F355445

General Info

Members Datasets Scaffolds Average Seq Length
243 176 486 116

Family's Representative Sequence

Representative Sequence 3300005844|Ga0068862_101251854|Ga0068862_1012518542
Length 127
Sequence MVLKSHLDEDPTVTDPELYTVAFENDRVRVLEYRDAPGATTHPHRHPDSVMVTLSSFQRRVTAFEHGTVGGRSAEIELTAGQVRWVGAQEHVGENTGTTDTHVFFIELKEPSSGTPVGEAPLGPSAG

Samples

Sample ID Description Type Environment
1 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
119 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
120 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
121 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
122 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
125 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
126 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
127 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
135 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
136 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
137 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
138 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
139 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
140 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
141 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
142 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
143 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
144 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
145 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
146 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
147 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
148 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
154 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
161 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
162 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
163 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
164 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
165 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
166 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
167 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
170 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
171 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
172 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
173 2508501039 Frankia saprophytica CN3 Isolate Nodule
174 2517572101 Frankia sp. DC12 Isolate Nodule
175 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
176 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.88
Metatranscriptomes 2.47
Isolates 1.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.82
Rhizoplane 7.41
Rhizosphere 86.42
Stem 0
Stem Tuber 0
Unclassified 3.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068862_101251854 3300005844 Bacteria 742
2 JGI24751J29686_10061399 3300002459 Bacteria 774
3 Ga0070658_10028020 3300005327 Bacteria 4521
4 Ga0070683_100000999 3300005329 Bacteria 21179
5 Ga0070683_100328328 3300005329 Bacteria 1456
6 Ga0070683_100399630 3300005329 Bacteria 1310
7 Ga0070690_100638835 3300005330 Bacteria 812
8 Ga0070670_100056954 3300005331 Bacteria 3355
9 Ga0070677_10561897 3300005333 Bacteria 627
10 Ga0068869_100165169 3300005334 Bacteria 1726
11 Ga0068869_100340461 3300005334 Bacteria 1220
12 Ga0070666_10277972 3300005335 Bacteria 1190
13 Ga0070680_100242173 3300005336 Bacteria 1524
14 Ga0070682_100007212 3300005337 Bacteria 6265
15 Ga0068868_100110282 3300005338 Bacteria 2235
16 Ga0070660_100022881 3300005339 Bacteria 4627
17 Ga0070689_100313030 3300005340 Bacteria 1309
18 Ga0070689_100394656 3300005340 Bacteria 1168
19 Ga0070661_100453546 3300005344 Bacteria 1020
20 Ga0070692_10455530 3300005345 Bacteria 820
21 Ga0070668_100000451 3300005347 Bacteria 27162
22 Ga0070669_100076182 3300005353 Bacteria 2489
23 Ga0070675_100873862 3300005354 Bacteria 823
24 Ga0070671_100036906 3300005355 Bacteria 4052
25 Ga0070688_100077328 3300005365 Bacteria 2144
26 Ga0070688_100835807 3300005365 Bacteria 722
27 Ga0070659_100004429 3300005366 Bacteria 10031
28 Ga0070659_100019663 3300005366 Bacteria 5122
29 Ga0070667_100008570 3300005367 Bacteria 8474
30 Ga0070667_100265134 3300005367 Bacteria 1539
31 Ga0070667_100410646 3300005367 Bacteria 1233
32 Ga0070709_10036560 3300005434 Unclassified 2993
33 Ga0070714_100243304 3300005435 Bacteria 1661
34 Ga0070705_101457386 3300005440 Bacteria 572
35 Ga0070700_100405471 3300005441 Bacteria 1026
36 Ga0070663_100005342 3300005455 Bacteria 7627
37 Ga0070663_101022745 3300005455 Bacteria 719
38 Ga0070678_100025850 3300005456 Bacteria 3959
39 Ga0070662_100324593 3300005457 Bacteria 1256
40 Ga0070681_10125371 3300005458 Bacteria 2501
41 Ga0070681_10388396 3300005458 Bacteria 1307
42 Ga0070685_10156868 3300005466 Bacteria 1447
43 Ga0070679_100686927 3300005530 Bacteria 966
44 Ga0070679_101092712 3300005530 Bacteria 742
45 Ga0070684_100379121 3300005535 Bacteria 1302
46 Ga0070684_101957301 3300005535 Bacteria 553
47 Ga0070693_100013389 3300005547 Bacteria 4177
48 Ga0070665_100112049 3300005548 Bacteria 2731
49 Ga0070664_100038289 3300005564 Bacteria 4036
50 Ga0070664_100135146 3300005564 Bacteria 2168
51 Ga0070664_100376843 3300005564 Bacteria 1294
52 Ga0068857_100123665 3300005577 Bacteria 2331
53 Ga0068857_100323787 3300005577 Bacteria 1424
54 Ga0068857_100328328 3300005577 Bacteria 1413
55 Ga0070702_100012811 3300005615 Bacteria 4218
56 Ga0068852_100269272 3300005616 Bacteria 1638
57 Ga0068864_100029010 3300005618 Bacteria 4681
58 Ga0068864_100075363 3300005618 Bacteria 2946
59 Ga0068851_10018778 3300005834 Bacteria 3336
60 Ga0068870_10003243 3300005840 Bacteria 6867
61 Ga0068863_100023860 3300005841 Bacteria 5837
62 Ga0068863_100428655 3300005841 Bacteria 1296
63 Ga0068858_100351667 3300005842 Bacteria 1411
64 Ga0068860_100783593 3300005843 Bacteria 966
65 Ga0068862_102467523 3300005844 Unclassified 532
66 Ga0081540_1085178 3300005983 Bacteria 1408
67 Ga0075432_10481524 3300006058 Bacteria 550
68 Ga0097621_100171837 3300006237 Bacteria 1868
69 Ga0075431_100062288 3300006847 Bacteria 3849
70 Ga0075431_100484085 3300006847 Bacteria 1230
71 Ga0075433_10020525 3300006852 Bacteria 5527
72 Ga0075434_100044020 3300006871 Bacteria 4428
73 Ga0075429_100150447 3300006880 Bacteria 2038
74 Ga0068865_102171527 3300006881 Bacteria 505
75 Ga0075436_100024540 3300006914 Bacteria 4144
76 Ga0075435_100046173 3300007076 Bacteria 3493
77 Ga0111539_10047375 3300009094 Bacteria 5137
78 Ga0105245_10116098 3300009098 Bacteria 2496
79 Ga0105245_10530033 3300009098 Bacteria 1197
80 Ga0105247_10031637 3300009101 Bacteria 3212
81 Ga0114129_10375843 3300009147 Bacteria 1878
82 Ga0114129_11839697 3300009147 Bacteria 735
83 Ga0105243_10623617 3300009148 Bacteria 1041
84 Ga0105241_10010477 3300009174 Bacteria 6800
85 Ga0105248_10034078 3300009177 Bacteria 5691
86 Ga0105248_10046588 3300009177 Bacteria 4860
87 Ga0105237_10070447 3300009545 Bacteria 3493
88 Ga0105238_10600429 3300009551 Bacteria 1108
89 Ga0105246_10034954 3300011119 Bacteria 3354
90 Ga0105246_11831729 3300011119 Bacteria 581
91 Ga0157373_10150792 3300013100 Bacteria 1635
92 Ga0157371_10015006 3300013102 Bacteria 5825
93 Ga0157370_10343418 3300013104 Bacteria 1376
94 Ga0157374_10462041 3300013296 Bacteria 1271
95 Ga0157372_10055485 3300013307 Bacteria 4425
96 Ga0157375_13066086 3300013308 Bacteria 558
97 Ga0163163_10077842 3300014325 Bacteria 3312
98 Ga0163163_10240530 3300014325 Bacteria 1860
99 Ga0163163_10240697 3300014325 Bacteria 1859
100 Ga0157380_10340194 3300014326 Bacteria 1399
101 Ga0157380_11059701 3300014326 Bacteria 848
102 Ga0157380_12859379 3300014326 Unclassified 549
103 Ga0182008_10256055 3300014497 Bacteria 904
104 Ga0157377_10203756 3300014745 Bacteria 1257
105 Ga0157379_10001516 3300014968 Bacteria 19122
106 Ga0157379_10513665 3300014968 Bacteria 1111
107 Ga0157376_10432198 3300014969 Bacteria 1280
108 Ga0157376_10524597 3300014969 Unclassified 1168
109 Ga0206352_10823007 3300020078 Bacteria 648
110 Ga0206354_11424434 3300020081 Bacteria 3083
111 Ga0206354_11591926 3300020081 Bacteria 859
112 Ga0206353_10130916 3300020082 Bacteria 1059
113 Ga0206353_11034202 3300020082 Bacteria 1341
114 Ga0154015_1314139 3300020610 Bacteria 1029
115 Ga0207656_10108655 3300025321 Bacteria 1279
116 Ga0207688_10238730 3300025901 Bacteria 1099
117 Ga0207647_10096258 3300025904 Bacteria 1762
118 Ga0207645_10076050 3300025907 Bacteria 2150
119 Ga0207643_10002927 3300025908 Bacteria 9213
120 Ga0207705_10071648 3300025909 Bacteria 2512
121 Ga0207707_10135025 3300025912 Bacteria 2157
122 Ga0207660_10103062 3300025917 Bacteria 2134
123 Ga0207657_10027188 3300025919 Bacteria 5242
124 Ga0207649_10060921 3300025920 Bacteria 2373
125 Ga0207681_10134240 3300025923 Bacteria 1834
126 Ga0207650_10059126 3300025925 Bacteria 2856
127 Ga0207687_10279929 3300025927 Bacteria 1336
128 Ga0207644_10358096 3300025931 Bacteria 1186
129 Ga0207711_10055091 3300025941 Bacteria 3414
130 Ga0207689_10247734 3300025942 Bacteria 1473
131 Ga0207689_10263668 3300025942 Bacteria 1426
132 Ga0207689_10429672 3300025942 Bacteria 1103
133 Ga0207661_10019678 3300025944 Bacteria 5038
134 Ga0207661_10054514 3300025944 Bacteria 3203
135 Ga0207661_10229728 3300025944 Bacteria 1642
136 Ga0207679_10011575 3300025945 Bacteria 5722
137 Ga0207679_11284499 3300025945 Bacteria 672
138 Ga0207679_11465455 3300025945 Bacteria 626
139 Ga0207679_11745505 3300025945 Bacteria 569
140 Ga0207667_10138932 3300025949 Bacteria 2501
141 Ga0207651_10804848 3300025960 Bacteria 833
142 Ga0207668_10000548 3300025972 Bacteria 23608
143 Ga0207668_11818667 3300025972 Unclassified 550
144 Ga0207640_10141544 3300025981 Bacteria 1754
145 Ga0207658_10644544 3300025986 Bacteria 954
146 Ga0207658_11248817 3300025986 Bacteria 679
147 Ga0207658_11712170 3300025986 Bacteria 574
148 Ga0207703_10000036 3300026035 Bacteria 181013
149 Ga0207703_10441955 3300026035 Bacteria 1213
150 Ga0207639_10885067 3300026041 Bacteria 834
151 Ga0207678_10004924 3300026067 Bacteria 11993
152 Ga0207708_10109256 3300026075 Bacteria 2146
153 Ga0207702_10023446 3300026078 Bacteria 5118
154 Ga0207641_10936109 3300026088 Bacteria 861
155 Ga0207676_10054044 3300026095 Bacteria 3146
156 Ga0207674_10046279 3300026116 Bacteria 4468
157 Ga0207674_10358029 3300026116 Bacteria 1411
158 Ga0207683_10020419 3300026121 Bacteria 5666
159 Ga0207428_10395150 3300027907 Bacteria 1013
160 Ga0268266_11608463 3300028379 Bacteria 625
161 Ga0268264_10801634 3300028381 Bacteria 941
162 Ga0268264_12034187 3300028381 Bacteria 583
163 Ga0307515_10013469 3300028794 Bacteria 15280
164 Ga0307513_10020274 3300031456 Bacteria 7886
165 Ga0307509_10372828 3300031507 Unclassified 1143
166 Ga0307408_101660489 3300031548 Bacteria 608
167 Ga0307408_102084804 3300031548 Bacteria 546
168 Ga0307516_10005680 3300031730 Bacteria 14799
169 Ga0307516_10031715 3300031730 Bacteria 5326
170 Ga0307405_10505987 3300031731 Bacteria 969
171 Ga0307405_10523256 3300031731 Bacteria 955
172 Ga0307413_10023551 3300031824 Bacteria 3339
173 Ga0307413_11726578 3300031824 Bacteria 559
174 Ga0307413_11819565 3300031824 Bacteria 545
175 Ga0307410_10077818 3300031852 Bacteria 2320
176 Ga0307410_11170338 3300031852 Bacteria 669
177 Ga0307410_11980131 3300031852 Bacteria 520
178 Ga0307406_10011453 3300031901 Bacteria 5035
179 Ga0307406_10028296 3300031901 Bacteria 3386
180 Ga0307407_10749349 3300031903 Bacteria 739
181 Ga0307412_10513509 3300031911 Bacteria 1000
182 Ga0307409_100023277 3300031995 Bacteria 4289
183 Ga0307409_100295934 3300031995 Bacteria 1503
184 Ga0307416_100386367 3300032002 Bacteria 1432
185 Ga0307416_100671321 3300032002 Bacteria 1123
186 Ga0307416_101049718 3300032002 Bacteria 919
187 Ga0307414_10121661 3300032004 Bacteria 2008
188 Ga0307414_10276180 3300032004 Bacteria 1410
189 Ga0307411_10038821 3300032005 Bacteria 3008
190 Ga0307415_100104197 3300032126 Bacteria 2089
191 Ga0307415_100245519 3300032126 Bacteria 1451
192 Ga0307415_100540067 3300032126 Bacteria 1027
193 Ga0307415_100771666 3300032126 Bacteria 875
194 Ga0316583_10055645 3300032133 Bacteria 1391
195 Ga0307507_10522537 3300033179 Unclassified 633
196 Ga0373951_0000084 3300035091 Bacteria 37175
197 Ga0373932_0234037 3300035112 Bacteria 665
198 Ga0373939_0244510 3300035114 Bacteria 696
199 Ga0373962_0002304 3300035242 Bacteria 4557
200 Ga0439447_073644 3300041407 Unclassified 792
201 Ga0451797_1549497 3300041453 Bacteria 1843
202 Ga0451802_0627331 3300041460 Bacteria 606
203 Ga0451802_1611603 3300041460 Bacteria 1224
204 Ga0451843_0748229 3300041509 Bacteria 921
205 Ga0466965_0748499 3300044683 Bacteria 563
206 Ga0466970_0358536 3300044765 Bacteria 828
207 Ga0466960_0390374 3300044901 Bacteria 800
208 Ga0495594_0104187 3300046499 Bacteria 1597
209 Ga0496101_0528895 3300048904 Bacteria 932
210 Ga0496102_0040897 3300048905 Bacteria 4196
211 Ga0496102_0051418 3300048905 Bacteria 3754
212 Ga0496102_1631601 3300048905 Unclassified 563
213 Ga0496104_0031987 3300048907 Bacteria 4895
214 Ga0496105_0011818 3300048908 Bacteria 6915
215 Ga0496106_0622401 3300048909 Bacteria 864
216 Ga0496106_1077866 3300048909 Bacteria 630
217 Ga0496107_0063144 3300048910 Bacteria 2684
218 Ga0496108_0687835 3300048911 Bacteria 887
219 Ga0496109_0065678 3300048912 Bacteria 3321
220 Ga0496110_0070143 3300048913 Bacteria 3104
221 Ga0496111_0032753 3300048914 Bacteria 3706
222 Ga0496112_0626378 3300048915 Bacteria 1006
223 Ga0496114_1265651 3300048917 Bacteria 624
224 Ga0496116_0000224 3300048919 Bacteria 106109
225 Ga0496118_0001326 3300048921 Bacteria 37538
226 Ga0496118_0413070 3300048921 Bacteria 697
227 Ga0496119_0003045 3300048922 Bacteria 17742
228 Ga0496121_0042989 3300048924 Bacteria 3920
229 Ga0501074_0038321 3300049590 Bacteria 3475
230 nmdc:mga05p37_1766842_c1 3300050507 Bacteria 599
231 nmdc:mga05p37_436761_c1 3300050507 Bacteria 1519
232 nmdc:mga09592_207436_c1 3300050508 Bacteria 1697
233 nmdc:mga09592_257629_c1 3300050508 Bacteria 1512
234 nmdc:mga06r32_1330_c3 3300050510 Bacteria 5379
235 nmdc:mga08y16_16862_c1 3300050511 Bacteria 7690
236 nmdc:mga0n895_195687_c1 3300050512 Bacteria 2053
237 nmdc:mga0rr50_46215_c1 3300050513 Bacteria 3205
238 nmdc:mga08x19_548721_c1 3300050514 Bacteria 818
239 nmdc:mga0a205_231261_c1 3300050515 Bacteria 1732
240 2508671793 2508501039 Bacteria 9978592
241 2517759876 2517572101 Bacteria 6884336
242 2935891202 2935890801 Bacteria 4593001
243 3003002410 3002998708 Bacteria 11715108
244 Ga0068862_101251854
245 JGI24751J29686_10061399
246 Ga0070658_10028020
247 Ga0070683_100000999
248 Ga0070683_100328328
249 Ga0070683_100399630
250 Ga0070690_100638835
251 Ga0070670_100056954
252 Ga0070677_10561897
253 Ga0068869_100165169
254 Ga0068869_100340461
255 Ga0070666_10277972
256 Ga0070680_100242173
257 Ga0070682_100007212
258 Ga0068868_100110282
259 Ga0070660_100022881
260 Ga0070689_100313030
261 Ga0070689_100394656
262 Ga0070661_100453546
263 Ga0070692_10455530
264 Ga0070668_100000451
265 Ga0070669_100076182
266 Ga0070675_100873862
267 Ga0070671_100036906
268 Ga0070688_100077328
269 Ga0070688_100835807
270 Ga0070659_100004429
271 Ga0070659_100019663
272 Ga0070667_100008570
273 Ga0070667_100265134
274 Ga0070667_100410646
275 Ga0070709_10036560
276 Ga0070714_100243304
277 Ga0070705_101457386
278 Ga0070700_100405471
279 Ga0070663_100005342
280 Ga0070663_101022745
281 Ga0070678_100025850
282 Ga0070662_100324593
283 Ga0070681_10125371
284 Ga0070681_10388396
285 Ga0070685_10156868
286 Ga0070679_100686927
287 Ga0070679_101092712
288 Ga0070684_100379121
289 Ga0070684_101957301
290 Ga0070693_100013389
291 Ga0070665_100112049
292 Ga0070664_100038289
293 Ga0070664_100135146
294 Ga0070664_100376843
295 Ga0068857_100123665
296 Ga0068857_100323787
297 Ga0068857_100328328
298 Ga0070702_100012811
299 Ga0068852_100269272
300 Ga0068864_100029010
301 Ga0068864_100075363
302 Ga0068851_10018778
303 Ga0068870_10003243
304 Ga0068863_100023860
305 Ga0068863_100428655
306 Ga0068858_100351667
307 Ga0068860_100783593
308 Ga0068862_102467523
309 Ga0081540_1085178
310 Ga0075432_10481524
311 Ga0097621_100171837
312 Ga0075431_100062288
313 Ga0075431_100484085
314 Ga0075433_10020525
315 Ga0075434_100044020
316 Ga0075429_100150447
317 Ga0068865_102171527
318 Ga0075436_100024540
319 Ga0075435_100046173
320 Ga0111539_10047375
321 Ga0105245_10116098
322 Ga0105245_10530033
323 Ga0105247_10031637
324 Ga0114129_10375843
325 Ga0114129_11839697
326 Ga0105243_10623617
327 Ga0105241_10010477
328 Ga0105248_10034078
329 Ga0105248_10046588
330 Ga0105237_10070447
331 Ga0105238_10600429
332 Ga0105246_10034954
333 Ga0105246_11831729
334 Ga0157373_10150792
335 Ga0157371_10015006
336 Ga0157370_10343418
337 Ga0157374_10462041
338 Ga0157372_10055485
339 Ga0157375_13066086
340 Ga0163163_10077842
341 Ga0163163_10240530
342 Ga0163163_10240697
343 Ga0157380_10340194
344 Ga0157380_11059701
345 Ga0157380_12859379
346 Ga0182008_10256055
347 Ga0157377_10203756
348 Ga0157379_10001516
349 Ga0157379_10513665
350 Ga0157376_10432198
351 Ga0157376_10524597
352 Ga0206352_10823007
353 Ga0206354_11424434
354 Ga0206354_11591926
355 Ga0206353_10130916
356 Ga0206353_11034202
357 Ga0154015_1314139
358 Ga0207656_10108655
359 Ga0207688_10238730
360 Ga0207647_10096258
361 Ga0207645_10076050
362 Ga0207643_10002927
363 Ga0207705_10071648
364 Ga0207707_10135025
365 Ga0207660_10103062
366 Ga0207657_10027188
367 Ga0207649_10060921
368 Ga0207681_10134240
369 Ga0207650_10059126
370 Ga0207687_10279929
371 Ga0207644_10358096
372 Ga0207711_10055091
373 Ga0207689_10247734
374 Ga0207689_10263668
375 Ga0207689_10429672
376 Ga0207661_10019678
377 Ga0207661_10054514
378 Ga0207661_10229728
379 Ga0207679_10011575
380 Ga0207679_11284499
381 Ga0207679_11465455
382 Ga0207679_11745505
383 Ga0207667_10138932
384 Ga0207651_10804848
385 Ga0207668_10000548
386 Ga0207668_11818667
387 Ga0207640_10141544
388 Ga0207658_10644544
389 Ga0207658_11248817
390 Ga0207658_11712170
391 Ga0207703_10000036
392 Ga0207703_10441955
393 Ga0207639_10885067
394 Ga0207678_10004924
395 Ga0207708_10109256
396 Ga0207702_10023446
397 Ga0207641_10936109
398 Ga0207676_10054044
399 Ga0207674_10046279
400 Ga0207674_10358029
401 Ga0207683_10020419
402 Ga0207428_10395150
403 Ga0268266_11608463
404 Ga0268264_10801634
405 Ga0268264_12034187
406 Ga0307515_10013469
407 Ga0307513_10020274
408 Ga0307509_10372828
409 Ga0307408_101660489
410 Ga0307408_102084804
411 Ga0307516_10005680
412 Ga0307516_10031715
413 Ga0307405_10505987
414 Ga0307405_10523256
415 Ga0307413_10023551
416 Ga0307413_11726578
417 Ga0307413_11819565
418 Ga0307410_10077818
419 Ga0307410_11170338
420 Ga0307410_11980131
421 Ga0307406_10011453
422 Ga0307406_10028296
423 Ga0307407_10749349
424 Ga0307412_10513509
425 Ga0307409_100023277
426 Ga0307409_100295934
427 Ga0307416_100386367
428 Ga0307416_100671321
429 Ga0307416_101049718
430 Ga0307414_10121661
431 Ga0307414_10276180
432 Ga0307411_10038821
433 Ga0307415_100104197
434 Ga0307415_100245519
435 Ga0307415_100540067
436 Ga0307415_100771666
437 Ga0316583_10055645
438 Ga0307507_10522537
439 Ga0373951_0000084
440 Ga0373932_0234037
441 Ga0373939_0244510
442 Ga0373962_0002304
443 Ga0439447_073644
444 Ga0451797_1549497
445 Ga0451802_0627331
446 Ga0451802_1611603
447 Ga0451843_0748229
448 Ga0466965_0748499
449 Ga0466970_0358536
450 Ga0466960_0390374
451 Ga0495594_0104187
452 Ga0496101_0528895
453 Ga0496102_0040897
454 Ga0496102_0051418
455 Ga0496102_1631601
456 Ga0496104_0031987
457 Ga0496105_0011818
458 Ga0496106_0622401
459 Ga0496106_1077866
460 Ga0496107_0063144
461 Ga0496108_0687835
462 Ga0496109_0065678
463 Ga0496110_0070143
464 Ga0496111_0032753
465 Ga0496112_0626378
466 Ga0496114_1265651
467 Ga0496116_0000224
468 Ga0496118_0001326
469 Ga0496118_0413070
470 Ga0496119_0003045
471 Ga0496121_0042989
472 Ga0501074_0038321
473 nmdc:mga05p37_1766842_c1
474 nmdc:mga05p37_436761_c1
475 nmdc:mga09592_207436_c1
476 nmdc:mga09592_257629_c1
477 nmdc:mga06r32_1330_c3
478 nmdc:mga08y16_16862_c1
479 nmdc:mga0n895_195687_c1
480 nmdc:mga0rr50_46215_c1
481 nmdc:mga08x19_548721_c1
482 nmdc:mga0a205_231261_c1
483 2508671793
484 2517759876
485 2935891202
486 3003002410

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fqp-assembly2.cif.gz_C crystal structure of a cupin domain (bp2299) from bordetella pertussis tohama i at 1.80 a resolution 0.9204 13 99
3lag-assembly1.cif.gz_A the crystal structure of a functionally unknown protein rpa4178 from rhodopseudomonas palustris cga009 0.9139 14 99
2fqp-assembly2.cif.gz_C crystal structure of a cupin domain (bp2299) from bordetella pertussis tohama i at 1.80 a resolution 0.8308 13 99
3lag-assembly1.cif.gz_A the crystal structure of a functionally unknown protein rpa4178 from rhodopseudomonas palustris cga009 0.8174 14 99
1lr5-assembly2.cif.gz_B crystal structure of auxin binding protein 0.7825 14 100
ID Description Score Start End Superfamily
2oziB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8799 14 99 2.60.120.10
2oziB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8115 14 99 2.60.120.10
3h8uB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7654 13 97 2.60.120.10
af_O43014_313_412_2.60.110.10 Mainly Beta;Sandwich;Thaumatin;Thaumatin 0.745 16 99 2.60.110.10
af_P77626_84_178_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7446 13 101 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A1E4I7L8-F1-model_v4 Cytoplasmic protein 0.994 2 98
AF-A0A163SH20-F1-model_v4 Cupin domain protein 0.9922 1 99
AF-A0A2E9LP31-F1-model_v4 Cytoplasmic protein 0.991 5 98
AF-A0A2V9LWX0-F1-model_v4 Cytoplasmic protein 0.9876 5 99
AF-A0A345R880-F1-model_v4 Cytoplasmic protein 0.9875 5 99

Map