F355376

General Info

Members Datasets Scaffolds Average Seq Length
243 141 486 151

Family's Representative Sequence

Representative Sequence 3300005441|Ga0070700_100131964|Ga0070700_1001319641
Length 149
Sequence MRQALMTLAATLSIALTWSPAHAHHSHFYDECKTITIEGRVESAAFKNPHNLIVLRLDDGTAFAVDWVNVTWLTRAGVIQASKGAVVPGARLAVTGYLIRDAATIPKFKGVVDPNTVEARLLRRVDDSFSWGMPPRSTSPNCDRVDSAG

Samples

Sample ID Description Type Environment
1 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
102 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
103 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
104 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
105 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
108 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
109 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
110 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
111 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
112 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
113 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
114 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
115 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
116 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
117 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
118 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
119 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
120 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
121 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
122 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
123 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
124 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
125 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
126 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
127 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
128 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
129 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
130 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
131 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
132 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
133 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
134 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
135 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
136 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
137 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
138 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
139 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
140 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
141 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.82
Rhizosphere 99.18
Stem 0
Stem Tuber 0
Unclassified 46.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070700_100131964 3300005441 Unclassified 1687
2 JGI24742J22300_10081647 3300002244 Unclassified 611
3 Ga0065704_10366183 3300005289 Unclassified 791
4 Ga0065715_10874539 3300005293 Bacteria 583
5 Ga0065707_10135984 3300005295 Bacteria 1841
6 Ga0065707_10149710 3300005295 Unclassified 1668
7 Ga0065707_10160745 3300005295 Unclassified 1565
8 Ga0065707_10812472 3300005295 Unclassified 595
9 Ga0070676_10064868 3300005328 Bacteria 2179
10 Ga0070676_10822549 3300005328 Unclassified 687
11 Ga0070690_100611890 3300005330 Unclassified 828
12 Ga0070670_100074741 3300005331 Bacteria 2911
13 Ga0070670_100942004 3300005331 Unclassified 784
14 Ga0070677_10002625 3300005333 Bacteria 5750
15 Ga0070677_10239433 3300005333 Bacteria 895
16 Ga0068869_100490100 3300005334 Unclassified 1025
17 Ga0070666_10092385 3300005335 Bacteria 2080
18 Ga0070666_10203881 3300005335 Bacteria 1392
19 Ga0070689_100683619 3300005340 Unclassified 895
20 Ga0070689_100775725 3300005340 Bacteria 842
21 Ga0070661_100248813 3300005344 Unclassified 1371
22 Ga0070669_100083692 3300005353 Unclassified 2379
23 Ga0070669_100583428 3300005353 Unclassified 935
24 Ga0070669_100616928 3300005353 Bacteria 910
25 Ga0070675_100236394 3300005354 Unclassified 1595
26 Ga0070675_100270789 3300005354 Unclassified 1490
27 Ga0070674_100000071 3300005356 Bacteria 46918
28 Ga0070674_100010200 3300005356 Bacteria 5665
29 Ga0070674_100228977 3300005356 Bacteria 1449
30 Ga0070673_100174321 3300005364 Bacteria 1837
31 Ga0070673_102121004 3300005364 Unclassified 534
32 Ga0070688_100176069 3300005365 Bacteria 1480
33 Ga0070688_100243320 3300005365 Unclassified 1278
34 Ga0070701_10634300 3300005438 Unclassified 711
35 Ga0070678_100017428 3300005456 Unclassified 4625
36 Ga0070678_100055127 3300005456 Unclassified 2901
37 Ga0070678_100153892 3300005456 Bacteria 1855
38 Ga0070678_100766446 3300005456 Bacteria 874
39 Ga0070662_100066297 3300005457 Bacteria 2649
40 Ga0070662_100132509 3300005457 Bacteria 1923
41 Ga0068867_100635416 3300005459 Bacteria 935
42 Ga0070698_100123568 3300005471 Bacteria 2546
43 Ga0070672_100097785 3300005543 Bacteria 2376
44 Ga0070672_100286857 3300005543 Bacteria 1393
45 Ga0070686_100343135 3300005544 Bacteria 1120
46 Ga0070686_101153273 3300005544 Unclassified 642
47 Ga0070664_100086247 3300005564 Bacteria 2712
48 Ga0068857_100311030 3300005577 Bacteria 1453
49 Ga0070702_100750951 3300005615 Unclassified 749
50 Ga0068859_100087615 3300005617 Bacteria 3162
51 Ga0068859_100163835 3300005617 Bacteria 2302
52 Ga0068859_100168268 3300005617 Bacteria 2272
53 Ga0068859_100725523 3300005617 Bacteria 1084
54 Ga0068859_101489416 3300005617 Unclassified 747
55 Ga0068859_101497755 3300005617 Unclassified 745
56 Ga0068864_100850566 3300005618 Unclassified 899
57 Ga0068866_10698052 3300005718 Bacteria 696
58 Ga0068861_100393509 3300005719 Bacteria 1228
59 Ga0068861_101112756 3300005719 Unclassified 760
60 Ga0068863_100587104 3300005841 Unclassified 1102
61 Ga0068858_100114274 3300005842 Unclassified 2522
62 Ga0068862_100518168 3300005844 Unclassified 1134
63 Ga0070717_10144476 3300006028 Bacteria 2054
64 Ga0070716_100110330 3300006173 Bacteria 1704
65 Ga0068871_101615558 3300006358 Unclassified 614
66 Ga0075428_100343776 3300006844 Bacteria 1602
67 Ga0075430_100549486 3300006846 Unclassified 952
68 Ga0075430_100643042 3300006846 Unclassified 875
69 Ga0075431_100540066 3300006847 Bacteria 1154
70 Ga0075433_10023537 3300006852 Bacteria 5186
71 Ga0075433_10030631 3300006852 Bacteria 4591
72 Ga0075434_100021401 3300006871 Bacteria 6284
73 Ga0075429_100134598 3300006880 Archaea 2163
74 Ga0068865_100699815 3300006881 Unclassified 866
75 Ga0097620_100087612 3300006931 Bacteria 3162
76 Ga0097620_100163821 3300006931 Bacteria 2302
77 Ga0097620_100168274 3300006931 Bacteria 2272
78 Ga0097620_100725469 3300006931 Bacteria 1084
79 Ga0097620_101489477 3300006931 Unclassified 747
80 Ga0097620_101497810 3300006931 Unclassified 745
81 Ga0111539_10001651 3300009094 Bacteria 29787
82 Ga0111539_10011252 3300009094 Bacteria 11242
83 Ga0111539_10021267 3300009094 Bacteria 7988
84 Ga0111539_10203762 3300009094 Bacteria 2306
85 Ga0111539_10411924 3300009094 Bacteria 1574
86 Ga0111539_10492798 3300009094 Bacteria 1427
87 Ga0111539_10592667 3300009094 Unclassified 1291
88 Ga0105245_10344330 3300009098 Unclassified 1475
89 Ga0105247_10041849 3300009101 Unclassified 2804
90 Ga0114129_10078045 3300009147 Unclassified 4606
91 Ga0114129_10097952 3300009147 Unclassified 4060
92 Ga0114129_10261582 3300009147 Bacteria 2319
93 Ga0105243_10488338 3300009148 Bacteria 1164
94 Ga0105242_10395399 3300009176 Bacteria 1288
95 Ga0105248_10311377 3300009177 Unclassified 1773
96 Ga0105248_10353297 3300009177 Unclassified 1655
97 Ga0105248_10502419 3300009177 Bacteria 1367
98 Ga0105249_10220729 3300009553 Unclassified 1865
99 Ga0105246_10525064 3300011119 Unclassified 1010
100 Ga0157378_10884283 3300013297 Unclassified 923
101 Ga0157375_10052002 3300013308 Unclassified 4026
102 Ga0157375_10388690 3300013308 Bacteria 1562
103 Ga0163163_10080732 3300014325 Unclassified 3253
104 Ga0163163_10574075 3300014325 Bacteria 1191
105 Ga0157380_10003695 3300014326 Bacteria 10525
106 Ga0157380_10022433 3300014326 Bacteria 4752
107 Ga0157380_10128132 3300014326 Bacteria 2161
108 Ga0157380_12413418 3300014326 Unclassified 591
109 Ga0157377_10010174 3300014745 Bacteria 4643
110 Ga0157377_10455709 3300014745 Unclassified 884
111 Ga0157379_11220349 3300014968 Unclassified 724
112 Ga0157376_12114104 3300014969 Unclassified 601
113 Ga0163161_10077881 3300017792 Unclassified 2436
114 Ga0163161_10128994 3300017792 Archaea 1906
115 Ga0163161_10892931 3300017792 Unclassified 752
116 Ga0207682_10002516 3300025893 Bacteria 8191
117 Ga0207682_10062264 3300025893 Bacteria 1564
118 Ga0207688_10268956 3300025901 Bacteria 1036
119 Ga0207688_10564694 3300025901 Bacteria 716
120 Ga0207680_10041211 3300025903 Unclassified 2692
121 Ga0207685_10690064 3300025905 Unclassified 555
122 Ga0207699_10370974 3300025906 Bacteria 1014
123 Ga0207643_10026526 3300025908 Bacteria 3208
124 Ga0207643_10216163 3300025908 Unclassified 1172
125 Ga0207643_10255303 3300025908 Unclassified 1081
126 Ga0207681_10033998 3300025923 Bacteria 3348
127 Ga0207681_10041842 3300025923 Bacteria 3057
128 Ga0207681_10111093 3300025923 Unclassified 1994
129 Ga0207681_10341601 3300025923 Bacteria 1196
130 Ga0207681_10550279 3300025923 Bacteria 950
131 Ga0207659_10097543 3300025926 Unclassified 2208
132 Ga0207659_10253019 3300025926 Unclassified 1430
133 Ga0207690_10305668 3300025932 Unclassified 1246
134 Ga0207706_10089161 3300025933 Bacteria 2711
135 Ga0207706_10679073 3300025933 Unclassified 881
136 Ga0207686_10695332 3300025934 Unclassified 808
137 Ga0207669_10003040 3300025937 Bacteria 7223
138 Ga0207669_10017930 3300025937 Unclassified 3645
139 Ga0207669_10298876 3300025937 Unclassified 1222
140 Ga0207704_10643848 3300025938 Unclassified 872
141 Ga0207704_11733690 3300025938 Unclassified 537
142 Ga0207665_10252958 3300025939 Bacteria 1302
143 Ga0207691_10084114 3300025940 Bacteria 2856
144 Ga0207691_10256514 3300025940 Bacteria 1508
145 Ga0207711_10891056 3300025941 Unclassified 827
146 Ga0207689_10137851 3300025942 Bacteria 2009
147 Ga0207689_10502532 3300025942 Unclassified 1016
148 Ga0207651_10463741 3300025960 Bacteria 1089
149 Ga0207651_10935474 3300025960 Bacteria 773
150 Ga0207712_10278314 3300025961 Bacteria 1364
151 Ga0207668_10286722 3300025972 Bacteria 1353
152 Ga0207668_10701460 3300025972 Unclassified 890
153 Ga0207703_10056597 3300026035 Unclassified 3194
154 Ga0207703_10082822 3300026035 Unclassified 2679
155 Ga0207708_10139027 3300026075 Bacteria 1904
156 Ga0207641_10226533 3300026088 Bacteria 1736
157 Ga0207641_10613709 3300026088 Unclassified 1066
158 Ga0207648_10177433 3300026089 Unclassified 1884
159 Ga0207648_10181667 3300026089 Bacteria 1862
160 Ga0207648_10296198 3300026089 Unclassified 1450
161 Ga0207676_11200612 3300026095 Unclassified 752
162 Ga0207674_10033506 3300026116 Bacteria 5377
163 Ga0207675_100160741 3300026118 Unclassified 2142
164 Ga0207675_100866184 3300026118 Unclassified 919
165 Ga0207683_10007588 3300026121 Bacteria 9293
166 Ga0207683_10037776 3300026121 Unclassified 4207
167 Ga0207683_10088178 3300026121 Bacteria 2760
168 Ga0209996_1078064 3300027395 Unclassified 518
169 Ga0209984_1044241 3300027424 Bacteria 645
170 Ga0209971_1077842 3300027682 Unclassified 807
171 Ga0209974_10220452 3300027876 Unclassified 706
172 Ga0207428_10009322 3300027907 Bacteria 8804
173 Ga0207428_10012254 3300027907 Bacteria 7538
174 Ga0207428_10037961 3300027907 Bacteria 3918
175 Ga0207428_10169516 3300027907 Bacteria 1654
176 Ga0207428_10855072 3300027907 Bacteria 644
177 Ga0268266_10843398 3300028379 Bacteria 886
178 Ga0268265_10294314 3300028380 Unclassified 1459
179 Ga0268265_11511725 3300028380 Unclassified 675
180 Ga0268264_10106884 3300028381 Unclassified 2444
181 Ga0268264_12316806 3300028381 Unclassified 544
182 Ga0307408_101388743 3300031548 Bacteria 661
183 Ga0373958_0139979 3300034819 Unclassified 598
184 Ga0373928_0088524 3300035084 Unclassified 791
185 Ga0373940_0158130 3300035088 Unclassified 726
186 Ga0373952_0044924 3300035092 Unclassified 1034
187 Ga0373932_0135764 3300035112 Unclassified 832
188 Ga0373937_0652376 3300036401 Unclassified 998
189 Ga0242420_010519 3300038996 Unclassified 1539
190 Ga0439440_0103974 3300042993 Unclassified 775
191 Ga0495592_0147588 3300046454 Bacteria 1629
192 Ga0495629_0342665 3300046459 Bacteria 1020
193 Ga0495629_1127149 3300046459 Unclassified 506
194 Ga0495651_0191282 3300046462 Bacteria 1440
195 Ga0495608_0002771 3300046511 Bacteria 12586
196 Ga0495630_0002122 3300046517 Bacteria 13796
197 Ga0495652_0656129 3300046529 Bacteria 710
198 Ga0495665_0189995 3300046531 Unclassified 1066
199 Ga0495587_0071290 3300046536 Unclassified 2021
200 Ga0495598_0149940 3300046537 Unclassified 813
201 Ga0495621_0140093 3300046539 Bacteria 946
202 Ga0495621_0287586 3300046539 Unclassified 679
203 Ga0495656_0002611 3300046615 Bacteria 6014
204 Ga0495634_0070831 3300046642 Bacteria 2298
205 Ga0495658_0302775 3300046683 Bacteria 1011
206 Ga0495669_0002612 3300046684 Bacteria 7369
207 Ga0495613_0021718 3300046689 Bacteria 4782
208 Ga0495600_0156368 3300046809 Bacteria 1475
209 Ga0495604_0056463 3300047317 Unclassified 3022
210 Ga0495674_0015334 3300047319 Bacteria 7168
211 Ga0495675_0158672 3300047444 Bacteria 1394
212 Ga0495684_0000176 3300047471 Bacteria 48583
213 Ga0496104_0878684 3300048907 Unclassified 802
214 Ga0496113_0713066 3300048916 Bacteria 800
215 Ga0501249_198285 3300049679 Unclassified 526
216 Ga0501079_0799732 3300049741 Unclassified 742
217 nmdc:mga05p37_220836_c1 3300050507 Archaea 2287
218 nmdc:mga05p37_386967_c1 3300050507 Bacteria 1637
219 nmdc:mga09592_108056_c1 3300050508 Bacteria 2386
220 nmdc:mga09592_514749_c1 3300050508 Bacteria 1030
221 nmdc:mga0qj67_277815_c1 3300050509 Unclassified 1358
222 nmdc:mga0qj67_914896_c1 3300050509 Unclassified 691
223 nmdc:mga06r32_9541_c1 3300050510 Bacteria 5110
224 nmdc:mga08y16_205666_c1 3300050511 Archaea 2040
225 nmdc:mga08y16_213667_c1 3300050511 Unclassified 1997
226 nmdc:mga08y16_270805_c1 3300050511 Bacteria 1753
227 nmdc:mga08y16_293693_c1 3300050511 Bacteria 1676
228 nmdc:mga08y16_321763_c1 3300050511 Bacteria 1592
229 nmdc:mga08y16_364897_c1 3300050511 Unclassified 1482
230 nmdc:mga08y16_5092_c1 3300050511 Bacteria 13737
231 nmdc:mga08y16_76992_c1 3300050511 Bacteria 3477
232 nmdc:mga08y16_7913_c1 3300050511 Bacteria 11123
233 nmdc:mga0n895_13079_c1 3300050512 Bacteria 7467
234 nmdc:mga0n895_134401_c1 3300050512 Bacteria 2499
235 nmdc:mga0a205_5381_c1 3300050515 Bacteria 11543
236 nmdc:mga0a205_618818_c1 3300050515 Unclassified 935
237 nmdc:mga0a205_83080_c1 3300050515 Bacteria 3094
238 nmdc:mga0a205_946715_c1 3300050515 Unclassified 708
239 Ga0495601_0006826 3300053077 Bacteria 6686
240 Ga0495601_0036701 3300053077 Unclassified 3062
241 Ga0495619_0003885 3300053085 Bacteria 9607
242 Ga0495619_0041504 3300053085 Bacteria 3010
243 Ga0495619_0598151 3300053085 Unclassified 755
244 Ga0070700_100131964
245 JGI24742J22300_10081647
246 Ga0065704_10366183
247 Ga0065715_10874539
248 Ga0065707_10135984
249 Ga0065707_10149710
250 Ga0065707_10160745
251 Ga0065707_10812472
252 Ga0070676_10064868
253 Ga0070676_10822549
254 Ga0070690_100611890
255 Ga0070670_100074741
256 Ga0070670_100942004
257 Ga0070677_10002625
258 Ga0070677_10239433
259 Ga0068869_100490100
260 Ga0070666_10092385
261 Ga0070666_10203881
262 Ga0070689_100683619
263 Ga0070689_100775725
264 Ga0070661_100248813
265 Ga0070669_100083692
266 Ga0070669_100583428
267 Ga0070669_100616928
268 Ga0070675_100236394
269 Ga0070675_100270789
270 Ga0070674_100000071
271 Ga0070674_100010200
272 Ga0070674_100228977
273 Ga0070673_100174321
274 Ga0070673_102121004
275 Ga0070688_100176069
276 Ga0070688_100243320
277 Ga0070701_10634300
278 Ga0070678_100017428
279 Ga0070678_100055127
280 Ga0070678_100153892
281 Ga0070678_100766446
282 Ga0070662_100066297
283 Ga0070662_100132509
284 Ga0068867_100635416
285 Ga0070698_100123568
286 Ga0070672_100097785
287 Ga0070672_100286857
288 Ga0070686_100343135
289 Ga0070686_101153273
290 Ga0070664_100086247
291 Ga0068857_100311030
292 Ga0070702_100750951
293 Ga0068859_100087615
294 Ga0068859_100163835
295 Ga0068859_100168268
296 Ga0068859_100725523
297 Ga0068859_101489416
298 Ga0068859_101497755
299 Ga0068864_100850566
300 Ga0068866_10698052
301 Ga0068861_100393509
302 Ga0068861_101112756
303 Ga0068863_100587104
304 Ga0068858_100114274
305 Ga0068862_100518168
306 Ga0070717_10144476
307 Ga0070716_100110330
308 Ga0068871_101615558
309 Ga0075428_100343776
310 Ga0075430_100549486
311 Ga0075430_100643042
312 Ga0075431_100540066
313 Ga0075433_10023537
314 Ga0075433_10030631
315 Ga0075434_100021401
316 Ga0075429_100134598
317 Ga0068865_100699815
318 Ga0097620_100087612
319 Ga0097620_100163821
320 Ga0097620_100168274
321 Ga0097620_100725469
322 Ga0097620_101489477
323 Ga0097620_101497810
324 Ga0111539_10001651
325 Ga0111539_10011252
326 Ga0111539_10021267
327 Ga0111539_10203762
328 Ga0111539_10411924
329 Ga0111539_10492798
330 Ga0111539_10592667
331 Ga0105245_10344330
332 Ga0105247_10041849
333 Ga0114129_10078045
334 Ga0114129_10097952
335 Ga0114129_10261582
336 Ga0105243_10488338
337 Ga0105242_10395399
338 Ga0105248_10311377
339 Ga0105248_10353297
340 Ga0105248_10502419
341 Ga0105249_10220729
342 Ga0105246_10525064
343 Ga0157378_10884283
344 Ga0157375_10052002
345 Ga0157375_10388690
346 Ga0163163_10080732
347 Ga0163163_10574075
348 Ga0157380_10003695
349 Ga0157380_10022433
350 Ga0157380_10128132
351 Ga0157380_12413418
352 Ga0157377_10010174
353 Ga0157377_10455709
354 Ga0157379_11220349
355 Ga0157376_12114104
356 Ga0163161_10077881
357 Ga0163161_10128994
358 Ga0163161_10892931
359 Ga0207682_10002516
360 Ga0207682_10062264
361 Ga0207688_10268956
362 Ga0207688_10564694
363 Ga0207680_10041211
364 Ga0207685_10690064
365 Ga0207699_10370974
366 Ga0207643_10026526
367 Ga0207643_10216163
368 Ga0207643_10255303
369 Ga0207681_10033998
370 Ga0207681_10041842
371 Ga0207681_10111093
372 Ga0207681_10341601
373 Ga0207681_10550279
374 Ga0207659_10097543
375 Ga0207659_10253019
376 Ga0207690_10305668
377 Ga0207706_10089161
378 Ga0207706_10679073
379 Ga0207686_10695332
380 Ga0207669_10003040
381 Ga0207669_10017930
382 Ga0207669_10298876
383 Ga0207704_10643848
384 Ga0207704_11733690
385 Ga0207665_10252958
386 Ga0207691_10084114
387 Ga0207691_10256514
388 Ga0207711_10891056
389 Ga0207689_10137851
390 Ga0207689_10502532
391 Ga0207651_10463741
392 Ga0207651_10935474
393 Ga0207712_10278314
394 Ga0207668_10286722
395 Ga0207668_10701460
396 Ga0207703_10056597
397 Ga0207703_10082822
398 Ga0207708_10139027
399 Ga0207641_10226533
400 Ga0207641_10613709
401 Ga0207648_10177433
402 Ga0207648_10181667
403 Ga0207648_10296198
404 Ga0207676_11200612
405 Ga0207674_10033506
406 Ga0207675_100160741
407 Ga0207675_100866184
408 Ga0207683_10007588
409 Ga0207683_10037776
410 Ga0207683_10088178
411 Ga0209996_1078064
412 Ga0209984_1044241
413 Ga0209971_1077842
414 Ga0209974_10220452
415 Ga0207428_10009322
416 Ga0207428_10012254
417 Ga0207428_10037961
418 Ga0207428_10169516
419 Ga0207428_10855072
420 Ga0268266_10843398
421 Ga0268265_10294314
422 Ga0268265_11511725
423 Ga0268264_10106884
424 Ga0268264_12316806
425 Ga0307408_101388743
426 Ga0373958_0139979
427 Ga0373928_0088524
428 Ga0373940_0158130
429 Ga0373952_0044924
430 Ga0373932_0135764
431 Ga0373937_0652376
432 Ga0242420_010519
433 Ga0439440_0103974
434 Ga0495592_0147588
435 Ga0495629_0342665
436 Ga0495629_1127149
437 Ga0495651_0191282
438 Ga0495608_0002771
439 Ga0495630_0002122
440 Ga0495652_0656129
441 Ga0495665_0189995
442 Ga0495587_0071290
443 Ga0495598_0149940
444 Ga0495621_0140093
445 Ga0495621_0287586
446 Ga0495656_0002611
447 Ga0495634_0070831
448 Ga0495658_0302775
449 Ga0495669_0002612
450 Ga0495613_0021718
451 Ga0495600_0156368
452 Ga0495604_0056463
453 Ga0495674_0015334
454 Ga0495675_0158672
455 Ga0495684_0000176
456 Ga0496104_0878684
457 Ga0496113_0713066
458 Ga0501249_198285
459 Ga0501079_0799732
460 nmdc:mga05p37_220836_c1
461 nmdc:mga05p37_386967_c1
462 nmdc:mga09592_108056_c1
463 nmdc:mga09592_514749_c1
464 nmdc:mga0qj67_277815_c1
465 nmdc:mga0qj67_914896_c1
466 nmdc:mga06r32_9541_c1
467 nmdc:mga08y16_205666_c1
468 nmdc:mga08y16_213667_c1
469 nmdc:mga08y16_270805_c1
470 nmdc:mga08y16_293693_c1
471 nmdc:mga08y16_321763_c1
472 nmdc:mga08y16_364897_c1
473 nmdc:mga08y16_5092_c1
474 nmdc:mga08y16_76992_c1
475 nmdc:mga08y16_7913_c1
476 nmdc:mga0n895_13079_c1
477 nmdc:mga0n895_134401_c1
478 nmdc:mga0a205_5381_c1
479 nmdc:mga0a205_618818_c1
480 nmdc:mga0a205_83080_c1
481 nmdc:mga0a205_946715_c1
482 Ga0495601_0006826
483 Ga0495601_0036701
484 Ga0495619_0003885
485 Ga0495619_0041504
486 Ga0495619_0598151

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19649

DUF6152

Family of unknown function (DUF6152)

11

107

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1quq-assembly2.cif.gz_C complex of replication protein a subunits rpa14 and rpa32 0.8529 34 127
3kdf-assembly3.cif.gz_D x-ray crystal structure of the human replication protein a complex from wheat germ cell free expression 0.8479 34 127
2pi2-assembly3.cif.gz_C full-length replication protein a subunits rpa14 and rpa32 0.8447 34 98
8r6f-assembly1.cif.gz_E cryoem structure of wheat 40s ribosomal subunit, body domain 0.833 39 66
7oud-assembly1.cif.gz_AAA crystal structure of a ternary complex of the flavoprotein monooxygenase grho5 with fad and collinone 0.8323 39 66
ID Description Score Start End Superfamily
af_A0A1D6H1F7_456_597_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.883 33 67 2.40.50.140
af_E7F0D5_148_289_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8657 33 67 2.40.50.140
2awoD03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8293 35 93 2.40.50.140
4gopY00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8281 34 125 2.40.50.140
af_Q9VKJ3_28_530_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8264 39 64 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A0F5YKM2-F1-model_v4 Uncharacterized protein 0.8911 22 134
AF-A0A6L8BDS5-F1-model_v4 Uncharacterized protein 0.8756 27 140
AF-A0A382A9L4-F1-model_v4 DUF5666 domain-containing protein 0.8719 24 132
AF-A0A6P0R0Z0-F1-model_v4 deleted 0.8621 17 134
AF-A0A419A8A7-F1-model_v4 Uncharacterized protein 0.86 26 132

Map