.978 1 281
AF-A0A521Y9S2-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9745 1 281
AF-K2FHW8-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.9732 1 196
AF-A0A7C5UV68-F1-model_v4 UDP-glucose 4-epimerase (Galactowaldenase) (UDP-galactose 4-epimerase) 0.9721 1 127
AF-A0A5E4K5E3-F1-model_v4 L-arabinose 1-dehydrogenase (NAD(P)(+)) (EC 1.1.1.376) 0.9715 2 315 GO:0044103

Feature Viewer

pLDDT pTM Quality
90.44 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map