F355672

General Info

Members Datasets Scaffolds Average Seq Length
243 152 486 150

Family's Representative Sequence

Representative Sequence 3300025935|Ga0207709_10784889|Ga0207709_107848892
Length 181
Sequence MSADKPPDIPVFRGGTGRRPGIDLSSNTSLIEATTPTLWTIGYERLPPDALVAELEAAGVERLLDVRYRPQSRRPGMSKTKLGIRLGEHGIAYEHRREFGTPPDIKPLFRSGATRQARDRFRAHVERTAAAGLDALAAELRTGTAPRTALLCLEADPAHCHRRVIAEQLRKRVPELRVVDL

Samples

Sample ID Description Type Environment
1 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
103 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
104 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
105 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
106 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
109 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
114 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
115 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
116 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
117 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
118 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
119 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
120 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
121 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
122 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
123 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
124 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
125 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
126 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
127 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
128 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
129 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
133 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
136 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
137 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
138 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
139 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
140 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
141 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
142 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
149 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
150 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
151 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
152 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0.41
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.29
Rhizosphere 87.24
Stem 0
Stem Tuber 0
Unclassified 4.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207709_10784889 3300025935 Bacteria 768
2 JGI24746J21847_1003222 3300001977 Bacteria 2568
3 Ga0070658_10990247 3300005327 Bacteria 731
4 Ga0070683_100224930 3300005329 Bacteria 1783
5 Ga0070683_100276369 3300005329 Bacteria 1598
6 Ga0070683_101179838 3300005329 Bacteria 736
7 Ga0070690_100197403 3300005330 Bacteria 1398
8 Ga0068869_100459067 3300005334 Bacteria 1057
9 Ga0068869_100484908 3300005334 Bacteria 1030
10 Ga0070666_10475523 3300005335 Bacteria 904
11 Ga0070682_100034439 3300005337 Bacteria 3085
12 Ga0068868_100012933 3300005338 Bacteria 6106
13 Ga0070668_100132375 3300005347 Bacteria 2002
14 Ga0070671_101034621 3300005355 Bacteria 720
15 Ga0070674_100317571 3300005356 Bacteria 1248
16 Ga0070674_101060149 3300005356 Bacteria 714
17 Ga0070673_100950970 3300005364 Bacteria 798
18 Ga0070659_100000247 3300005366 Bacteria 42631
19 Ga0070659_100716031 3300005366 Bacteria 866
20 Ga0070659_100758776 3300005366 Bacteria 842
21 Ga0070714_100000165 3300005435 Bacteria 53705
22 Ga0070714_100003981 3300005435 Bacteria 11107
23 Ga0070714_100817596 3300005435 Bacteria 903
24 Ga0070710_10000035 3300005437 Bacteria 61950
25 Ga0070701_10176115 3300005438 Bacteria 1249
26 Ga0070701_10308444 3300005438 Bacteria 975
27 Ga0070701_10440423 3300005438 Bacteria 834
28 Ga0070705_100270747 3300005440 Bacteria 1203
29 Ga0070700_100489268 3300005441 Bacteria 944
30 Ga0070700_100729152 3300005441 Bacteria 791
31 Ga0070694_101427649 3300005444 Bacteria 584
32 Ga0070678_100060668 3300005456 Bacteria 2785
33 Ga0070678_100391364 3300005456 Bacteria 1205
34 Ga0070678_100908684 3300005456 Unclassified 805
35 Ga0070662_100210998 3300005457 Bacteria 1545
36 Ga0070662_100976885 3300005457 Bacteria 724
37 Ga0068867_100531812 3300005459 Bacteria 1015
38 Ga0070684_100442860 3300005535 Bacteria 1200
39 Ga0070684_100812905 3300005535 Bacteria 874
40 Ga0070684_101507873 3300005535 Bacteria 634
41 Ga0070696_101108949 3300005546 Bacteria 665
42 Ga0070665_100034495 3300005548 Bacteria 5089
43 Ga0070665_100342210 3300005548 Bacteria 1501
44 Ga0070704_100878040 3300005549 Bacteria 805
45 Ga0070704_100972198 3300005549 Bacteria 767
46 Ga0070664_100041894 3300005564 Bacteria 3865
47 Ga0068856_100466138 3300005614 Bacteria 1284
48 Ga0068856_100979405 3300005614 Bacteria 864
49 Ga0070702_100019197 3300005615 Bacteria 3560
50 Ga0070702_100124815 3300005615 Bacteria 1617
51 Ga0070702_100865272 3300005615 Bacteria 705
52 Ga0068852_100311637 3300005616 Bacteria 1526
53 Ga0068859_100017969 3300005617 Bacteria 7106
54 Ga0068859_100660742 3300005617 Bacteria 1137
55 Ga0068864_100511759 3300005618 Bacteria 1156
56 Ga0068866_10140924 3300005718 Bacteria 1384
57 Ga0068866_10380707 3300005718 Bacteria 905
58 Ga0068861_100071082 3300005719 Bacteria 2697
59 Ga0068861_100158835 3300005719 Bacteria 1863
60 Ga0068861_100376919 3300005719 Bacteria 1252
61 Ga0068870_10862196 3300005840 Bacteria 637
62 Ga0068863_100492806 3300005841 Bacteria 1206
63 Ga0068858_100086504 3300005842 Bacteria 2916
64 Ga0068860_101196413 3300005843 Bacteria 780
65 Ga0068860_101841005 3300005843 Bacteria 627
66 Ga0081538_10000540 3300005981 Bacteria 41719
67 Ga0081540_1089648 3300005983 Bacteria 1356
68 Ga0070712_100189270 3300006175 Bacteria 1609
69 Ga0070712_100851283 3300006175 Bacteria 784
70 Ga0075433_11165057 3300006852 Bacteria 669
71 Ga0075429_100308731 3300006880 Bacteria 1385
72 Ga0068865_100023823 3300006881 Bacteria 4012
73 Ga0068865_100210984 3300006881 Bacteria 1513
74 Ga0097620_100017969 3300006931 Bacteria 7106
75 Ga0097620_100660737 3300006931 Bacteria 1137
76 Ga0105240_10056319 3300009093 Bacteria 4920
77 Ga0111539_10249291 3300009094 Bacteria 2067
78 Ga0105245_10004960 3300009098 Bacteria 11699
79 Ga0105245_10073221 3300009098 Bacteria 3114
80 Ga0105247_10113808 3300009101 Bacteria 1745
81 Ga0105247_10513698 3300009101 Unclassified 875
82 Ga0114129_12200401 3300009147 Bacteria 663
83 Ga0105243_10094792 3300009148 Bacteria 2465
84 Ga0105242_10390754 3300009176 Bacteria 1295
85 Ga0105248_10507121 3300009177 Bacteria 1360
86 Ga0105248_11387525 3300009177 Bacteria 795
87 Ga0105249_12304417 3300009553 Unclassified 611
88 Ga0105239_10196210 3300010375 Bacteria 2261
89 Ga0105239_11027885 3300010375 Bacteria 948
90 Ga0105239_11358747 3300010375 Archaea 820
91 Ga0105246_10192199 3300011119 Bacteria 1581
92 Ga0105246_10297535 3300011119 Bacteria 1301
93 Ga0157378_10279217 3300013297 Bacteria 1609
94 Ga0163162_10119877 3300013306 Bacteria 2734
95 Ga0163162_10131334 3300013306 Bacteria 2613
96 Ga0157372_10410679 3300013307 Bacteria 1578
97 Ga0157372_10764257 3300013307 Bacteria 1123
98 Ga0157375_10038048 3300013308 Bacteria 4616
99 Ga0163163_10619917 3300014325 Bacteria 1145
100 Ga0157380_10551270 3300014326 Bacteria 1131
101 Ga0157380_11811513 3300014326 Bacteria 670
102 Ga0182008_10172135 3300014497 Bacteria 1093
103 Ga0182008_10388963 3300014497 Bacteria 747
104 Ga0182008_10562503 3300014497 Bacteria 635
105 Ga0157377_10082100 3300014745 Bacteria 1886
106 Ga0157377_10195224 3300014745 Bacteria 1282
107 Ga0157377_10292702 3300014745 Bacteria 1072
108 Ga0157377_10499947 3300014745 Bacteria 849
109 Ga0157379_10001943 3300014968 Bacteria 17101
110 Ga0157379_10180815 3300014968 Bacteria 1905
111 Ga0206354_10813083 3300020081 Bacteria 907
112 Ga0207692_10000010 3300025898 Bacteria 130517
113 Ga0207642_10026488 3300025899 Bacteria 2361
114 Ga0207710_10075930 3300025900 Bacteria 1549
115 Ga0207688_10000357 3300025901 Bacteria 21322
116 Ga0207705_10666692 3300025909 Bacteria 809
117 Ga0207695_10171922 3300025913 Bacteria 2092
118 Ga0207693_10658148 3300025915 Bacteria 813
119 Ga0207650_10580014 3300025925 Bacteria 942
120 Ga0207687_10037063 3300025927 Bacteria 3325
121 Ga0207687_10259984 3300025927 Bacteria 1384
122 Ga0207664_10000057 3300025929 Bacteria 122177
123 Ga0207664_10000491 3300025929 Bacteria 28190
124 Ga0207664_10271798 3300025929 Bacteria 1485
125 Ga0207644_11152206 3300025931 Bacteria 652
126 Ga0207690_10000039 3300025932 Bacteria 132999
127 Ga0207690_10649324 3300025932 Bacteria 864
128 Ga0207706_10396939 3300025933 Bacteria 1196
129 Ga0207686_10285813 3300025934 Bacteria 1219
130 Ga0207686_10598295 3300025934 Unclassified 868
131 Ga0207709_10476928 3300025935 Bacteria 969
132 Ga0207669_10295181 3300025937 Bacteria 1229
133 Ga0207704_10010171 3300025938 Bacteria 4575
134 Ga0207704_10893669 3300025938 Bacteria 747
135 Ga0207689_10574480 3300025942 Bacteria 948
136 Ga0207689_10709801 3300025942 Bacteria 848
137 Ga0207689_10805508 3300025942 Unclassified 793
138 Ga0207661_10381136 3300025944 Bacteria 1276
139 Ga0207661_10462476 3300025944 Bacteria 1156
140 Ga0207651_10063735 3300025960 Bacteria 2576
141 Ga0207651_10850554 3300025960 Bacteria 811
142 Ga0207668_10127888 3300025972 Bacteria 1935
143 Ga0207668_10518800 3300025972 Bacteria 1028
144 Ga0207640_11410628 3300025981 Bacteria 624
145 Ga0207677_10071483 3300026023 Bacteria 2449
146 Ga0207703_10598123 3300026035 Bacteria 1043
147 Ga0207639_10647968 3300026041 Bacteria 977
148 Ga0207678_10199879 3300026067 Bacteria 1709
149 Ga0207708_10013612 3300026075 Bacteria 6078
150 Ga0207708_10118543 3300026075 Bacteria 2061
151 Ga0207648_10259729 3300026089 Bacteria 1550
152 Ga0207648_11362306 3300026089 Bacteria 667
153 Ga0207676_10762817 3300026095 Bacteria 941
154 Ga0207675_100032824 3300026118 Bacteria 4837
155 Ga0207675_100288028 3300026118 Bacteria 1597
156 Ga0207683_10056305 3300026121 Bacteria 3448
157 Ga0207683_10561313 3300026121 Bacteria 1056
158 Ga0207683_10875627 3300026121 Bacteria 834
159 Ga0207698_10060206 3300026142 Bacteria 2952
160 Ga0207698_10319086 3300026142 Bacteria 1454
161 Ga0207698_10716077 3300026142 Bacteria 997
162 Ga0268266_10953511 3300028379 Bacteria 830
163 Ga0268264_11672210 3300028381 Bacteria 647
164 Ga0307408_100150072 3300031548 Bacteria 1839
165 Ga0307405_10412100 3300031731 Bacteria 1061
166 Ga0307410_10654475 3300031852 Bacteria 882
167 Ga0307410_11489899 3300031852 Bacteria 596
168 Ga0326468_10091820 3300031889 Bacteria 544
169 Ga0307406_10336994 3300031901 Unclassified 1173
170 Ga0307406_10902765 3300031901 Bacteria 752
171 Ga0307409_100074446 3300031995 Bacteria 2714
172 Ga0307409_100393091 3300031995 Bacteria 1322
173 Ga0307416_100045063 3300032002 Bacteria 3470
174 Ga0307416_100263671 3300032002 Bacteria 1686
175 Ga0307416_100670334 3300032002 Bacteria 1124
176 Ga0307416_100978503 3300032002 Bacteria 949
177 Ga0307416_101283579 3300032002 Bacteria 838
178 Ga0307411_10192151 3300032005 Bacteria 1560
179 Ga0307411_11378770 3300032005 Bacteria 645
180 Ga0307415_100089574 3300032126 Bacteria 2223
181 Ga0395900_0757329 3300037418 Bacteria 901
182 Ga0395898_0413806 3300037466 Bacteria 1285
183 Ga0395901_0270656 3300038443 Bacteria 1767
184 Ga0395901_0375967 3300038443 Bacteria 1463
185 Ga0395901_0416828 3300038443 Bacteria 1378
186 Ga0439466_0130834 3300041411 Bacteria 772
187 Ga0439465_0013521 3300041413 Bacteria 2543
188 Ga0451795_0299356 3300041456 Bacteria 804
189 Ga0439431_0022519 3300041997 Bacteria 1519
190 Ga0466961_0837883 3300044693 Bacteria 548
191 Ga0466957_0654880 3300044842 Bacteria 739
192 Ga0466958_0604931 3300045836 Bacteria 713
193 Ga0466967_0075196 3300045976 Bacteria 3036
194 Ga0466967_0150845 3300045976 Bacteria 2172
195 Ga0466967_0220650 3300045976 Unclassified 1801
196 Ga0466967_0335863 3300045976 Bacteria 1460
197 Ga0466967_0496052 3300045976 Bacteria 1198
198 Ga0466967_0865638 3300045976 Bacteria 898
199 Ga0495641_0123897 3300046461 Unclassified 1153
200 Ga0495672_0028326 3300047320 Bacteria 3546
201 Ga0495683_0009270 3300047323 Bacteria 5243
202 Ga0496100_0077060 3300048903 Bacteria 2240
203 Ga0496100_0310675 3300048903 Bacteria 1182
204 Ga0496100_0452259 3300048903 Bacteria 985
205 Ga0496101_0011328 3300048904 Bacteria 5913
206 Ga0496101_0561121 3300048904 Unclassified 903
207 Ga0496102_0026092 3300048905 Bacteria 5208
208 Ga0496102_0052771 3300048905 Bacteria 3706
209 Ga0496105_0122859 3300048908 Bacteria 2141
210 Ga0496106_0543003 3300048909 Bacteria 933
211 Ga0496106_0590716 3300048909 Bacteria 890
212 Ga0496106_1070698 3300048909 Bacteria 632
213 Ga0496107_0000637 3300048910 Bacteria 19758
214 Ga0496107_0202674 3300048910 Bacteria 1475
215 Ga0496108_0001333 3300048911 Bacteria 19395
216 Ga0496108_0080059 3300048911 Bacteria 2767
217 Ga0496108_1217121 3300048911 Bacteria 636
218 Ga0496109_0032952 3300048912 Bacteria 4661
219 Ga0496109_0215644 3300048912 Bacteria 1805
220 Ga0496110_0333123 3300048913 Bacteria 1383
221 Ga0496110_0599231 3300048913 Bacteria 1000
222 Ga0496111_0240039 3300048914 Bacteria 1346
223 Ga0496112_0079866 3300048915 Bacteria 3235
224 Ga0496114_1114080 3300048917 Bacteria 674
225 Ga0496115_0010871 3300048918 Bacteria 6813
226 Ga0496119_0009911 3300048922 Bacteria 8089
227 Ga0496119_0162449 3300048922 Bacteria 1186
228 Ga0496120_0007556 3300048923 Bacteria 8068
229 Ga0496121_0063248 3300048924 Bacteria 3025
230 Ga0496124_0031619 3300048927 Bacteria 4684
231 Ga0496125_0572120 3300048928 Bacteria 622
232 Ga0501032_0565695 3300049569 Bacteria 724
233 Ga0501033_0649652 3300049570 Bacteria 721
234 Ga0501034_0193388 3300049571 Bacteria 1996
235 Ga0501034_0957552 3300049571 Unclassified 741
236 Ga0501036_0290813 3300049572 Bacteria 1367
237 Ga0501043_1178568 3300049579 Bacteria 539
238 Ga0501047_1196506 3300049581 Unclassified 573
239 Ga0501067_0219903 3300049583 Bacteria 1058
240 Ga0501044_0473113 3300049823 Bacteria 1157
241 nmdc:mga08y16_812233_c1 3300050511 Bacteria 927
242 nmdc:mga0rr50_186028_c1 3300050513 Bacteria 1700
243 Ga0466962_0055371 3300061719 Bacteria 1895
244 Ga0207709_10784889
245 JGI24746J21847_1003222
246 Ga0070658_10990247
247 Ga0070683_100224930
248 Ga0070683_100276369
249 Ga0070683_101179838
250 Ga0070690_100197403
251 Ga0068869_100459067
252 Ga0068869_100484908
253 Ga0070666_10475523
254 Ga0070682_100034439
255 Ga0068868_100012933
256 Ga0070668_100132375
257 Ga0070671_101034621
258 Ga0070674_100317571
259 Ga0070674_101060149
260 Ga0070673_100950970
261 Ga0070659_100000247
262 Ga0070659_100716031
263 Ga0070659_100758776
264 Ga0070714_100000165
265 Ga0070714_100003981
266 Ga0070714_100817596
267 Ga0070710_10000035
268 Ga0070701_10176115
269 Ga0070701_10308444
270 Ga0070701_10440423
271 Ga0070705_100270747
272 Ga0070700_100489268
273 Ga0070700_100729152
274 Ga0070694_101427649
275 Ga0070678_100060668
276 Ga0070678_100391364
277 Ga0070678_100908684
278 Ga0070662_100210998
279 Ga0070662_100976885
280 Ga0068867_100531812
281 Ga0070684_100442860
282 Ga0070684_100812905
283 Ga0070684_101507873
284 Ga0070696_101108949
285 Ga0070665_100034495
286 Ga0070665_100342210
287 Ga0070704_100878040
288 Ga0070704_100972198
289 Ga0070664_100041894
290 Ga0068856_100466138
291 Ga0068856_100979405
292 Ga0070702_100019197
293 Ga0070702_100124815
294 Ga0070702_100865272
295 Ga0068852_100311637
296 Ga0068859_100017969
297 Ga0068859_100660742
298 Ga0068864_100511759
299 Ga0068866_10140924
300 Ga0068866_10380707
301 Ga0068861_100071082
302 Ga0068861_100158835
303 Ga0068861_100376919
304 Ga0068870_10862196
305 Ga0068863_100492806
306 Ga0068858_100086504
307 Ga0068860_101196413
308 Ga0068860_101841005
309 Ga0081538_10000540
310 Ga0081540_1089648
311 Ga0070712_100189270
312 Ga0070712_100851283
313 Ga0075433_11165057
314 Ga0075429_100308731
315 Ga0068865_100023823
316 Ga0068865_100210984
317 Ga0097620_100017969
318 Ga0097620_100660737
319 Ga0105240_10056319
320 Ga0111539_10249291
321 Ga0105245_10004960
322 Ga0105245_10073221
323 Ga0105247_10113808
324 Ga0105247_10513698
325 Ga0114129_12200401
326 Ga0105243_10094792
327 Ga0105242_10390754
328 Ga0105248_10507121
329 Ga0105248_11387525
330 Ga0105249_12304417
331 Ga0105239_10196210
332 Ga0105239_11027885
333 Ga0105239_11358747
334 Ga0105246_10192199
335 Ga0105246_10297535
336 Ga0157378_10279217
337 Ga0163162_10119877
338 Ga0163162_10131334
339 Ga0157372_10410679
340 Ga0157372_10764257
341 Ga0157375_10038048
342 Ga0163163_10619917
343 Ga0157380_10551270
344 Ga0157380_11811513
345 Ga0182008_10172135
346 Ga0182008_10388963
347 Ga0182008_10562503
348 Ga0157377_10082100
349 Ga0157377_10195224
350 Ga0157377_10292702
351 Ga0157377_10499947
352 Ga0157379_10001943
353 Ga0157379_10180815
354 Ga0206354_10813083
355 Ga0207692_10000010
356 Ga0207642_10026488
357 Ga0207710_10075930
358 Ga0207688_10000357
359 Ga0207705_10666692
360 Ga0207695_10171922
361 Ga0207693_10658148
362 Ga0207650_10580014
363 Ga0207687_10037063
364 Ga0207687_10259984
365 Ga0207664_10000057
366 Ga0207664_10000491
367 Ga0207664_10271798
368 Ga0207644_11152206
369 Ga0207690_10000039
370 Ga0207690_10649324
371 Ga0207706_10396939
372 Ga0207686_10285813
373 Ga0207686_10598295
374 Ga0207709_10476928
375 Ga0207669_10295181
376 Ga0207704_10010171
377 Ga0207704_10893669
378 Ga0207689_10574480
379 Ga0207689_10709801
380 Ga0207689_10805508
381 Ga0207661_10381136
382 Ga0207661_10462476
383 Ga0207651_10063735
384 Ga0207651_10850554
385 Ga0207668_10127888
386 Ga0207668_10518800
387 Ga0207640_11410628
388 Ga0207677_10071483
389 Ga0207703_10598123
390 Ga0207639_10647968
391 Ga0207678_10199879
392 Ga0207708_10013612
393 Ga0207708_10118543
394 Ga0207648_10259729
395 Ga0207648_11362306
396 Ga0207676_10762817
397 Ga0207675_100032824
398 Ga0207675_100288028
399 Ga0207683_10056305
400 Ga0207683_10561313
401 Ga0207683_10875627
402 Ga0207698_10060206
403 Ga0207698_10319086
404 Ga0207698_10716077
405 Ga0268266_10953511
406 Ga0268264_11672210
407 Ga0307408_100150072
408 Ga0307405_10412100
409 Ga0307410_10654475
410 Ga0307410_11489899
411 Ga0326468_10091820
412 Ga0307406_10336994
413 Ga0307406_10902765
414 Ga0307409_100074446
415 Ga0307409_100393091
416 Ga0307416_100045063
417 Ga0307416_100263671
418 Ga0307416_100670334
419 Ga0307416_100978503
420 Ga0307416_101283579
421 Ga0307411_10192151
422 Ga0307411_11378770
423 Ga0307415_100089574
424 Ga0395900_0757329
425 Ga0395898_0413806
426 Ga0395901_0270656
427 Ga0395901_0375967
428 Ga0395901_0416828
429 Ga0439466_0130834
430 Ga0439465_0013521
431 Ga0451795_0299356
432 Ga0439431_0022519
433 Ga0466961_0837883
434 Ga0466957_0654880
435 Ga0466958_0604931
436 Ga0466967_0075196
437 Ga0466967_0150845
438 Ga0466967_0220650
439 Ga0466967_0335863
440 Ga0466967_0496052
441 Ga0466967_0865638
442 Ga0495641_0123897
443 Ga0495672_0028326
444 Ga0495683_0009270
445 Ga0496100_0077060
446 Ga0496100_0310675
447 Ga0496100_0452259
448 Ga0496101_0011328
449 Ga0496101_0561121
450 Ga0496102_0026092
451 Ga0496102_0052771
452 Ga0496105_0122859
453 Ga0496106_0543003
454 Ga0496106_0590716
455 Ga0496106_1070698
456 Ga0496107_0000637
457 Ga0496107_0202674
458 Ga0496108_0001333
459 Ga0496108_0080059
460 Ga0496108_1217121
461 Ga0496109_0032952
462 Ga0496109_0215644
463 Ga0496110_0333123
464 Ga0496110_0599231
465 Ga0496111_0240039
466 Ga0496112_0079866
467 Ga0496114_1114080
468 Ga0496115_0010871
469 Ga0496119_0009911
470 Ga0496119_0162449
471 Ga0496120_0007556
472 Ga0496121_0063248
473 Ga0496124_0031619
474 Ga0496125_0572120
475 Ga0501032_0565695
476 Ga0501033_0649652
477 Ga0501034_0193388
478 Ga0501034_0957552
479 Ga0501036_0290813
480 Ga0501043_1178568
481 Ga0501047_1196506
482 Ga0501067_0219903
483 Ga0501044_0473113
484 nmdc:mga08y16_812233_c1
485 nmdc:mga0rr50_186028_c1
486 Ga0466962_0055371

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04343

DUF488

Domain of unknown function DUF488

47

169

0.92

PF22751

DUF488-N3a

Active DUF488-N3 subclade

92

173

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gxg-assembly1.cif.gz_A crystal structure of putative phosphatase (duf442) (yp_001181608.1) from shewanella putrefaciens cn-32 at 1.60 a resolution 0.751 17 150
3hh1-assembly3.cif.gz_D the structure of a tetrapyrrole methylase family protein domain from chlorobium tepidum tls 0.7045 14 157
3hh1-assembly3.cif.gz_D the structure of a tetrapyrrole methylase family protein domain from chlorobium tepidum tls 0.6886 14 157
6pr2-assembly1.cif.gz_A r261a/s128a s. typhimurium siroheme synthase 0.6639 15 157
3hh1-assembly1.cif.gz_B the structure of a tetrapyrrole methylase family protein domain from chlorobium tepidum tls 0.6625 15 157
ID Description Score Start End Superfamily
af_Q9VVU7_1_266_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7594 31 75 3.40.50.2300
af_A0A0R0IWM0_102_225_3.40.1010.10 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.6465 9 157 3.40.1010.10
2f46B00 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.6325 13 150 3.90.190.10
af_A0A0R0IWM0_102_225_3.40.1010.10 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.6199 9 157 3.40.1010.10
3vkaA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;FMN-linked oxidoreductases 0.614 14 75 3.20.20.390
ID Description Score Start End GO Terms
AF-A0A5C7Q1E7-F1-model_v4 DUF488 domain-containing protein 0.9558 15 157
AF-A0A7T9F9S6-F1-model_v4 deleted 0.9536 16 157
AF-A0A2W6BUE4-F1-model_v4 DUF488 domain-containing protein 0.9531 14 157
AF-A0A7Z7IS59-F1-model_v4 DUF488 domain-containing protein 0.9525 32 157
AF-A0A4Y8X4G6-F1-model_v4 Uncharacterized protein (DUF488 family) 0.9515 16 147

Map