F355444

General Info

Members Datasets Scaffolds Average Seq Length
243 163 486 188

Family's Representative Sequence

Representative Sequence 3300005844|Ga0068862_100369685|Ga0068862_1003696852
Length 209
Sequence VIKLKKEFIGAYNMPFIQTPISNLLVFEPKIHEDSRGYFFESFNLQTFRAEGIDINFVQDNQSSSKYGVIRGLHYQLNPSAQVKLIRVLSGRILDVVVDIRKGSPTFGKNFSVELTAENKKQLFVPAGLAHGFSVLSEEAEVLYKCDSFYNKDSEAGILYNDPSLNIDWKIPAEKEIVSEKDKGLPLFAECRNNFIWNENKVQNTGNRG

Samples

Sample ID Description Type Environment
1 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
68 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
105 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
106 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
107 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
108 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
109 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
110 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
111 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
112 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
117 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
118 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
119 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
120 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
121 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
122 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
123 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
124 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
125 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
126 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
127 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
128 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
129 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
138 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
139 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
140 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
141 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
142 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
143 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
144 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
145 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
146 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
147 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
148 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
149 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
150 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
151 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
152 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
153 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
154 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
155 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
156 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
157 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
158 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
159 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
160 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
161 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
162 2671180694 Paenibacillus sp. A3 Isolate Unclassified
163 2846952575 Azospirillum brasilense sp7 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.94
Metatranscriptomes 0
Isolates 2.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.35
Nodule 0
Rhizoplane 0.41
Rhizosphere 89.3
Stem 0
Stem Tuber 0
Unclassified 12.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068862_100369685 3300005844 Unclassified 1334
2 JGI24751J29686_10000611 3300002459 Bacteria 9290
3 JGI25406J46586_10004895 3300003203 Bacteria 6222
4 rootH1_10183992 3300003323 Bacteria 1519
5 rootH1_10207743 3300003323 Bacteria 2190
6 Ga0065714_10046969 3300005288 Bacteria 689
7 Ga0065704_10169157 3300005289 Bacteria 1302
8 Ga0065712_10008503 3300005290 Bacteria 3134
9 Ga0065712_10016228 3300005290 Bacteria 2706
10 Ga0065715_10121072 3300005293 Bacteria 2231
11 Ga0065707_10680682 3300005295 Bacteria 649
12 Ga0070690_100052089 3300005330 Bacteria 2615
13 Ga0070670_100061004 3300005331 Bacteria 3238
14 Ga0070670_100076421 3300005331 Bacteria 2877
15 Ga0070670_101031550 3300005331 Bacteria 749
16 Ga0070677_10067032 3300005333 Bacteria 1498
17 Ga0068869_100037896 3300005334 Bacteria 3431
18 Ga0068869_100395470 3300005334 Bacteria 1135
19 Ga0068869_100629815 3300005334 Bacteria 909
20 Ga0070666_10144398 3300005335 Unclassified 1658
21 Ga0070682_100000101 3300005337 Bacteria 76535
22 Ga0070689_100096077 3300005340 Bacteria 2341
23 Ga0070689_100241527 3300005340 Unclassified 1487
24 Ga0070687_100058529 3300005343 Bacteria 2025
25 Ga0070687_100208283 3300005343 Unclassified 1189
26 Ga0070669_100046405 3300005353 Bacteria 3168
27 Ga0070669_100047502 3300005353 Bacteria 3131
28 Ga0070673_100056502 3300005364 Bacteria 3097
29 Ga0070673_100101023 3300005364 Bacteria 2375
30 Ga0070673_100473393 3300005364 Bacteria 1130
31 Ga0070673_100555015 3300005364 Bacteria 1044
32 Ga0070688_100024394 3300005365 Bacteria 3569
33 Ga0070701_10071128 3300005438 Bacteria 1860
34 Ga0070705_100460748 3300005440 Unclassified 956
35 Ga0070694_100201949 3300005444 Bacteria 1482
36 Ga0070678_100970388 3300005456 Unclassified 780
37 Ga0070662_101127327 3300005457 Bacteria 673
38 Ga0068867_100271589 3300005459 Bacteria 1386
39 Ga0070685_10108623 3300005466 Bacteria 1705
40 Ga0070698_100005764 3300005471 Bacteria 13543
41 Ga0070684_100187985 3300005535 Bacteria 1879
42 Ga0068853_100004753 3300005539 Bacteria 10558
43 Ga0070672_100393654 3300005543 Unclassified 1187
44 Ga0070665_100000008 3300005548 Bacteria 606341
45 Ga0070704_100040346 3300005549 Bacteria 3213
46 Ga0070704_101166927 3300005549 Unclassified 701
47 Ga0068857_100178297 3300005577 Bacteria 1933
48 Ga0068857_101530300 3300005577 Unclassified 650
49 Ga0068854_100545884 3300005578 Bacteria 982
50 Ga0068852_100120388 3300005616 Bacteria 2402
51 Ga0068852_101119714 3300005616 Bacteria 808
52 Ga0068859_100121426 3300005617 Bacteria 2679
53 Ga0068859_100786942 3300005617 Bacteria 1039
54 Ga0068864_100048758 3300005618 Bacteria 3642
55 Ga0068864_100466611 3300005618 Unclassified 1210
56 Ga0068861_100005893 3300005719 Bacteria 8329
57 Ga0068861_101140988 3300005719 Unclassified 751
58 Ga0068851_10068773 3300005834 Bacteria 1828
59 Ga0068851_10069741 3300005834 Bacteria 1816
60 Ga0068863_100075894 3300005841 Bacteria 3180
61 Ga0068860_100000029 3300005843 Bacteria 259192
62 Ga0068860_100140603 3300005843 Bacteria 2320
63 Ga0068860_100469955 3300005843 Bacteria 1252
64 Ga0068860_101643004 3300005843 Unclassified 664
65 Ga0068862_100378682 3300005844 Bacteria 1319
66 Ga0075366_10062783 3300006195 Bacteria 2208
67 Ga0075370_10357186 3300006353 Bacteria 873
68 Ga0068871_100232203 3300006358 Bacteria 1601
69 Ga0075428_100052075 3300006844 Bacteria 4488
70 Ga0075430_100593420 3300006846 Bacteria 914
71 Ga0075431_100127863 3300006847 Bacteria 2622
72 Ga0075429_100005315 3300006880 Bacteria 11083
73 Ga0097620_100121425 3300006931 Bacteria 2679
74 Ga0097620_100786776 3300006931 Bacteria 1039
75 Ga0105240_10601699 3300009093 Bacteria 1210
76 Ga0105240_10688331 3300009093 Bacteria 1117
77 Ga0111539_10138953 3300009094 Bacteria 2845
78 Ga0111539_11870700 3300009094 Bacteria 696
79 Ga0105245_10450899 3300009098 Bacteria 1295
80 Ga0105242_10002400 3300009176 Bacteria 14740
81 Ga0105242_10042029 3300009176 Bacteria 3689
82 Ga0105242_10195440 3300009176 Bacteria 1794
83 Ga0105238_10057019 3300009551 Bacteria 3917
84 Ga0105238_10473672 3300009551 Bacteria 1251
85 Ga0105238_10947334 3300009551 Bacteria 880
86 Ga0105238_11565789 3300009551 Unclassified 689
87 Ga0105249_10006698 3300009553 Bacteria 10035
88 Ga0105249_10009044 3300009553 Bacteria 8706
89 Ga0105249_10096659 3300009553 Bacteria 2772
90 Ga0105249_10267973 3300009553 Bacteria 1700
91 Ga0105239_10020869 3300010375 Bacteria 7227
92 Ga0157371_10353280 3300013102 Unclassified 1070
93 Ga0157378_10058147 3300013297 Bacteria 3448
94 Ga0157378_10449663 3300013297 Bacteria 1278
95 Ga0163162_10000423 3300013306 Bacteria 39010
96 Ga0163162_10033676 3300013306 Bacteria 5092
97 Ga0163162_10555607 3300013306 Unclassified 1276
98 Ga0157375_10074137 3300013308 Bacteria 3424
99 Ga0157375_10661752 3300013308 Bacteria 1200
100 Ga0163163_10665790 3300014325 Bacteria 1104
101 Ga0163163_11281391 3300014325 Unclassified 795
102 Ga0157380_10017367 3300014326 Bacteria 5325
103 Ga0157380_10140915 3300014326 Bacteria 2072
104 Ga0157380_10143104 3300014326 Bacteria 2057
105 Ga0157380_11457534 3300014326 Bacteria 736
106 Ga0157377_10002480 3300014745 Bacteria 8165
107 Ga0157376_10174448 3300014969 Bacteria 1960
108 Ga0157376_10415708 3300014969 Unclassified 1304
109 Ga0157376_11598344 3300014969 Bacteria 686
110 Ga0163161_10053027 3300017792 Bacteria 2940
111 Ga0213876_10277220 3300021384 Bacteria 891
112 Ga0207697_10026089 3300025315 Unclassified 2390
113 Ga0207682_10018849 3300025893 Bacteria 2699
114 Ga0207680_10239526 3300025903 Unclassified 1250
115 Ga0207647_10055707 3300025904 Bacteria 2429
116 Ga0207645_10145618 3300025907 Bacteria 1544
117 Ga0207645_10368515 3300025907 Bacteria 963
118 Ga0207643_10048898 3300025908 Bacteria 2396
119 Ga0207695_10028280 3300025913 Bacteria 6223
120 Ga0207695_10782046 3300025913 Bacteria 834
121 Ga0207671_10049931 3300025914 Bacteria 3098
122 Ga0207662_10062043 3300025918 Bacteria 2245
123 Ga0207681_10389604 3300025923 Unclassified 1123
124 Ga0207681_10846643 3300025923 Unclassified 765
125 Ga0207694_10117417 3300025924 Bacteria 2121
126 Ga0207650_10059065 3300025925 Bacteria 2857
127 Ga0207650_10208464 3300025925 Unclassified 1569
128 Ga0207650_10359157 3300025925 Bacteria 1200
129 Ga0207650_10599027 3300025925 Bacteria 927
130 Ga0207706_10288335 3300025933 Unclassified 1431
131 Ga0207686_10000715 3300025934 Bacteria 20597
132 Ga0207686_10078304 3300025934 Bacteria 2149
133 Ga0207686_10109900 3300025934 Bacteria 1857
134 Ga0207670_10009038 3300025936 Bacteria 5657
135 Ga0207691_10009967 3300025940 Bacteria 9126
136 Ga0207689_10035121 3300025942 Bacteria 4164
137 Ga0207689_10047854 3300025942 Bacteria 3528
138 Ga0207651_10014803 3300025960 Bacteria 4515
139 Ga0207651_10036157 3300025960 Bacteria 3221
140 Ga0207651_10371331 3300025960 Unclassified 1210
141 Ga0207712_10001188 3300025961 Bacteria 17998
142 Ga0207712_10002851 3300025961 Bacteria 11074
143 Ga0207712_10014921 3300025961 Bacteria 5003
144 Ga0207712_10053260 3300025961 Bacteria 2838
145 Ga0207640_10209040 3300025981 Unclassified 1485
146 Ga0207640_10475415 3300025981 Bacteria 1035
147 Ga0207658_10169377 3300025986 Bacteria 1798
148 Ga0207658_10272238 3300025986 Unclassified 1448
149 Ga0207703_10633839 3300026035 Bacteria 1013
150 Ga0207639_10002436 3300026041 Bacteria 12511
151 Ga0207639_10024079 3300026041 Bacteria 4402
152 Ga0207639_10318891 3300026041 Bacteria 1379
153 Ga0207639_10480289 3300026041 Bacteria 1132
154 Ga0207708_10183476 3300026075 Unclassified 1662
155 Ga0207702_10606842 3300026078 Unclassified 1074
156 Ga0207641_10000213 3300026088 Bacteria 75051
157 Ga0207641_10018145 3300026088 Bacteria 5766
158 Ga0207648_10069357 3300026089 Bacteria 3072
159 Ga0207648_10193421 3300026089 Bacteria 1804
160 Ga0207676_10016401 3300026095 Bacteria 5364
161 Ga0207674_10063414 3300026116 Bacteria 3730
162 Ga0207674_10378502 3300026116 Bacteria 1368
163 Ga0207675_100011637 3300026118 Bacteria 8227
164 Ga0207683_10149149 3300026121 Bacteria 2110
165 Ga0207698_10846645 3300026142 Bacteria 919
166 Ga0207428_10198410 3300027907 Bacteria 1510
167 Ga0268266_10000016 3300028379 Bacteria 629101
168 Ga0268265_10114481 3300028380 Bacteria 2209
169 Ga0268265_10244984 3300028380 Bacteria 1584
170 Ga0268264_10000072 3300028381 Bacteria 260791
171 Ga0268264_10007515 3300028381 Bacteria 9093
172 Ga0268264_10149431 3300028381 Bacteria 2093
173 Ga0268264_10927185 3300028381 Bacteria 875
174 Ga0268264_10979609 3300028381 Bacteria 851
175 Ga0307517_10000697 3300028786 Bacteria 57970
176 Ga0307513_10485743 3300031456 Bacteria 954
177 Ga0307509_10174317 3300031507 Bacteria 2025
178 Ga0316576_10004720 3300031727 Bacteria 8223
179 Ga0316576_10009509 3300031727 Bacteria 6278
180 Ga0316578_10043047 3300031728 Bacteria 2621
181 Ga0316577_10147464 3300031733 Bacteria 1326
182 Ga0307412_10094073 3300031911 Bacteria 2104
183 Ga0316574_0085022 3300035398 Bacteria 2013
184 Ga0316584_0002337 3300036712 Bacteria 11957
185 Ga0395905_0129711 3300037471 Bacteria 2371
186 Ga0400483_152004 3300039062 Bacteria 1590
187 Ga0436365_1534476 3300039437 Bacteria 874
188 Ga0451843_1169828 3300041509 Bacteria 790
189 Ga0439441_059679 3300042001 Bacteria 801
190 Ga0451577_0302238 3300042876 Bacteria 1450
191 Ga0453683_0354325 3300044673 Unclassified 943
192 Ga0453684_0096188 3300044712 Bacteria 3639
193 Ga0453684_0709378 3300044712 Bacteria 1092
194 Ga0495648_0003626 3300046524 Bacteria 13516
195 Ga0495598_0087575 3300046537 Bacteria 1010
196 Ga0495621_0034432 3300046539 Bacteria 1750
197 Ga0495621_0225660 3300046539 Bacteria 759
198 Ga0495625_0214841 3300046660 Bacteria 1263
199 Ga0495672_0048991 3300047320 Bacteria 2503
200 Ga0495687_000004 3300047443 Bacteria 779298
201 Ga0495686_0178108 3300047472 Unclassified 1233
202 Ga0496109_0267242 3300048912 Bacteria 1611
203 Ga0501032_0044738 3300049569 Bacteria 2996
204 Ga0501034_0076899 3300049571 Bacteria 3344
205 Ga0501034_0889789 3300049571 Bacteria 779
206 Ga0501037_0019761 3300049573 Bacteria 4971
207 Ga0501038_0005909 3300049574 Bacteria 11311
208 Ga0501039_0125305 3300049575 Bacteria 2015
209 Ga0501043_0062294 3300049579 Bacteria 2928
210 Ga0501046_0019608 3300049580 Bacteria 5607
211 Ga0501047_0005143 3300049581 Bacteria 12276
212 Ga0501067_0048077 3300049583 Bacteria 2366
213 Ga0501068_0038333 3300049584 Bacteria 2871
214 Ga0501073_0002414 3300049589 Bacteria 13987
215 Ga0501074_0064741 3300049590 Bacteria 2632
216 Ga0501079_0680110 3300049741 Bacteria 810
217 Ga0501080_0000609 3300049742 Bacteria 28337
218 Ga0501080_0607253 3300049742 Bacteria 971
219 Ga0501083_0113275 3300049744 Bacteria 1782
220 Ga0501035_0303252 3300049822 Bacteria 1345
221 nmdc:mga0k408_110218_c1 3300050493 Bacteria 1627
222 nmdc:mga0k408_282503_c1 3300050493 Bacteria 991
223 nmdc:mga0k408_97056_c1 3300050493 Bacteria 1735
224 nmdc:mga05p37_3553_c1 3300050507 Bacteria 18203
225 nmdc:mga0qj67_754498_c1 3300050509 Bacteria 772
226 nmdc:mga06r32_1452231_c1 3300050510 Bacteria 627
227 nmdc:mga08y16_168790_c1 3300050511 Bacteria 2273
228 nmdc:mga0a205_306218_c1 3300050515 Bacteria 1461
229 nmdc:mga0a205_752285_c1 3300050515 Unclassified 823
230 Ga0500583_0000120 3300053092 Bacteria 37819
231 Ga0500583_0000866 3300053092 Bacteria 8739
232 Ga0500618_116878 3300053125 Bacteria 603
233 Ga0500561_0172913 3300053137 Bacteria 678
234 Ga0500568_0000609 3300053139 Bacteria 25906
235 Ga0500622_0002131 3300053156 Bacteria 14740
236 Ga0500639_236193 3300053163 Bacteria 747
237 Ga0500611_120228 3300053727 Bacteria 699
238 Ga0501082_0010004 3300060353 Bacteria 8178
239 2556063744 2554235469 Bacteria 3590176
240 2563930271 2563366752 Bacteria 4961801
241 2599102538 2597490356 Bacteria 7030811
242 2673818020 2671180694 Bacteria 7506943
243 2846958563 2846952575 Bacteria 6587527
244 Ga0068862_100369685
245 JGI24751J29686_10000611
246 JGI25406J46586_10004895
247 rootH1_10183992
248 rootH1_10207743
249 Ga0065714_10046969
250 Ga0065704_10169157
251 Ga0065712_10008503
252 Ga0065712_10016228
253 Ga0065715_10121072
254 Ga0065707_10680682
255 Ga0070690_100052089
256 Ga0070670_100061004
257 Ga0070670_100076421
258 Ga0070670_101031550
259 Ga0070677_10067032
260 Ga0068869_100037896
261 Ga0068869_100395470
262 Ga0068869_100629815
263 Ga0070666_10144398
264 Ga0070682_100000101
265 Ga0070689_100096077
266 Ga0070689_100241527
267 Ga0070687_100058529
268 Ga0070687_100208283
269 Ga0070669_100046405
270 Ga0070669_100047502
271 Ga0070673_100056502
272 Ga0070673_100101023
273 Ga0070673_100473393
274 Ga0070673_100555015
275 Ga0070688_100024394
276 Ga0070701_10071128
277 Ga0070705_100460748
278 Ga0070694_100201949
279 Ga0070678_100970388
280 Ga0070662_101127327
281 Ga0068867_100271589
282 Ga0070685_10108623
283 Ga0070698_100005764
284 Ga0070684_100187985
285 Ga0068853_100004753
286 Ga0070672_100393654
287 Ga0070665_100000008
288 Ga0070704_100040346
289 Ga0070704_101166927
290 Ga0068857_100178297
291 Ga0068857_101530300
292 Ga0068854_100545884
293 Ga0068852_100120388
294 Ga0068852_101119714
295 Ga0068859_100121426
296 Ga0068859_100786942
297 Ga0068864_100048758
298 Ga0068864_100466611
299 Ga0068861_100005893
300 Ga0068861_101140988
301 Ga0068851_10068773
302 Ga0068851_10069741
303 Ga0068863_100075894
304 Ga0068860_100000029
305 Ga0068860_100140603
306 Ga0068860_100469955
307 Ga0068860_101643004
308 Ga0068862_100378682
309 Ga0075366_10062783
310 Ga0075370_10357186
311 Ga0068871_100232203
312 Ga0075428_100052075
313 Ga0075430_100593420
314 Ga0075431_100127863
315 Ga0075429_100005315
316 Ga0097620_100121425
317 Ga0097620_100786776
318 Ga0105240_10601699
319 Ga0105240_10688331
320 Ga0111539_10138953
321 Ga0111539_11870700
322 Ga0105245_10450899
323 Ga0105242_10002400
324 Ga0105242_10042029
325 Ga0105242_10195440
326 Ga0105238_10057019
327 Ga0105238_10473672
328 Ga0105238_10947334
329 Ga0105238_11565789
330 Ga0105249_10006698
331 Ga0105249_10009044
332 Ga0105249_10096659
333 Ga0105249_10267973
334 Ga0105239_10020869
335 Ga0157371_10353280
336 Ga0157378_10058147
337 Ga0157378_10449663
338 Ga0163162_10000423
339 Ga0163162_10033676
340 Ga0163162_10555607
341 Ga0157375_10074137
342 Ga0157375_10661752
343 Ga0163163_10665790
344 Ga0163163_11281391
345 Ga0157380_10017367
346 Ga0157380_10140915
347 Ga0157380_10143104
348 Ga0157380_11457534
349 Ga0157377_10002480
350 Ga0157376_10174448
351 Ga0157376_10415708
352 Ga0157376_11598344
353 Ga0163161_10053027
354 Ga0213876_10277220
355 Ga0207697_10026089
356 Ga0207682_10018849
357 Ga0207680_10239526
358 Ga0207647_10055707
359 Ga0207645_10145618
360 Ga0207645_10368515
361 Ga0207643_10048898
362 Ga0207695_10028280
363 Ga0207695_10782046
364 Ga0207671_10049931
365 Ga0207662_10062043
366 Ga0207681_10389604
367 Ga0207681_10846643
368 Ga0207694_10117417
369 Ga0207650_10059065
370 Ga0207650_10208464
371 Ga0207650_10359157
372 Ga0207650_10599027
373 Ga0207706_10288335
374 Ga0207686_10000715
375 Ga0207686_10078304
376 Ga0207686_10109900
377 Ga0207670_10009038
378 Ga0207691_10009967
379 Ga0207689_10035121
380 Ga0207689_10047854
381 Ga0207651_10014803
382 Ga0207651_10036157
383 Ga0207651_10371331
384 Ga0207712_10001188
385 Ga0207712_10002851
386 Ga0207712_10014921
387 Ga0207712_10053260
388 Ga0207640_10209040
389 Ga0207640_10475415
390 Ga0207658_10169377
391 Ga0207658_10272238
392 Ga0207703_10633839
393 Ga0207639_10002436
394 Ga0207639_10024079
395 Ga0207639_10318891
396 Ga0207639_10480289
397 Ga0207708_10183476
398 Ga0207702_10606842
399 Ga0207641_10000213
400 Ga0207641_10018145
401 Ga0207648_10069357
402 Ga0207648_10193421
403 Ga0207676_10016401
404 Ga0207674_10063414
405 Ga0207674_10378502
406 Ga0207675_100011637
407 Ga0207683_10149149
408 Ga0207698_10846645
409 Ga0207428_10198410
410 Ga0268266_10000016
411 Ga0268265_10114481
412 Ga0268265_10244984
413 Ga0268264_10000072
414 Ga0268264_10007515
415 Ga0268264_10149431
416 Ga0268264_10927185
417 Ga0268264_10979609
418 Ga0307517_10000697
419 Ga0307513_10485743
420 Ga0307509_10174317
421 Ga0316576_10004720
422 Ga0316576_10009509
423 Ga0316578_10043047
424 Ga0316577_10147464
425 Ga0307412_10094073
426 Ga0316574_0085022
427 Ga0316584_0002337
428 Ga0395905_0129711
429 Ga0400483_152004
430 Ga0436365_1534476
431 Ga0451843_1169828
432 Ga0439441_059679
433 Ga0451577_0302238
434 Ga0453683_0354325
435 Ga0453684_0096188
436 Ga0453684_0709378
437 Ga0495648_0003626
438 Ga0495598_0087575
439 Ga0495621_0034432
440 Ga0495621_0225660
441 Ga0495625_0214841
442 Ga0495672_0048991
443 Ga0495687_000004
444 Ga0495686_0178108
445 Ga0496109_0267242
446 Ga0501032_0044738
447 Ga0501034_0076899
448 Ga0501034_0889789
449 Ga0501037_0019761
450 Ga0501038_0005909
451 Ga0501039_0125305
452 Ga0501043_0062294
453 Ga0501046_0019608
454 Ga0501047_0005143
455 Ga0501067_0048077
456 Ga0501068_0038333
457 Ga0501073_0002414
458 Ga0501074_0064741
459 Ga0501079_0680110
460 Ga0501080_0000609
461 Ga0501080_0607253
462 Ga0501083_0113275
463 Ga0501035_0303252
464 nmdc:mga0k408_110218_c1
465 nmdc:mga0k408_282503_c1
466 nmdc:mga0k408_97056_c1
467 nmdc:mga05p37_3553_c1
468 nmdc:mga0qj67_754498_c1
469 nmdc:mga06r32_1452231_c1
470 nmdc:mga08y16_168790_c1
471 nmdc:mga0a205_306218_c1
472 nmdc:mga0a205_752285_c1
473 Ga0500583_0000120
474 Ga0500583_0000866
475 Ga0500618_116878
476 Ga0500561_0172913
477 Ga0500568_0000609
478 Ga0500622_0002131
479 Ga0500639_236193
480 Ga0500611_120228
481 Ga0501082_0010004
482 2556063744
483 2563930271
484 2599102538
485 2673818020
486 2846958563

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00908

dTDP_sugar_isom

dTDP-4-dehydrorhamnose 3,5-epimerase

18

190

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1dzt-assembly1.cif.gz_B rmlc from salmonella typhimurium 0.9709 2 175
3ryk-assembly1.cif.gz_B 1.63 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase (rfbc) from bacillus anthracis str. ames with tdp and ppi bound 0.9705 2 174
7pvi-assembly1.cif.gz_BBB dtdp-sugar epimerase 0.9699 2 185
6c46-assembly2.cif.gz_C crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase from elizabethkingia anophelis nuhp1 0.9693 1 174
2ixh-assembly1.cif.gz_A rmlc p aeruginosa with dtdp-rhamnose 0.9689 1 177
ID Description Score Start End Superfamily
2ixcB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9675 1 176 2.60.120.10
2c0zA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9668 1 176 2.60.120.10
5buvB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9641 2 174 2.60.120.10
6dinA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9546 2 181 2.60.120.10
1ofnB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9493 1 176 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A7X9PK35-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9953 44 179 GO:0000271
GO:0005829
GO:0008830
GO:0019305
AF-A0A1Y3NSB4-F1-model_v4 RmlD-like substrate binding domain-containing protein 0.994 1 174 GO:0005829
GO:0006556
GO:0008830
GO:0008831
GO:0019305
GO:0045226
AF-A0A350YWE6-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9935 1 136 GO:0000271
GO:0005829
GO:0008830
GO:0019305
AF-A0A350MPY5-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9923 2 148 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A2E6AY78-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.992 41 179 GO:0000271
GO:0005829
GO:0008830
GO:0019305

Map