F355189

General Info

Members Datasets Scaffolds Average Seq Length
243 185 486 125

Family's Representative Sequence

Representative Sequence 3300000546|LJNas_1022900|LJNas_10229002
Length 148
Sequence MELAIACCLFWVRTGKFKMKDTQAGDTQAGAKHYRWADLPAEPMKGGITRALITGDRMMIAHVRLKKGDEVPRHSHENEQITYILEGALHFWLGPKGEREQTVRAGEVLVIPSNLEHRAVALEDTLDVDVFNPPRQDWLNGTDAYLRG

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
109 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
114 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
118 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
119 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
120 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
121 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
122 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
123 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
124 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
125 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
129 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
130 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
131 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
132 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
133 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
134 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
135 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
136 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
137 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
146 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
147 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
148 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
149 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
150 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
151 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
152 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
153 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
154 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
155 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
156 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
157 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
158 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
159 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
160 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
161 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
162 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
163 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
164 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
165 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
166 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
167 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
168 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
169 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
170 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
171 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
179 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
180 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
181 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
182 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
183 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
184 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
185 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.35
Metatranscriptomes 1.65
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.82
Nodule 0
Rhizoplane 6.58
Rhizosphere 89.71
Stem 0
Stem Tuber 0
Unclassified 18.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1022900 3300000546 Unclassified 667
2 LJNas_1014203 3300000546 Bacteria 849
3 LJNas_1020430 3300000546 Unclassified 706
4 Ga0058860_12185322 3300004801 Bacteria 738
5 Ga0070658_10877922 3300005327 Bacteria 780
6 Ga0070683_100066107 3300005329 Bacteria 3368
7 Ga0070690_100030023 3300005330 Bacteria 3375
8 Ga0068869_100389984 3300005334 Bacteria 1143
9 Ga0068869_101270941 3300005334 Bacteria 649
10 Ga0070666_10018385 3300005335 Bacteria 4493
11 Ga0070680_100056879 3300005336 Bacteria 3197
12 Ga0070660_100013169 3300005339 Bacteria 5926
13 Ga0070661_100026602 3300005344 Unclassified 4162
14 Ga0070692_10330031 3300005345 Bacteria 941
15 Ga0070671_100821169 3300005355 Bacteria 810
16 Ga0070674_100615029 3300005356 Bacteria 920
17 Ga0070688_100105678 3300005365 Bacteria 1864
18 Ga0070659_100035666 3300005366 Bacteria 3873
19 Ga0070659_100231666 3300005366 Bacteria 1526
20 Ga0070667_100006030 3300005367 Bacteria 10072
21 Ga0070667_101354542 3300005367 Unclassified 667
22 Ga0070703_10522728 3300005406 Bacteria 537
23 Ga0070714_100008154 3300005435 Bacteria 8164
24 Ga0070710_10145282 3300005437 Bacteria 1458
25 Ga0070700_100048087 3300005441 Bacteria 2643
26 Ga0070700_100594596 3300005441 Bacteria 866
27 Ga0070678_100606636 3300005456 Bacteria 978
28 Ga0070662_100358001 3300005457 Bacteria 1197
29 Ga0070681_10408893 3300005458 Unclassified 1269
30 Ga0068867_100310901 3300005459 Unclassified 1302
31 Ga0070707_100390679 3300005468 Bacteria 1351
32 Ga0070679_100074337 3300005530 Unclassified 3389
33 Ga0070684_100067732 3300005535 Bacteria 3137
34 Ga0070684_102104846 3300005535 Unclassified 532
35 Ga0068853_100260291 3300005539 Bacteria 1595
36 Ga0068853_100901801 3300005539 Bacteria 849
37 Ga0070672_100052804 3300005543 Bacteria 3175
38 Ga0070686_100088385 3300005544 Bacteria 2068
39 Ga0070695_100473151 3300005545 Bacteria 964
40 Ga0070696_101438170 3300005546 Unclassified 589
41 Ga0070665_100038066 3300005548 Bacteria 4835
42 Ga0068855_100398186 3300005563 Bacteria 1509
43 Ga0068855_100958078 3300005563 Bacteria 901
44 Ga0070702_100010713 3300005615 Bacteria 4530
45 Ga0068852_100065170 3300005616 Bacteria 3177
46 Ga0068859_100001453 3300005617 Bacteria 24054
47 Ga0068859_100159016 3300005617 Bacteria 2338
48 Ga0068866_10119405 3300005718 Bacteria 1483
49 Ga0068861_100429919 3300005719 Bacteria 1178
50 Ga0068861_101641906 3300005719 Unclassified 634
51 Ga0068863_100027242 3300005841 Bacteria 5450
52 Ga0068863_100193685 3300005841 Bacteria 1954
53 Ga0068858_100002038 3300005842 Bacteria 20580
54 Ga0068858_100759252 3300005842 Unclassified 945
55 Ga0068860_100005335 3300005843 Bacteria 13045
56 Ga0068860_100110323 3300005843 Bacteria 2629
57 Ga0068860_100164783 3300005843 Bacteria 2139
58 Ga0068862_100083553 3300005844 Bacteria 2773
59 Ga0068862_100172120 3300005844 Bacteria 1939
60 Ga0068862_100463448 3300005844 Unclassified 1197
61 Ga0070717_10020935 3300006028 Bacteria 5149
62 Ga0070712_100881894 3300006175 Bacteria 771
63 Ga0075366_10758188 3300006195 Bacteria 603
64 Ga0097621_100141763 3300006237 Unclassified 2054
65 Ga0097621_100596333 3300006237 Unclassified 1009
66 Ga0068871_100038144 3300006358 Bacteria 3835
67 Ga0068871_100423633 3300006358 Bacteria 1189
68 Ga0068865_100011719 3300006881 Bacteria 5492
69 Ga0097620_100001453 3300006931 Bacteria 24054
70 Ga0097620_100159012 3300006931 Bacteria 2338
71 Ga0075435_100725499 3300007076 Bacteria 864
72 Ga0075435_100775019 3300007076 Bacteria 835
73 Ga0099795_10176356 3300007788 Bacteria 890
74 Ga0105240_10773936 3300009093 Bacteria 1042
75 Ga0111539_12284306 3300009094 Unclassified 628
76 Ga0105247_10061715 3300009101 Bacteria 2324
77 Ga0105247_10646700 3300009101 Bacteria 789
78 Ga0114129_10140738 3300009147 Bacteria 3308
79 Ga0114129_12756343 3300009147 Unclassified 585
80 Ga0105243_10001448 3300009148 Bacteria 20858
81 Ga0105242_10212151 3300009176 Bacteria 1726
82 Ga0105242_12633341 3300009176 Bacteria 552
83 Ga0105248_10149825 3300009177 Unclassified 2632
84 Ga0105248_10816604 3300009177 Unclassified 1052
85 Ga0105248_11616092 3300009177 Bacteria 734
86 Ga0105237_10570203 3300009545 Bacteria 1139
87 Ga0105249_10009596 3300009553 Bacteria 8480
88 Ga0105249_10049732 3300009553 Bacteria 3823
89 Ga0105249_10127993 3300009553 Bacteria 2421
90 Ga0105249_10217662 3300009553 Bacteria 1878
91 Ga0105249_10373269 3300009553 Bacteria 1451
92 Ga0099796_10047181 3300010159 Unclassified 1481
93 Ga0105246_10636952 3300011119 Bacteria 926
94 Ga0157371_10009641 3300013102 Bacteria 7592
95 Ga0157370_10577294 3300013104 Bacteria 1030
96 Ga0157369_10266479 3300013105 Unclassified 1786
97 Ga0157378_11064575 3300013297 Bacteria 845
98 Ga0163162_10078428 3300013306 Bacteria 3369
99 Ga0157375_10135909 3300013308 Bacteria 2582
100 Ga0157375_11042313 3300013308 Bacteria 956
101 Ga0157379_10266784 3300014968 Bacteria 1556
102 Ga0157376_10264537 3300014969 Unclassified 1613
103 Ga0207653_10322221 3300025885 Bacteria 601
104 Ga0207692_10371187 3300025898 Bacteria 886
105 Ga0207642_10658722 3300025899 Bacteria 657
106 Ga0207642_10980281 3300025899 Bacteria 544
107 Ga0207710_10000666 3300025900 Bacteria 19351
108 Ga0207710_10169598 3300025900 Bacteria 1067
109 Ga0207710_10701986 3300025900 Bacteria 531
110 Ga0207680_10102425 3300025903 Bacteria 1842
111 Ga0207647_10327033 3300025904 Bacteria 870
112 Ga0207685_10275487 3300025905 Bacteria 823
113 Ga0207699_10018469 3300025906 Bacteria 3696
114 Ga0207695_10268833 3300025913 Unclassified 1601
115 Ga0207693_10389609 3300025915 Bacteria 1089
116 Ga0207660_10029799 3300025917 Bacteria 3748
117 Ga0207657_10026981 3300025919 Bacteria 5266
118 Ga0207649_10369569 3300025920 Unclassified 1066
119 Ga0207649_11131453 3300025920 Bacteria 618
120 Ga0207652_10011992 3300025921 Bacteria 6994
121 Ga0207694_10172883 3300025924 Bacteria 1750
122 Ga0207650_10421492 3300025925 Unclassified 1108
123 Ga0207687_10640700 3300025927 Bacteria 898
124 Ga0207644_10001891 3300025931 Bacteria 13622
125 Ga0207690_10067546 3300025932 Bacteria 2452
126 Ga0207686_11561200 3300025934 Bacteria 545
127 Ga0207704_10073756 3300025938 Bacteria 2175
128 Ga0207711_10328943 3300025941 Bacteria 1413
129 Ga0207711_10767873 3300025941 Bacteria 898
130 Ga0207689_10016124 3300025942 Bacteria 6326
131 Ga0207689_10957024 3300025942 Unclassified 722
132 Ga0207661_10160341 3300025944 Bacteria 1951
133 Ga0207667_10441128 3300025949 Bacteria 1324
134 Ga0207712_10004286 3300025961 Bacteria 9002
135 Ga0207712_10088145 3300025961 Bacteria 2278
136 Ga0207712_10120651 3300025961 Bacteria 1983
137 Ga0207712_10390588 3300025961 Bacteria 1167
138 Ga0207668_11179298 3300025972 Unclassified 688
139 Ga0207658_10003545 3300025986 Bacteria 11017
140 Ga0207703_10000855 3300026035 Bacteria 29877
141 Ga0207703_11358169 3300026035 Bacteria 683
142 Ga0207639_11201474 3300026041 Bacteria 712
143 Ga0207708_10399076 3300026075 Bacteria 1137
144 Ga0207641_10193661 3300026088 Bacteria 1870
145 Ga0207641_10663849 3300026088 Bacteria 1025
146 Ga0207648_10093552 3300026089 Bacteria 2628
147 Ga0207675_100783514 3300026118 Bacteria 966
148 Ga0207675_100886039 3300026118 Bacteria 908
149 Ga0207683_10474674 3300026121 Bacteria 1154
150 Ga0209588_1000038 3300027671 Bacteria 63048
151 Ga0265354_1000711 3300028016 Bacteria 5503
152 Ga0265356_1001001 3300028017 Bacteria 4481
153 Ga0268266_12251231 3300028379 Unclassified 517
154 Ga0268265_10043188 3300028380 Bacteria 3349
155 Ga0268265_10536615 3300028380 Unclassified 1108
156 Ga0268265_10851380 3300028380 Bacteria 892
157 Ga0268264_10088499 3300028381 Bacteria 2665
158 Ga0268264_10300329 3300028381 Bacteria 1511
159 Ga0268264_10461534 3300028381 Bacteria 1232
160 Ga0268264_10693038 3300028381 Bacteria 1011
161 Ga0268264_11838888 3300028381 Bacteria 616
162 Ga0307511_10052073 3300030521 Bacteria 3269
163 Ga0265770_1000171 3300030878 Bacteria 8400
164 Ga0265765_1009586 3300030879 Bacteria 1069
165 Ga0265760_10001437 3300031090 Bacteria 7015
166 Ga0265325_10045475 3300031241 Unclassified 2281
167 Ga0265340_10421320 3300031247 Unclassified 589
168 Ga0265316_10369143 3300031344 Bacteria 1037
169 Ga0307513_10005412 3300031456 Bacteria 16878
170 Ga0307509_10000038 3300031507 Bacteria 188458
171 Ga0265313_10347345 3300031595 Bacteria 588
172 Ga0307508_10242423 3300031616 Unclassified 1400
173 Ga0307516_10005145 3300031730 Bacteria 15780
174 Ga0307405_10587570 3300031731 Unclassified 907
175 Ga0307409_100941778 3300031995 Unclassified 879
176 Ga0307416_100040627 3300032002 Bacteria 3616
177 Ga0307416_103825468 3300032002 Bacteria 504
178 Ga0316214_1058073 3300033545 Bacteria 564
179 Ga0373934_0040608 3300035086 Bacteria 1835
180 Ga0373949_0000001 3300035090 Bacteria 103947
181 Ga0373923_0194034 3300035111 Bacteria 937
182 Ga0373936_0008741 3300035113 Unclassified 3816
183 Ga0373953_0116761 3300035117 Bacteria 1131
184 Ga0373956_0003450 3300035119 Bacteria 6369
185 Ga0373957_0002943 3300035120 Bacteria 4935
186 Ga0373924_0083463 3300035410 Bacteria 1361
187 Ga0373935_1266322 3300035692 Unclassified 550
188 Ga0373933_0003710 3300035724 Bacteria 8448
189 Ga0373937_0000108 3300036401 Bacteria 79022
190 Ga0395899_0333736 3300037312 Bacteria 1018
191 Ga0395900_0428014 3300037418 Bacteria 1283
192 Ga0395898_1021023 3300037466 Bacteria 762
193 Ga0395905_0242144 3300037471 Bacteria 1685
194 Ga0395901_0011264 3300038443 Bacteria 9060
195 Ga0436360_0484901 3300039438 Bacteria 2164
196 Ga0466967_0667614 3300045976 Bacteria 1029
197 Ga0495592_0516262 3300046454 Bacteria 739
198 Ga0495603_0008611 3300046455 Bacteria 6166
199 Ga0495641_0338007 3300046461 Bacteria 680
200 Ga0495582_0911433 3300046473 Bacteria 508
201 Ga0495639_0052911 3300046475 Bacteria 1849
202 Ga0495596_0089387 3300046500 Bacteria 1195
203 Ga0495596_0135376 3300046500 Bacteria 956
204 Ga0495608_0728286 3300046511 Bacteria 589
205 Ga0495618_0800541 3300046514 Bacteria 549
206 Ga0495637_0336951 3300046520 Unclassified 531
207 Ga0495644_0031330 3300046523 Bacteria 2009
208 Ga0495663_0066947 3300046525 Bacteria 1138
209 Ga0495587_0107148 3300046536 Bacteria 1607
210 Ga0495668_0652499 3300046616 Unclassified 582
211 Ga0495634_0373968 3300046642 Unclassified 850
212 Ga0495599_0057116 3300046678 Bacteria 2442
213 Ga0495670_0118947 3300046691 Bacteria 1372
214 Ga0495660_0284769 3300046810 Bacteria 755
215 Ga0495604_0523784 3300047317 Unclassified 767
216 Ga0495636_0678011 3300047318 Unclassified 508
217 Ga0495676_0744391 3300047321 Unclassified 633
218 Ga0495680_0716398 3300047322 Bacteria 660
219 Ga0495680_0834643 3300047322 Unclassified 600
220 Ga0495680_0861591 3300047322 Bacteria 588
221 Ga0495677_0038224 3300047445 Bacteria 1754
222 Ga0495684_0150045 3300047471 Bacteria 1743
223 Ga0496100_0173517 3300048903 Bacteria 1555
224 Ga0496100_0848544 3300048903 Unclassified 716
225 Ga0496101_0409339 3300048904 Bacteria 1069
226 Ga0496104_1208502 3300048907 Bacteria 659
227 Ga0496105_0214162 3300048908 Bacteria 1570
228 Ga0496105_0232489 3300048908 Bacteria 1498
229 Ga0496105_0337110 3300048908 Bacteria 1206
230 Ga0496106_1307669 3300048909 Unclassified 563
231 Ga0496107_1196264 3300048910 Bacteria 546
232 Ga0496111_0010004 3300048914 Bacteria 6347
233 Ga0496112_1419874 3300048915 Bacteria 609
234 Ga0496113_0081667 3300048916 Bacteria 2478
235 Ga0496114_0374406 3300048917 Bacteria 1260
236 Ga0496114_0689485 3300048917 Bacteria 896
237 Ga0496114_0727713 3300048917 Unclassified 869
238 Ga0496115_0583520 3300048918 Bacteria 890
239 Ga0501207_017735 3300049654 Bacteria 1113
240 nmdc:mga0k408_681283_c1 3300050493 Bacteria 603
241 nmdc:mga05p37_489837_c1 3300050507 Bacteria 1414
242 Ga0495655_0233563 3300053083 Bacteria 613
243 Ga0495619_0986973 3300053085 Bacteria 564
244 LJNas_1022900
245 LJNas_1014203
246 LJNas_1020430
247 Ga0058860_12185322
248 Ga0070658_10877922
249 Ga0070683_100066107
250 Ga0070690_100030023
251 Ga0068869_100389984
252 Ga0068869_101270941
253 Ga0070666_10018385
254 Ga0070680_100056879
255 Ga0070660_100013169
256 Ga0070661_100026602
257 Ga0070692_10330031
258 Ga0070671_100821169
259 Ga0070674_100615029
260 Ga0070688_100105678
261 Ga0070659_100035666
262 Ga0070659_100231666
263 Ga0070667_100006030
264 Ga0070667_101354542
265 Ga0070703_10522728
266 Ga0070714_100008154
267 Ga0070710_10145282
268 Ga0070700_100048087
269 Ga0070700_100594596
270 Ga0070678_100606636
271 Ga0070662_100358001
272 Ga0070681_10408893
273 Ga0068867_100310901
274 Ga0070707_100390679
275 Ga0070679_100074337
276 Ga0070684_100067732
277 Ga0070684_102104846
278 Ga0068853_100260291
279 Ga0068853_100901801
280 Ga0070672_100052804
281 Ga0070686_100088385
282 Ga0070695_100473151
283 Ga0070696_101438170
284 Ga0070665_100038066
285 Ga0068855_100398186
286 Ga0068855_100958078
287 Ga0070702_100010713
288 Ga0068852_100065170
289 Ga0068859_100001453
290 Ga0068859_100159016
291 Ga0068866_10119405
292 Ga0068861_100429919
293 Ga0068861_101641906
294 Ga0068863_100027242
295 Ga0068863_100193685
296 Ga0068858_100002038
297 Ga0068858_100759252
298 Ga0068860_100005335
299 Ga0068860_100110323
300 Ga0068860_100164783
301 Ga0068862_100083553
302 Ga0068862_100172120
303 Ga0068862_100463448
304 Ga0070717_10020935
305 Ga0070712_100881894
306 Ga0075366_10758188
307 Ga0097621_100141763
308 Ga0097621_100596333
309 Ga0068871_100038144
310 Ga0068871_100423633
311 Ga0068865_100011719
312 Ga0097620_100001453
313 Ga0097620_100159012
314 Ga0075435_100725499
315 Ga0075435_100775019
316 Ga0099795_10176356
317 Ga0105240_10773936
318 Ga0111539_12284306
319 Ga0105247_10061715
320 Ga0105247_10646700
321 Ga0114129_10140738
322 Ga0114129_12756343
323 Ga0105243_10001448
324 Ga0105242_10212151
325 Ga0105242_12633341
326 Ga0105248_10149825
327 Ga0105248_10816604
328 Ga0105248_11616092
329 Ga0105237_10570203
330 Ga0105249_10009596
331 Ga0105249_10049732
332 Ga0105249_10127993
333 Ga0105249_10217662
334 Ga0105249_10373269
335 Ga0099796_10047181
336 Ga0105246_10636952
337 Ga0157371_10009641
338 Ga0157370_10577294
339 Ga0157369_10266479
340 Ga0157378_11064575
341 Ga0163162_10078428
342 Ga0157375_10135909
343 Ga0157375_11042313
344 Ga0157379_10266784
345 Ga0157376_10264537
346 Ga0207653_10322221
347 Ga0207692_10371187
348 Ga0207642_10658722
349 Ga0207642_10980281
350 Ga0207710_10000666
351 Ga0207710_10169598
352 Ga0207710_10701986
353 Ga0207680_10102425
354 Ga0207647_10327033
355 Ga0207685_10275487
356 Ga0207699_10018469
357 Ga0207695_10268833
358 Ga0207693_10389609
359 Ga0207660_10029799
360 Ga0207657_10026981
361 Ga0207649_10369569
362 Ga0207649_11131453
363 Ga0207652_10011992
364 Ga0207694_10172883
365 Ga0207650_10421492
366 Ga0207687_10640700
367 Ga0207644_10001891
368 Ga0207690_10067546
369 Ga0207686_11561200
370 Ga0207704_10073756
371 Ga0207711_10328943
372 Ga0207711_10767873
373 Ga0207689_10016124
374 Ga0207689_10957024
375 Ga0207661_10160341
376 Ga0207667_10441128
377 Ga0207712_10004286
378 Ga0207712_10088145
379 Ga0207712_10120651
380 Ga0207712_10390588
381 Ga0207668_11179298
382 Ga0207658_10003545
383 Ga0207703_10000855
384 Ga0207703_11358169
385 Ga0207639_11201474
386 Ga0207708_10399076
387 Ga0207641_10193661
388 Ga0207641_10663849
389 Ga0207648_10093552
390 Ga0207675_100783514
391 Ga0207675_100886039
392 Ga0207683_10474674
393 Ga0209588_1000038
394 Ga0265354_1000711
395 Ga0265356_1001001
396 Ga0268266_12251231
397 Ga0268265_10043188
398 Ga0268265_10536615
399 Ga0268265_10851380
400 Ga0268264_10088499
401 Ga0268264_10300329
402 Ga0268264_10461534
403 Ga0268264_10693038
404 Ga0268264_11838888
405 Ga0307511_10052073
406 Ga0265770_1000171
407 Ga0265765_1009586
408 Ga0265760_10001437
409 Ga0265325_10045475
410 Ga0265340_10421320
411 Ga0265316_10369143
412 Ga0307513_10005412
413 Ga0307509_10000038
414 Ga0265313_10347345
415 Ga0307508_10242423
416 Ga0307516_10005145
417 Ga0307405_10587570
418 Ga0307409_100941778
419 Ga0307416_100040627
420 Ga0307416_103825468
421 Ga0316214_1058073
422 Ga0373934_0040608
423 Ga0373949_0000001
424 Ga0373923_0194034
425 Ga0373936_0008741
426 Ga0373953_0116761
427 Ga0373956_0003450
428 Ga0373957_0002943
429 Ga0373924_0083463
430 Ga0373935_1266322
431 Ga0373933_0003710
432 Ga0373937_0000108
433 Ga0395899_0333736
434 Ga0395900_0428014
435 Ga0395898_1021023
436 Ga0395905_0242144
437 Ga0395901_0011264
438 Ga0436360_0484901
439 Ga0466967_0667614
440 Ga0495592_0516262
441 Ga0495603_0008611
442 Ga0495641_0338007
443 Ga0495582_0911433
444 Ga0495639_0052911
445 Ga0495596_0089387
446 Ga0495596_0135376
447 Ga0495608_0728286
448 Ga0495618_0800541
449 Ga0495637_0336951
450 Ga0495644_0031330
451 Ga0495663_0066947
452 Ga0495587_0107148
453 Ga0495668_0652499
454 Ga0495634_0373968
455 Ga0495599_0057116
456 Ga0495670_0118947
457 Ga0495660_0284769
458 Ga0495604_0523784
459 Ga0495636_0678011
460 Ga0495676_0744391
461 Ga0495680_0716398
462 Ga0495680_0834643
463 Ga0495680_0861591
464 Ga0495677_0038224
465 Ga0495684_0150045
466 Ga0496100_0173517
467 Ga0496100_0848544
468 Ga0496101_0409339
469 Ga0496104_1208502
470 Ga0496105_0214162
471 Ga0496105_0232489
472 Ga0496105_0337110
473 Ga0496106_1307669
474 Ga0496107_1196264
475 Ga0496111_0010004
476 Ga0496112_1419874
477 Ga0496113_0081667
478 Ga0496114_0374406
479 Ga0496114_0689485
480 Ga0496114_0727713
481 Ga0496115_0583520
482 Ga0501207_017735
483 nmdc:mga0k408_681283_c1
484 nmdc:mga05p37_489837_c1
485 Ga0495655_0233563
486 Ga0495619_0986973

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

61

132

0.91

PF02311

AraC_binding

AraC-like ligand binding domain

60

132

0.88

PF00190

Cupin_1

Cupin

53

136

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4e2g-assembly2.cif.gz_C crystal structure of cupin fold protein sthe2323 from sphaerobacter thermophilus 0.9363 8 117
2oa2-assembly1.cif.gz_A-2 crystal structure of bh2720 (10175341) from bacillus halodurans at 1.41 a resolution 0.9334 27 112
6f4n-assembly1.cif.gz_A human jmjd5 in complex with mn and 2og. 0.9313 35 108
4e2g-assembly3.cif.gz_E crystal structure of cupin fold protein sthe2323 from sphaerobacter thermophilus 0.9306 7 117
7zyb-assembly1.cif.gz_A bekdgf with ca 0.9272 7 117
ID Description Score Start End Superfamily
af_Q9W0M3_161_400_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.9399 35 108 2.60.120.650
3fjsA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9297 27 111 2.60.120.10
af_Q55DF5_199_447_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.9281 37 105 2.60.120.650
2pfwB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9252 7 115 2.60.120.10
af_Q17765_350_577_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.9244 35 108 2.60.120.650
ID Description Score Start End GO Terms
AF-A0A1W9I2K5-F1-model_v4 Cupin type-2 domain-containing protein 0.994 7 125
AF-A0A2A4VYL0-F1-model_v4 Cupin 0.9919 16 125
AF-A0A2V7GQM7-F1-model_v4 Cupin domain-containing protein 0.9902 8 125
AF-A0A651HMY5-F1-model_v4 Cupin domain-containing protein 0.9896 6 122
AF-A0A838T0J1-F1-model_v4 Cupin domain-containing protein 0.9895 7 125

Map