F355144

General Info

Members Datasets Scaffolds Average Seq Length
242 199 484 701

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221690|2644503683
Length 770
Sequence THVTGSHPAPDDQAPGTLGAMQMWPGRPYPLGATYDGSGTNFALFSEVAERVELCLIADDGTETRTNLTEVDAFVWHGYLPAITPGQRYGYRVHGPYDPAQGHRCNPNKLLLDPYAKAIDGQIDGDPSLYSYDFAAPEKRNDDDSAAHTMTSVVINPYFDWGHDRPPQHEYHESVIYEAHVRGLTMQHPAVPEELRGTYAGMAHPAVIEHLTSLGVTAVELMPVHQFVNDPSLVEKGLSNYWGYNTIGFFAPHNGYAAFQHAGQQVQEFKAMVKELHAADIEVILDVVYNHTAEGNHLGPTLSFRGLDNANYYRLVDDDQAHYFDTTGTGNSLLMRSPHVLQLIMDSLRYWVLEMHVDGFRFDLAATLARQFHEVDRLSAFFDLVHQDPVVSQVKLIAEPWDVGDGGYQVGGFPPLWSEWNGKYRDTVRDFWRGEPSTLGEFASRLSGSSDLYEHTGRRPIASVNFVTAHDGFTLNDLVSYNEKHNEANGEGNNDGESHNRSWNCGVEGPTDDVSVRTLRARQRRNFLTTLLLSQGVPMIAHGDELGRTQQGNNNVYCQDGPISWVDWTLDQDETDLLEFTRRLVRLRQDHPVFRRRRFFAGEPDLADESDLLDLAWLGTDGHHMRDEAWGADHARAVMVFLNGDAIAEPDLRGQEIVDDSFLVLFNGQPDAATFTLPPARFGAVWTAVVDTDSQIEAGSTVEAGTTLELREKSIIVFTRPSILPSPTSSGIGAVAAAASEAAKQVKGRGHGEAADEKPKRRTTKPRPSA

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003285 Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
4 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
5 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
6 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
7 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
8 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
9 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
10 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
12 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
13 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
14 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
15 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
16 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
17 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
18 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
19 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
20 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
21 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
22 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
23 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
32 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
33 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
34 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
35 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
36 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
37 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
38 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
39 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
40 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
41 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
42 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
43 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
44 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
45 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
46 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
47 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
48 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
49 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
50 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
51 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
52 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
53 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
54 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
55 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
56 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
57 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
58 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
59 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
60 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
61 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
62 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
63 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
64 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
65 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
66 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
67 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
68 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
69 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
70 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
71 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
72 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
73 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
74 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
75 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
76 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
77 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
78 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
79 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
80 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
81 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
82 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
83 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
84 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
85 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
86 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
87 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
88 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
89 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
90 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
91 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
92 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
93 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
94 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
95 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
96 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
97 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
110 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
111 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
112 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
113 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
114 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
115 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
116 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
117 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
118 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
119 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
120 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
121 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
122 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
123 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
124 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
125 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
126 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
127 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
128 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
129 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
130 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
131 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
132 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
133 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
134 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
135 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
136 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
137 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
138 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
139 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
140 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
141 2643221548 Streptomyces sp. Root55 Isolate Unclassified
142 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
143 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
144 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
145 2643221647 Streptomyces sp. Root369 Isolate Unclassified
146 2643221670 Streptomyces sp. Root431 Isolate Unclassified
147 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
148 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
149 2643221692 Nocardia sp. Root136 Isolate Unclassified
150 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
151 2643221714 Streptomyces sp. Root264 Isolate Unclassified
152 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
153 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
154 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
155 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
156 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
157 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
158 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
159 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
160 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
161 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
162 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
163 2867369537 Streptomyces sp. Z26 Isolate Unclassified
164 2867428634 Streptomyces sp. RP5T Isolate Unclassified
165 2867475112 Streptomyces sp. TM32 Isolate Unclassified
166 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
167 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
168 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
169 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
170 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
171 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
172 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
173 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
174 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
175 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
176 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
177 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
178 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
179 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
180 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
181 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
182 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
183 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
184 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
185 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
186 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
187 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
188 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
189 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
190 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
191 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
192 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
193 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
194 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
195 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
196 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
197 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
198 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
199 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 72.31
Metatranscriptomes 0.41
Isolates 27.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.41
Nodule 0
Rhizoplane 0.83
Rhizosphere 80.17
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10007215 3300003203 Bacteria 5085
2 Ga0007423J48922_100269 3300003285 Bacteria 2678
3 Ga0070710_10005252 3300005437 Bacteria 6136
4 Ga0070662_100069665 3300005457 Bacteria 2589
5 Ga0070698_100003618 3300005471 Bacteria 16992
6 Ga0070698_100015730 3300005471 Bacteria 7991
7 Ga0070699_100006071 3300005518 Bacteria 10562
8 Ga0070699_100016395 3300005518 Bacteria 6364
9 Ga0070697_100002595 3300005536 Bacteria 13900
10 Ga0070704_100016089 3300005549 Bacteria 4718
11 Ga0068861_100012796 3300005719 Bacteria 5858
12 Ga0081455_10020324 3300005937 Bacteria 6258
13 Ga0081538_10000666 3300005981 Bacteria 37828
14 Ga0081538_10011097 3300005981 Bacteria 7326
15 Ga0081539_10001200 3300005985 Bacteria 46704
16 Ga0081539_10008067 3300005985 Bacteria 9323
17 Ga0070717_10001657 3300006028 Bacteria 15472
18 Ga0075427_10000778 3300006194 Bacteria 3877
19 Ga0075430_100010295 3300006846 Bacteria 7916
20 Ga0075431_100055359 3300006847 Bacteria 4091
21 Ga0075434_100046240 3300006871 Bacteria 4319
22 Ga0111539_10009363 3300009094 Bacteria 12366
23 Ga0105245_10001200 3300009098 Bacteria 23450
24 Ga0105249_10026959 3300009553 Bacteria 5182
25 Ga0157372_10040554 3300013307 Bacteria 5143
26 Ga0213876_10014872 3300021384 Bacteria 4125
27 Ga0207699_10001332 3300025906 Bacteria 11729
28 Ga0207684_10000031 3300025910 Bacteria 296401
29 Ga0207684_10002123 3300025910 Bacteria 20330
30 Ga0207646_10000031 3300025922 Bacteria 219144
31 Ga0207646_10002041 3300025922 Bacteria 24256
32 Ga0207687_10001950 3300025927 Bacteria 14195
33 Ga0207706_10036277 3300025933 Bacteria 4380
34 Ga0207639_10017870 3300026041 Bacteria 5030
35 Ga0207678_10012019 3300026067 Bacteria 7602
36 Ga0207678_10107607 3300026067 Bacteria 2378
37 Ga0207675_100005038 3300026118 Bacteria 12715
38 Ga0207428_10001040 3300027907 Bacteria 30610
39 Ga0265318_10016490 3300028577 Bacteria 3053
40 Ga0265323_10005554 3300028653 Bacteria 5350
41 Ga0307511_10036594 3300030521 Bacteria 4258
42 Ga0265316_10027663 3300031344 Bacteria 4690
43 Ga0307513_10013027 3300031456 Bacteria 10229
44 Ga0307508_10004357 3300031616 Bacteria 13848
45 Ga0316575_10000770 3300031665 Bacteria 9687
46 Ga0316576_10001737 3300031727 Bacteria 11998
47 Ga0316576_10001791 3300031727 Bacteria 11886
48 Ga0316577_10006992 3300031733 Bacteria 6000
49 Ga0307413_10018750 3300031824 Bacteria 3639
50 Ga0307406_10001203 3300031901 Bacteria 14489
51 Ga0307409_100000303 3300031995 Bacteria 20044
52 Ga0307415_100000065 3300032126 Bacteria 43936
53 Ga0307415_100037808 3300032126 Bacteria 3175
54 Ga0316583_10003255 3300032133 Bacteria 5707
55 Ga0316585_10001122 3300032137 Bacteria 6976
56 Ga0373954_0022434 3300035118 Bacteria 2863
57 Ga0316574_0007457 3300035398 Bacteria 5997
58 Ga0316574_0022135 3300035398 Bacteria 3783
59 Ga0316574_0036872 3300035398 Bacteria 2995
60 Ga0316584_0001232 3300036712 Bacteria 15120
61 Ga0316584_0018162 3300036712 Bacteria 5071
62 Ga0395898_0006944 3300037466 Bacteria 12035
63 Ga0395898_0017034 3300037466 Bacteria 7421
64 Ga0395905_0097311 3300037471 Bacteria 2763
65 Ga0316581_0000357 3300037588 Bacteria 8410
66 Ga0395901_0010604 3300038443 Bacteria 9335
67 Ga0395901_0066566 3300038443 Bacteria 3752
68 Ga0400483_145018 3300039062 Bacteria 7455
69 Ga0400483_235545 3300039062 Bacteria 2859
70 Ga0436365_0081021 3300039437 Bacteria 15657
71 Ga0436365_1787365 3300039437 Bacteria 5164
72 Ga0439440_0002436 3300042993 Bacteria 3517
73 Ga0466963_0103101 3300044694 Bacteria 1954
74 Ga0466971_0009607 3300044719 Bacteria 4221
75 Ga0466957_0009819 3300044842 Bacteria 5472
76 Ga0466967_0005030 3300045976 Bacteria 9059
77 Ga0495603_0022284 3300046455 Bacteria 3836
78 Ga0495603_0024592 3300046455 Bacteria 3643
79 Ga0495603_0025566 3300046455 Bacteria 3570
80 Ga0495629_0000868 3300046459 Bacteria 24359
81 Ga0495629_0004172 3300046459 Bacteria 10844
82 Ga0495662_0025528 3300046476 Bacteria 2853
83 Ga0495662_0026827 3300046476 Bacteria 2782
84 Ga0495585_0035505 3300046492 Bacteria 2816
85 Ga0495594_0000546 3300046499 Bacteria 19218
86 Ga0495594_0005919 3300046499 Bacteria 6284
87 Ga0495583_0022814 3300046506 Bacteria 3183
88 Ga0495608_0053015 3300046511 Bacteria 2684
89 Ga0495616_0003403 3300046513 Bacteria 10194
90 Ga0495628_0013517 3300046516 Bacteria 6866
91 Ga0495631_0004882 3300046518 Bacteria 7057
92 Ga0495640_0023170 3300046533 Bacteria 4531
93 Ga0495609_0010959 3300046538 Bacteria 4331
94 Ga0495622_0004300 3300046557 Bacteria 6631
95 Ga0495634_0028667 3300046642 Bacteria 3862
96 Ga0495634_0075437 3300046642 Bacteria 2214
97 Ga0495635_0019267 3300046663 Bacteria 4759
98 Ga0495588_0007898 3300046674 Bacteria 4861
99 Ga0495588_0021663 3300046674 Bacteria 3170
100 Ga0495657_0002219 3300046675 Bacteria 16443
101 Ga0495657_0015716 3300046675 Bacteria 5531
102 Ga0495657_0044558 3300046675 Bacteria 3017
103 Ga0495599_0031518 3300046678 Bacteria 3327
104 Ga0495623_0014608 3300046679 Bacteria 5079
105 Ga0495646_0042347 3300046680 Bacteria 2794
106 Ga0495613_0001373 3300046689 Bacteria 18549
107 Ga0495600_0015644 3300046809 Bacteria 4802
108 Ga0495581_0017982 3300047315 Bacteria 4108
109 Ga0495604_0005666 3300047317 Bacteria 9904
110 Ga0495676_0001095 3300047321 Bacteria 22965
111 Ga0495676_0001866 3300047321 Bacteria 18493
112 Ga0495676_0015829 3300047321 Bacteria 6703
113 Ga0495680_0009542 3300047322 Bacteria 8719
114 Ga0495687_006517 3300047443 Bacteria 7133
115 Ga0495675_0001121 3300047444 Bacteria 16290
116 Ga0495675_0013884 3300047444 Bacteria 5092
117 Ga0495685_006728 3300047447 Bacteria 3775
118 Ga0495602_0075920 3300048088 Bacteria 2850
119 Ga0495614_0000892 3300048089 Bacteria 12675
120 Ga0496109_0030859 3300048912 Bacteria 4805
121 Ga0496122_0000275 3300048925 Bacteria 114580
122 Ga0496122_0005433 3300048925 Bacteria 15186
123 Ga0496123_0000166 3300048926 Bacteria 131527
124 Ga0496124_0001046 3300048927 Bacteria 43693
125 Ga0496125_0000025 3300048928 Bacteria 440074
126 Ga0496125_0003883 3300048928 Bacteria 17664
127 Ga0501031_0005933 3300049568 Bacteria 7967
128 Ga0501033_0012588 3300049570 Bacteria 6455
129 Ga0501034_0078378 3300049571 Bacteria 3308
130 Ga0501036_0000066 3300049572 Bacteria 67540
131 Ga0501036_0026223 3300049572 Bacteria 4918
132 Ga0501037_0026618 3300049573 Bacteria 4274
133 Ga0501038_0001909 3300049574 Bacteria 19280
134 Ga0501038_0067900 3300049574 Bacteria 3032
135 Ga0501039_0022083 3300049575 Bacteria 4883
136 Ga0501040_0001804 3300049576 Bacteria 13748
137 Ga0501043_0058911 3300049579 Bacteria 3014
138 Ga0501046_0000684 3300049580 Bacteria 32896
139 Ga0501046_0004161 3300049580 Bacteria 13173
140 Ga0501046_0040193 3300049580 Bacteria 3739
141 Ga0501047_0000089 3300049581 Bacteria 117033
142 Ga0501047_0001176 3300049581 Bacteria 25927
143 Ga0501048_0000207 3300049582 Bacteria 38591
144 Ga0501068_0000181 3300049584 Bacteria 29335
145 Ga0501069_0006956 3300049585 Bacteria 5913
146 Ga0501070_0032604 3300049586 Bacteria 4360
147 Ga0501072_0000018 3300049588 Bacteria 158735
148 Ga0501072_0000086 3300049588 Bacteria 68239
149 Ga0501073_0031190 3300049589 Bacteria 3803
150 Ga0501073_0106543 3300049589 Bacteria 1945
151 Ga0501076_0022223 3300049592 Bacteria 4873
152 Ga0501077_0000155 3300049593 Bacteria 38326
153 Ga0501077_0003085 3300049593 Bacteria 10016
154 Ga0501079_0012086 3300049741 Bacteria 6589
155 Ga0501080_0029414 3300049742 Bacteria 5114
156 Ga0501081_0005834 3300049743 Bacteria 7969
157 Ga0501083_0020942 3300049744 Bacteria 4545
158 Ga0501044_0009088 3300049823 Bacteria 10851
159 Ga0501044_0077715 3300049823 Bacteria 3365
160 nmdc:mga00v17_40340_c1 3300050491 Bacteria 2800
161 nmdc:mga05p37_49543_c1 3300050507 Bacteria 5167
162 nmdc:mga09592_11295_c1 3300050508 Bacteria 7267
163 nmdc:mga0qj67_29351_c1 3300050509 Bacteria 4273
164 nmdc:mga06r32_3499_c1 3300050510 Bacteria 14017
165 nmdc:mga08y16_42783_c1 3300050511 Bacteria 4744
166 nmdc:mga0n895_32059_c1 3300050512 Bacteria 5040
167 nmdc:mga0a205_16633_c2 3300050515 Bacteria 5363
168 Ga0501084_0000113 3300054114 Bacteria 61155
169 Ga0501084_0011515 3300054114 Bacteria 7323
170 Ga0590075_002957 3300059424 Bacteria 4044
171 Ga0590077_000942 3300059426 Bacteria 7423
172 Ga0501082_0001276 3300060353 Bacteria 22105
173 Ga0501082_0018351 3300060353 Bacteria 6024
174 Ga0501082_0025575 3300060353 Bacteria 5087
175 Ga0530510_0003234 3300061734 Bacteria 11188
176 Ga0530510_0028899 3300061734 Bacteria 3977
177 2644503683 2643221690 Bacteria 4654705
178 2585296947 2582581312 Bacteria 7308206
179 2585307230 2582581313 Bacteria 10042643
180 2585319914 2582581314 Bacteria 11452267
181 2616699769 2616644814 Bacteria 11555299
182 2616902457 2616644941 Bacteria 8510691
183 2623499957 2622736605 Bacteria 4992138
184 2643761834 2643221548 Bacteria 8053412
185 2643943295 2643221587 Bacteria 7586415
186 2644014122 2643221601 Bacteria 7493239
187 2644175484 2643221631 Bacteria 8168043
188 2644264762 2643221647 Bacteria 10741251
189 2644388275 2643221670 Bacteria 6497041
190 2644430763 2643221677 Bacteria 7584031
191 2644460739 2643221682 Bacteria 6743283
192 2644514377 2643221692 Bacteria 7282860
193 2644525972 2643221694 Bacteria 4392972
194 2644626722 2643221714 Bacteria 9015452
195 2644633754 2643221715 Bacteria 6671032
196 2644670030 2643221722 Bacteria 4247614
197 2784591234 2784132148 Bacteria 8627943
198 2785340453 2784746763 Bacteria 9783172
199 2785372313 2784746768 Bacteria 10036182
200 2793979180 2791355406 Bacteria 11364898
201 2811843770 2808606982 Bacteria 7791042
202 2812365312 2811994880 Bacteria 4147780
203 2819743385 2818991472 Bacteria 10089953
204 2862182411 2862178590 Bacteria 8583590
205 2863409399 2863404153 Bacteria 9672205
206 2867374486 2867369537 Bacteria 6501581
207 2867433919 2867428634 Bacteria 9590268
208 2867476149 2867475112 Bacteria 6909112
209 2873153367 2873151551 Bacteria 8625867
210 2877678338 2877676314 Bacteria 9512378
211 2884995637 2884994152 Bacteria 4492978
212 2902814951 2902810491 Bacteria 6794147
213 2912716846 2912715099 Bacteria 9460473
214 2912729444 2912723979 Bacteria 8557534
215 2918507248 2918501144 Bacteria 8668083
216 2946078410 2946072368 Bacteria 8999607
217 2954010274 2954002825 Bacteria 9173742
218 2954383253 2954380949 Bacteria 10050426
219 2954693963 2954691527 Bacteria 10720516
220 2954709069 2954701450 Bacteria 10834262
221 2954713586 2954711539 Bacteria 10867210
222 2954723550 2954721474 Bacteria 10456478
223 2954738281 2954731030 Bacteria 10243860
224 2954742455 2954740390 Bacteria 10229294
225 2954757142 2954749733 Bacteria 10366972
226 2954761423 2954759201 Bacteria 9358192
227 2966600114 2966598605 Bacteria 7676064
228 2990067597 2990059506 Bacteria 9321252
229 2997459451 2997451912 Bacteria 8492419
230 2997602072 2997600082 Bacteria 9896405
231 3006327172 3006321560 Bacteria 8247479
232 3006393844 3006393351 Bacteria 6615579
233 3006430172 3006425503 Bacteria 6491253
234 8008576462 8008574985 Bacteria 7815457
235 8047895475 8047893842 Bacteria 11723082
236 8048136526 8048127548 Bacteria 11053136
237 8048363479 8048356638 Bacteria 11044339
238 8048372500 8048369669 Bacteria 11666822
239 8048381434 8048379754 Bacteria 11877923
240 8054163101 8054160619 Bacteria 7783213
241 8056667106 8056667051 Bacteria 6953971
242 8056829832 8056829672 Bacteria 9045328
243 JGI25406J46586_10007215
244 Ga0007423J48922_100269
245 Ga0070710_10005252
246 Ga0070662_100069665
247 Ga0070698_100003618
248 Ga0070698_100015730
249 Ga0070699_100006071
250 Ga0070699_100016395
251 Ga0070697_100002595
252 Ga0070704_100016089
253 Ga0068861_100012796
254 Ga0081455_10020324
255 Ga0081538_10000666
256 Ga0081538_10011097
257 Ga0081539_10001200
258 Ga0081539_10008067
259 Ga0070717_10001657
260 Ga0075427_10000778
261 Ga0075430_100010295
262 Ga0075431_100055359
263 Ga0075434_100046240
264 Ga0111539_10009363
265 Ga0105245_10001200
266 Ga0105249_10026959
267 Ga0157372_10040554
268 Ga0213876_10014872
269 Ga0207699_10001332
270 Ga0207684_10000031
271 Ga0207684_10002123
272 Ga0207646_10000031
273 Ga0207646_10002041
274 Ga0207687_10001950
275 Ga0207706_10036277
276 Ga0207639_10017870
277 Ga0207678_10012019
278 Ga0207678_10107607
279 Ga0207675_100005038
280 Ga0207428_10001040
281 Ga0265318_10016490
282 Ga0265323_10005554
283 Ga0307511_10036594
284 Ga0265316_10027663
285 Ga0307513_10013027
286 Ga0307508_10004357
287 Ga0316575_10000770
288 Ga0316576_10001737
289 Ga0316576_10001791
290 Ga0316577_10006992
291 Ga0307413_10018750
292 Ga0307406_10001203
293 Ga0307409_100000303
294 Ga0307415_100000065
295 Ga0307415_100037808
296 Ga0316583_10003255
297 Ga0316585_10001122
298 Ga0373954_0022434
299 Ga0316574_0007457
300 Ga0316574_0022135
301 Ga0316574_0036872
302 Ga0316584_0001232
303 Ga0316584_0018162
304 Ga0395898_0006944
305 Ga0395898_0017034
306 Ga0395905_0097311
307 Ga0316581_0000357
308 Ga0395901_0010604
309 Ga0395901_0066566
310 Ga0400483_145018
311 Ga0400483_235545
312 Ga0436365_0081021
313 Ga0436365_1787365
314 Ga0439440_0002436
315 Ga0466963_0103101
316 Ga0466971_0009607
317 Ga0466957_0009819
318 Ga0466967_0005030
319 Ga0495603_0022284
320 Ga0495603_0024592
321 Ga0495603_0025566
322 Ga0495629_0000868
323 Ga0495629_0004172
324 Ga0495662_0025528
325 Ga0495662_0026827
326 Ga0495585_0035505
327 Ga0495594_0000546
328 Ga0495594_0005919
329 Ga0495583_0022814
330 Ga0495608_0053015
331 Ga0495616_0003403
332 Ga0495628_0013517
333 Ga0495631_0004882
334 Ga0495640_0023170
335 Ga0495609_0010959
336 Ga0495622_0004300
337 Ga0495634_0028667
338 Ga0495634_0075437
339 Ga0495635_0019267
340 Ga0495588_0007898
341 Ga0495588_0021663
342 Ga0495657_0002219
343 Ga0495657_0015716
344 Ga0495657_0044558
345 Ga0495599_0031518
346 Ga0495623_0014608
347 Ga0495646_0042347
348 Ga0495613_0001373
349 Ga0495600_0015644
350 Ga0495581_0017982
351 Ga0495604_0005666
352 Ga0495676_0001095
353 Ga0495676_0001866
354 Ga0495676_0015829
355 Ga0495680_0009542
356 Ga0495687_006517
357 Ga0495675_0001121
358 Ga0495675_0013884
359 Ga0495685_006728
360 Ga0495602_0075920
361 Ga0495614_0000892
362 Ga0496109_0030859
363 Ga0496122_0000275
364 Ga0496122_0005433
365 Ga0496123_0000166
366 Ga0496124_0001046
367 Ga0496125_0000025
368 Ga0496125_0003883
369 Ga0501031_0005933
370 Ga0501033_0012588
371 Ga0501034_0078378
372 Ga0501036_0000066
373 Ga0501036_0026223
374 Ga0501037_0026618
375 Ga0501038_0001909
376 Ga0501038_0067900
377 Ga0501039_0022083
378 Ga0501040_0001804
379 Ga0501043_0058911
380 Ga0501046_0000684
381 Ga0501046_0004161
382 Ga0501046_0040193
383 Ga0501047_0000089
384 Ga0501047_0001176
385 Ga0501048_0000207
386 Ga0501068_0000181
387 Ga0501069_0006956
388 Ga0501070_0032604
389 Ga0501072_0000018
390 Ga0501072_0000086
391 Ga0501073_0031190
392 Ga0501073_0106543
393 Ga0501076_0022223
394 Ga0501077_0000155
395 Ga0501077_0003085
396 Ga0501079_0012086
397 Ga0501080_0029414
398 Ga0501081_0005834
399 Ga0501083_0020942
400 Ga0501044_0009088
401 Ga0501044_0077715
402 nmdc:mga00v17_40340_c1
403 nmdc:mga05p37_49543_c1
404 nmdc:mga09592_11295_c1
405 nmdc:mga0qj67_29351_c1
406 nmdc:mga06r32_3499_c1
407 nmdc:mga08y16_42783_c1
408 nmdc:mga0n895_32059_c1
409 nmdc:mga0a205_16633_c2
410 Ga0501084_0000113
411 Ga0501084_0011515
412 Ga0590075_002957
413 Ga0590077_000942
414 Ga0501082_0001276
415 Ga0501082_0018351
416 Ga0501082_0025575
417 Ga0530510_0003234
418 Ga0530510_0028899
419 2644503683
420 2585296947
421 2585307230
422 2585319914
423 2616699769
424 2616902457
425 2623499957
426 2643761834
427 2643943295
428 2644014122
429 2644175484
430 2644264762
431 2644388275
432 2644430763
433 2644460739
434 2644514377
435 2644525972
436 2644626722
437 2644633754
438 2644670030
439 2784591234
440 2785340453
441 2785372313
442 2793979180
443 2811843770
444 2812365312
445 2819743385
446 2862182411
447 2863409399
448 2867374486
449 2867433919
450 2867476149
451 2873153367
452 2877678338
453 2884995637
454 2902814951
455 2912716846
456 2912729444
457 2918507248
458 2946078410
459 2954010274
460 2954383253
461 2954693963
462 2954709069
463 2954713586
464 2954723550
465 2954738281
466 2954742455
467 2954757142
468 2954761423
469 2966600114
470 2990067597
471 2997459451
472 2997602072
473 3006327172
474 3006393844
475 3006430172
476 8008576462
477 8047895475
478 8048136526
479 8048363479
480 8048372500
481 8048381434
482 8054163101
483 8056667106
484 8056829832

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02922

CBM_48

Carbohydrate-binding module 48 (Isoamylase N-terminal domain)

30

116

0.93

PF00128

Alpha-amylase

Alpha amylase, catalytic domain

205

555

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
7u3b-assembly4.cif.gz_G structure of s. venezuelae glgx bound to c-di-gmp and acarbose (ph 8.5) 0.9359 7 691
7u3a-assembly2.cif.gz_D structure of the streptomyces venezuelae glgx-c-di-gmp complex 0.9357 7 691
7u3b-assembly1.cif.gz_C structure of s. venezuelae glgx bound to c-di-gmp and acarbose (ph 8.5) 0.9357 8 691
7u3d-assembly1.cif.gz_A structure of s. venezuelae glgx-c-di-gmp-acarbose complex (4.6) 0.9352 7 691
7u39-assembly5.cif.gz_L structure of the apo form of streptomyces venezuelae glgx, the glycogen debranching enzyme 0.9348 7 691
ID Description Score Start End Superfamily
af_P9WQ25_15_155_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.9733 4 142 2.60.40.10
2wskA01 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.9727 8 142 2.60.40.10
2wskA01 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.9654 8 142 2.60.40.10
af_P9WQ25_15_155_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.9531 4 142 2.60.40.10
2vuyA01 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.9507 2 142 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A3D0S1A0-F1-model_v4 Glycogen debranching enzyme 0.9963 6 97 GO:0004553
GO:0005975
AF-A0A6B3N7H6-F1-model_v4 Glycogen debranching enzyme 0.9953 7 89 GO:0004553
GO:0005975
AF-A0A377LRD9-F1-model_v4 Glycogen debranching protein (EC 3.2.1.-) 0.9918 5 96 GO:0004553
GO:0005975
AF-A0A6B3GXF5-F1-model_v4 Glycogen debranching enzyme 0.9885 6 102 GO:0004553
GO:0005975
AF-A0A3A1XKG3-F1-model_v4 Glycogen debranching enzyme 0.9875 6 148 GO:0004553
GO:0005975

Map