F355126

General Info

Members Datasets Scaffolds Average Seq Length
242 147 484 142

Family's Representative Sequence

Representative Sequence 3300053732|Ga0500656_008581|Ga0500656_008581_129_590
Length 153
Sequence MFGLDDKFLQDLGLDQLPEDQRQAFKEHIYSELELRVGVRLSEGLSDEQLAEFESFVDRDQAKVQAWVMTYAPQYASDSVYAQLYNQNEQNKSQGRPAMADGELLAEYASLKWLAMNRPNYRDVVTQVLEELKREISSNRDAILGNDDMPQAV

Samples

Sample ID Description Type Environment
1 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
44 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
45 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
83 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
84 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
85 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
86 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
87 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
88 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
89 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
94 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
95 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
96 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
97 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
98 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
99 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
100 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
101 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
102 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
103 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
104 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
105 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
106 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
107 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
108 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
109 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
110 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
111 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
112 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
113 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
114 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
115 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
116 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
117 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
118 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
119 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
120 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
121 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
122 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
123 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
124 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
125 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
126 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
127 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
128 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
129 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
130 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
131 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
132 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
133 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
134 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
135 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
136 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
137 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
138 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
139 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
140 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
141 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
142 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
143 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
144 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
145 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
146 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
147 3300053738 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.17
Metatranscriptomes 0.83
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.07
Nodule 0
Rhizoplane 2.48
Rhizosphere 74.38
Stem 0
Stem Tuber 0
Unclassified 14.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500656_008581 3300053732 Bacteria 1086
2 JGI24740J21852_10002798 3300001979 Bacteria 7807
3 JGI24740J21852_10011391 3300001979 Bacteria 3387
4 JGI24740J21852_10026508 3300001979 Bacteria 1941
5 JGI24739J22299_10000781 3300001989 Bacteria 11605
6 JGI24739J22299_10065906 3300001989 Bacteria 1135
7 JGI24743J22301_10014542 3300001991 Bacteria 1452
8 JGI24735J21928_10000077 3300002067 Bacteria 39575
9 JGI24738J21930_10000400 3300002075 Bacteria 12121
10 JGI24033J26618_1013240 3300002155 Unclassified 1000
11 rootH2_10000659 3300003320 Bacteria 146718
12 rootL2_10050750 3300003322 Bacteria 17435
13 rootH1_10057818 3300003323 Bacteria 17352
14 rootH1_10141767 3300003323 Bacteria 3586
15 JGI25405J52794_10003538 3300003911 Bacteria 2747
16 Ga0070658_10000035 3300005327 Bacteria 145828
17 Ga0070683_100403624 3300005329 Bacteria 1303
18 Ga0070683_100994708 3300005329 Unclassified 805
19 Ga0068868_100154731 3300005338 Unclassified 1890
20 Ga0070660_100000215 3300005339 Bacteria 38482
21 Ga0070660_100007912 3300005339 Bacteria 7417
22 Ga0070661_100041774 3300005344 Bacteria 3346
23 Ga0070661_100120443 3300005344 Unclassified 1965
24 Ga0070675_100998376 3300005354 Bacteria 768
25 Ga0070659_100004463 3300005366 Bacteria 9994
26 Ga0070662_100000332 3300005457 Bacteria 28364
27 Ga0070662_100286359 3300005457 Unclassified 1335
28 Ga0068855_100000138 3300005563 Bacteria 92676
29 Ga0068855_100000364 3300005563 Bacteria 56128
30 Ga0068855_100003673 3300005563 Bacteria 18770
31 Ga0070664_100002795 3300005564 Bacteria 14103
32 Ga0068857_100000706 3300005577 Bacteria 24865
33 Ga0068857_100006694 3300005577 Bacteria 9906
34 Ga0068854_100012216 3300005578 Bacteria 5619
35 Ga0068854_100960600 3300005578 Bacteria 754
36 Ga0068856_100000608 3300005614 Bacteria 39195
37 Ga0068856_100003088 3300005614 Bacteria 17007
38 Ga0068852_100000044 3300005616 Bacteria 89653
39 Ga0068852_100000051 3300005616 Bacteria 81538
40 Ga0068852_100059829 3300005616 Bacteria 3305
41 Ga0068864_100311725 3300005618 Bacteria 1475
42 Ga0068858_100853499 3300005842 Bacteria 889
43 Ga0081455_10000006 3300005937 Bacteria 323066
44 Ga0075365_10000034 3300006038 Bacteria 51086
45 Ga0075365_10000460 3300006038 Bacteria 15242
46 Ga0075365_10000644 3300006038 Bacteria 13843
47 Ga0075365_10021093 3300006038 Bacteria 4056
48 Ga0075364_10463134 3300006051 Unclassified 866
49 Ga0075369_10019332 3300006186 Bacteria 2781
50 Ga0075366_10000670 3300006195 Bacteria 16163
51 Ga0075370_10006261 3300006353 Bacteria 5976
52 Ga0075370_10139076 3300006353 Unclassified 1419
53 Ga0075370_10475298 3300006353 Unclassified 753
54 Ga0068871_100173196 3300006358 Bacteria 1851
55 Ga0075428_100001647 3300006844 Bacteria 23770
56 Ga0068865_100000560 3300006881 Bacteria 20677
57 Ga0105240_10000004 3300009093 Bacteria 708156
58 Ga0105240_10002095 3300009093 Bacteria 32628
59 Ga0105240_10009553 3300009093 Bacteria 13730
60 Ga0105245_10353465 3300009098 Bacteria 1457
61 Ga0105241_10008521 3300009174 Bacteria 7540
62 Ga0105241_10034396 3300009174 Unclassified 3806
63 Ga0105241_10102040 3300009174 Bacteria 2282
64 Ga0105241_10148786 3300009174 Bacteria 1913
65 Ga0105248_10225480 3300009177 Bacteria 2109
66 Ga0105237_10000002 3300009545 Bacteria 702357
67 Ga0105237_10000488 3300009545 Bacteria 56363
68 Ga0105238_10001880 3300009551 Bacteria 21077
69 Ga0105238_10369446 3300009551 Bacteria 1425
70 Ga0105238_10370767 3300009551 Bacteria 1422
71 Ga0105032_100003 3300009979 Bacteria 186985
72 Ga0105032_100032 3300009979 Bacteria 23486
73 Ga0105033_106594 3300009986 Bacteria 1004
74 Ga0105028_124041 3300009993 Unclassified 669
75 Ga0105239_10003120 3300010375 Bacteria 20559
76 Ga0105239_10019236 3300010375 Bacteria 7543
77 Ga0105246_10001198 3300011119 Bacteria 15139
78 Ga0105246_10003729 3300011119 Bacteria 9227
79 Ga0105246_10006428 3300011119 Bacteria 7183
80 Ga0105246_10569134 3300011119 Unclassified 974
81 Ga0157373_10001838 3300013100 Bacteria 16136
82 Ga0157373_10004984 3300013100 Bacteria 9978
83 Ga0157373_10010132 3300013100 Bacteria 6946
84 Ga0157373_10198583 3300013100 Bacteria 1414
85 Ga0157371_10004563 3300013102 Bacteria 12052
86 Ga0157371_10025787 3300013102 Unclassified 4280
87 Ga0157371_10033358 3300013102 Bacteria 3699
88 Ga0157370_10002860 3300013104 Bacteria 20609
89 Ga0157370_10008361 3300013104 Bacteria 11161
90 Ga0157369_10000024 3300013105 Bacteria 225851
91 Ga0157369_10000177 3300013105 Bacteria 89168
92 Ga0157369_10002122 3300013105 Bacteria 23910
93 Ga0157369_10097706 3300013105 Bacteria 3132
94 Ga0157374_10000960 3300013296 Bacteria 25007
95 Ga0157378_10658957 3300013297 Bacteria 1063
96 Ga0157372_10000002 3300013307 Bacteria 687862
97 Ga0157372_10000008 3300013307 Bacteria 305449
98 Ga0157372_10820089 3300013307 Bacteria 1080
99 Ga0163163_10185790 3300014325 Bacteria 2126
100 Ga0157377_10003036 3300014745 Bacteria 7524
101 Ga0157376_10000205 3300014969 Bacteria 40924
102 Ga0157376_10130563 3300014969 Bacteria 2241
103 Ga0206349_1617658 3300020075 Unclassified 857
104 Ga0206351_10582172 3300020077 Bacteria 963
105 Ga0207697_10074909 3300025315 Bacteria 1422
106 Ga0207647_10007844 3300025904 Bacteria 7680
107 Ga0207705_10000010 3300025909 Bacteria 518023
108 Ga0207654_10039505 3300025911 Bacteria 2654
109 Ga0207654_10070890 3300025911 Bacteria 2070
110 Ga0207695_10000009 3300025913 Bacteria 1034276
111 Ga0207695_10001907 3300025913 Bacteria 32545
112 Ga0207695_10001983 3300025913 Bacteria 31603
113 Ga0207671_10000003 3300025914 Bacteria 1065461
114 Ga0207671_10000008 3300025914 Bacteria 798229
115 Ga0207657_10009518 3300025919 Bacteria 9757
116 Ga0207649_10107697 3300025920 Bacteria 1856
117 Ga0207649_10224069 3300025920 Bacteria 1341
118 Ga0207694_10009118 3300025924 Bacteria 7489
119 Ga0207694_10111054 3300025924 Unclassified 2181
120 Ga0207694_10149078 3300025924 Bacteria 1884
121 Ga0207687_10041685 3300025927 Unclassified 3153
122 Ga0207690_10196470 3300025932 Bacteria 1529
123 Ga0207706_10001897 3300025933 Bacteria 20526
124 Ga0207704_10000232 3300025938 Bacteria 27521
125 Ga0207711_10420116 3300025941 Bacteria 1244
126 Ga0207661_10011984 3300025944 Bacteria 6298
127 Ga0207661_10863045 3300025944 Unclassified 833
128 Ga0207679_10002334 3300025945 Bacteria 11669
129 Ga0207667_10000005 3300025949 Bacteria 715503
130 Ga0207667_10000434 3300025949 Bacteria 56114
131 Ga0207667_10005303 3300025949 Bacteria 15714
132 Ga0207640_10008814 3300025981 Bacteria 5614
133 Ga0207703_10818212 3300026035 Bacteria 890
134 Ga0207702_10000190 3300026078 Bacteria 73848
135 Ga0207702_10001028 3300026078 Bacteria 28634
136 Ga0207674_10005607 3300026116 Bacteria 14881
137 Ga0207698_10000022 3300026142 Bacteria 131985
138 Ga0207698_10000073 3300026142 Bacteria 67094
139 Ga0314311_1091695 3300030733 Bacteria 2500
140 Ga0316179_1048097 3300030734 Bacteria 10717
141 Ga0316179_1115384 3300030734 Unclassified 1005
142 Ga0316180_1066695 3300030736 Bacteria 1071
143 Ga0316183_1003180 3300030742 Bacteria 30203
144 Ga0316183_1009015 3300030742 Bacteria 5486
145 Ga0316183_1014102 3300030742 Bacteria 1340
146 Ga0316183_1073484 3300030742 Bacteria 1322
147 Ga0316183_1177159 3300030742 Bacteria 9855
148 Ga0316181_1047787 3300030744 Bacteria 1442
149 Ga0316181_1095012 3300030744 Bacteria 2013
150 Ga0316181_1151728 3300030744 Bacteria 17131
151 Ga0316182_1000593 3300030745 Bacteria 17115
152 Ga0316182_1008497 3300030745 Bacteria 5463
153 Ga0316182_1030052 3300030745 Bacteria 42417
154 Ga0316182_1257558 3300030745 Unclassified 2872
155 Ga0316182_1268732 3300030745 Bacteria 15179
156 Ga0307406_10000002 3300031901 Bacteria 255753
157 Ga0307406_10000079 3300031901 Bacteria 53858
158 Ga0395899_0028500 3300037312 Unclassified 4205
159 Ga0395899_0035254 3300037312 Unclassified 3756
160 Ga0395900_0000001 3300037418 Bacteria 931146
161 Ga0395898_0000002 3300037466 Bacteria 931013
162 Ga0395901_0000006 3300038443 Bacteria 514112
163 Ga0395901_0596665 3300038443 Bacteria 1114
164 Ga0439438_003278 3300041405 Bacteria 6616
165 Ga0439447_059731 3300041407 Bacteria 898
166 Ga0439461_0035684 3300041410 Bacteria 1055
167 Ga0439466_0064837 3300041411 Bacteria 1171
168 Ga0439442_003970 3300042002 Unclassified 2932
169 Ga0439445_0001682 3300042004 Bacteria 4846
170 Ga0439432_001212 3300042006 Bacteria 9763
171 Ga0439457_100134 3300042014 Bacteria 675
172 Ga0439462_0057973 3300042015 Bacteria 1046
173 Ga0439463_023502 3300042016 Bacteria 1543
174 Ga0450906_001841 3300042145 Bacteria 4646
175 Ga0439446_0000005 3300042156 Bacteria 101649
176 Ga0439446_0003104 3300042156 Unclassified 4081
177 Ga0450909_001481 3300042185 Bacteria 3280
178 Ga0450909_033219 3300042185 Unclassified 785
179 Ga0450909_070774 3300042185 Unclassified 558
180 Ga0439434_0000771 3300042435 Bacteria 9208
181 Ga0439434_0062585 3300042435 Bacteria 1165
182 Ga0439434_0078108 3300042435 Unclassified 1048
183 Ga0439434_0205940 3300042435 Unclassified 664
184 Ga0439459_0127015 3300042438 Bacteria 648
185 Ga0439464_0000002 3300042439 Bacteria 79371
186 Ga0450918_007680 3300042531 Unclassified 1905
187 Ga0450918_098204 3300042531 Bacteria 571
188 Ga0439440_0270347 3300042993 Bacteria 522
189 Ga0453684_0713696 3300044712 Bacteria 1089
190 Ga0451576_0063554 3300045051 Bacteria 3848
191 Ga0495638_0000119 3300046460 Bacteria 127603
192 Ga0495660_0000035 3300046810 Bacteria 199140
193 Ga0495681_0178766 3300047470 Bacteria 873
194 Ga0495686_0008359 3300047472 Bacteria 7604
195 Ga0496100_0009796 3300048903 Bacteria 5398
196 Ga0496101_0375869 3300048904 Bacteria 1118
197 Ga0496108_0907807 3300048911 Bacteria 756
198 Ga0496111_0961494 3300048914 Bacteria 613
199 Ga0496113_0075467 3300048916 Unclassified 2573
200 Ga0496115_0000049 3300048918 Bacteria 109919
201 Ga0496124_0266413 3300048927 Bacteria 1257
202 Ga0501034_0001705 3300049571 Bacteria 28293
203 nmdc:mga00v17_493802_c1 3300050491 Unclassified 794
204 nmdc:mga00v17_877841_c1 3300050491 Bacteria 569
205 nmdc:mga0yw44_1150504_c1 3300050492 Bacteria 524
206 nmdc:mga0yw44_31_c1 3300050492 Bacteria 51752
207 nmdc:mga0yw44_737730_c1 3300050492 Unclassified 669
208 nmdc:mga0yw44_93_c1 3300050492 Bacteria 31138
209 nmdc:mga0k408_90_c1 3300050493 Bacteria 29972
210 nmdc:mga06z11_202586_c1 3300050494 Bacteria 1153
211 nmdc:mga07m45_150763_c1 3300050496 Unclassified 1348
212 nmdc:mga07m45_265672_c1 3300050496 Bacteria 998
213 nmdc:mga07m45_65372_c2 3300050496 Unclassified 1419
214 nmdc:mga07m45_951_c1 3300050496 Bacteria 6821
215 nmdc:mga0sz30_8311_c1 3300050516 Unclassified 3916
216 Ga0500643_008950 3300053087 Bacteria 3874
217 Ga0500643_020118 3300053087 Bacteria 2188
218 Ga0500643_028294 3300053087 Bacteria 1735
219 Ga0500644_0004601 3300053088 Bacteria 3458
220 Ga0500644_0090256 3300053088 Bacteria 1145
221 Ga0500646_0000001 3300053090 Bacteria 273936
222 Ga0500646_0018781 3300053090 Bacteria 1824
223 Ga0500583_0000140 3300053092 Bacteria 30524
224 Ga0500583_0013069 3300053092 Bacteria 3195
225 Ga0500583_0107329 3300053092 Bacteria 1372
226 Ga0500651_0000019 3300053093 Bacteria 141974
227 Ga0500641_0000001 3300053096 Bacteria 1115973
228 Ga0500650_0284701 3300053098 Unclassified 734
229 Ga0500569_000002 3300053109 Bacteria 127605
230 Ga0500594_0000024 3300053118 Bacteria 52779
231 Ga0500652_000001 3300053131 Bacteria 946868
232 Ga0500652_019449 3300053131 Bacteria 2524
233 Ga0500655_000810 3300053133 Bacteria 6138
234 Ga0500577_0026179 3300053142 Bacteria 1983
235 Ga0500588_0000039 3300053146 Bacteria 24643
236 Ga0500616_0000067 3300053153 Bacteria 236311
237 Ga0500616_0022191 3300053153 Bacteria 3549
238 Ga0500616_0074165 3300053153 Bacteria 1725
239 Ga0500570_000431 3300053724 Bacteria 16058
240 Ga0500570_141053 3300053724 Unclassified 886
241 Ga0500611_006832 3300053727 Bacteria 1684
242 Ga0500613_000453 3300053738 Bacteria 2219
243 Ga0500656_008581
244 JGI24740J21852_10002798
245 JGI24740J21852_10011391
246 JGI24740J21852_10026508
247 JGI24739J22299_10000781
248 JGI24739J22299_10065906
249 JGI24743J22301_10014542
250 JGI24735J21928_10000077
251 JGI24738J21930_10000400
252 JGI24033J26618_1013240
253 rootH2_10000659
254 rootL2_10050750
255 rootH1_10057818
256 rootH1_10141767
257 JGI25405J52794_10003538
258 Ga0070658_10000035
259 Ga0070683_100403624
260 Ga0070683_100994708
261 Ga0068868_100154731
262 Ga0070660_100000215
263 Ga0070660_100007912
264 Ga0070661_100041774
265 Ga0070661_100120443
266 Ga0070675_100998376
267 Ga0070659_100004463
268 Ga0070662_100000332
269 Ga0070662_100286359
270 Ga0068855_100000138
271 Ga0068855_100000364
272 Ga0068855_100003673
273 Ga0070664_100002795
274 Ga0068857_100000706
275 Ga0068857_100006694
276 Ga0068854_100012216
277 Ga0068854_100960600
278 Ga0068856_100000608
279 Ga0068856_100003088
280 Ga0068852_100000044
281 Ga0068852_100000051
282 Ga0068852_100059829
283 Ga0068864_100311725
284 Ga0068858_100853499
285 Ga0081455_10000006
286 Ga0075365_10000034
287 Ga0075365_10000460
288 Ga0075365_10000644
289 Ga0075365_10021093
290 Ga0075364_10463134
291 Ga0075369_10019332
292 Ga0075366_10000670
293 Ga0075370_10006261
294 Ga0075370_10139076
295 Ga0075370_10475298
296 Ga0068871_100173196
297 Ga0075428_100001647
298 Ga0068865_100000560
299 Ga0105240_10000004
300 Ga0105240_10002095
301 Ga0105240_10009553
302 Ga0105245_10353465
303 Ga0105241_10008521
304 Ga0105241_10034396
305 Ga0105241_10102040
306 Ga0105241_10148786
307 Ga0105248_10225480
308 Ga0105237_10000002
309 Ga0105237_10000488
310 Ga0105238_10001880
311 Ga0105238_10369446
312 Ga0105238_10370767
313 Ga0105032_100003
314 Ga0105032_100032
315 Ga0105033_106594
316 Ga0105028_124041
317 Ga0105239_10003120
318 Ga0105239_10019236
319 Ga0105246_10001198
320 Ga0105246_10003729
321 Ga0105246_10006428
322 Ga0105246_10569134
323 Ga0157373_10001838
324 Ga0157373_10004984
325 Ga0157373_10010132
326 Ga0157373_10198583
327 Ga0157371_10004563
328 Ga0157371_10025787
329 Ga0157371_10033358
330 Ga0157370_10002860
331 Ga0157370_10008361
332 Ga0157369_10000024
333 Ga0157369_10000177
334 Ga0157369_10002122
335 Ga0157369_10097706
336 Ga0157374_10000960
337 Ga0157378_10658957
338 Ga0157372_10000002
339 Ga0157372_10000008
340 Ga0157372_10820089
341 Ga0163163_10185790
342 Ga0157377_10003036
343 Ga0157376_10000205
344 Ga0157376_10130563
345 Ga0206349_1617658
346 Ga0206351_10582172
347 Ga0207697_10074909
348 Ga0207647_10007844
349 Ga0207705_10000010
350 Ga0207654_10039505
351 Ga0207654_10070890
352 Ga0207695_10000009
353 Ga0207695_10001907
354 Ga0207695_10001983
355 Ga0207671_10000003
356 Ga0207671_10000008
357 Ga0207657_10009518
358 Ga0207649_10107697
359 Ga0207649_10224069
360 Ga0207694_10009118
361 Ga0207694_10111054
362 Ga0207694_10149078
363 Ga0207687_10041685
364 Ga0207690_10196470
365 Ga0207706_10001897
366 Ga0207704_10000232
367 Ga0207711_10420116
368 Ga0207661_10011984
369 Ga0207661_10863045
370 Ga0207679_10002334
371 Ga0207667_10000005
372 Ga0207667_10000434
373 Ga0207667_10005303
374 Ga0207640_10008814
375 Ga0207703_10818212
376 Ga0207702_10000190
377 Ga0207702_10001028
378 Ga0207674_10005607
379 Ga0207698_10000022
380 Ga0207698_10000073
381 Ga0314311_1091695
382 Ga0316179_1048097
383 Ga0316179_1115384
384 Ga0316180_1066695
385 Ga0316183_1003180
386 Ga0316183_1009015
387 Ga0316183_1014102
388 Ga0316183_1073484
389 Ga0316183_1177159
390 Ga0316181_1047787
391 Ga0316181_1095012
392 Ga0316181_1151728
393 Ga0316182_1000593
394 Ga0316182_1008497
395 Ga0316182_1030052
396 Ga0316182_1257558
397 Ga0316182_1268732
398 Ga0307406_10000002
399 Ga0307406_10000079
400 Ga0395899_0028500
401 Ga0395899_0035254
402 Ga0395900_0000001
403 Ga0395898_0000002
404 Ga0395901_0000006
405 Ga0395901_0596665
406 Ga0439438_003278
407 Ga0439447_059731
408 Ga0439461_0035684
409 Ga0439466_0064837
410 Ga0439442_003970
411 Ga0439445_0001682
412 Ga0439432_001212
413 Ga0439457_100134
414 Ga0439462_0057973
415 Ga0439463_023502
416 Ga0450906_001841
417 Ga0439446_0000005
418 Ga0439446_0003104
419 Ga0450909_001481
420 Ga0450909_033219
421 Ga0450909_070774
422 Ga0439434_0000771
423 Ga0439434_0062585
424 Ga0439434_0078108
425 Ga0439434_0205940
426 Ga0439459_0127015
427 Ga0439464_0000002
428 Ga0450918_007680
429 Ga0450918_098204
430 Ga0439440_0270347
431 Ga0453684_0713696
432 Ga0451576_0063554
433 Ga0495638_0000119
434 Ga0495660_0000035
435 Ga0495681_0178766
436 Ga0495686_0008359
437 Ga0496100_0009796
438 Ga0496101_0375869
439 Ga0496108_0907807
440 Ga0496111_0961494
441 Ga0496113_0075467
442 Ga0496115_0000049
443 Ga0496124_0266413
444 Ga0501034_0001705
445 nmdc:mga00v17_493802_c1
446 nmdc:mga00v17_877841_c1
447 nmdc:mga0yw44_1150504_c1
448 nmdc:mga0yw44_31_c1
449 nmdc:mga0yw44_737730_c1
450 nmdc:mga0yw44_93_c1
451 nmdc:mga0k408_90_c1
452 nmdc:mga06z11_202586_c1
453 nmdc:mga07m45_150763_c1
454 nmdc:mga07m45_265672_c1
455 nmdc:mga07m45_65372_c2
456 nmdc:mga07m45_951_c1
457 nmdc:mga0sz30_8311_c1
458 Ga0500643_008950
459 Ga0500643_020118
460 Ga0500643_028294
461 Ga0500644_0004601
462 Ga0500644_0090256
463 Ga0500646_0000001
464 Ga0500646_0018781
465 Ga0500583_0000140
466 Ga0500583_0013069
467 Ga0500583_0107329
468 Ga0500651_0000019
469 Ga0500641_0000001
470 Ga0500650_0284701
471 Ga0500569_000002
472 Ga0500594_0000024
473 Ga0500652_000001
474 Ga0500652_019449
475 Ga0500655_000810
476 Ga0500577_0026179
477 Ga0500588_0000039
478 Ga0500616_0000067
479 Ga0500616_0022191
480 Ga0500616_0074165
481 Ga0500570_000431
482 Ga0500570_141053
483 Ga0500611_006832
484 Ga0500613_000453

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18908

DUF5663

Protein of unknown function (DUF5663)

8

88

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wa6-assembly3.cif.gz_B structure of yeast saga dubm with sgf73 n59d mutant at 2.36 angstroms resolution 0.4396 2 129
4wa6-assembly3.cif.gz_B structure of yeast saga dubm with sgf73 n59d mutant at 2.36 angstroms resolution 0.4267 2 129
6ar7-assembly1.cif.gz_A crystal structure of a putative uncharacterized protein from burkholderia thailandensis 0.3014 4 121
6ar7-assembly4.cif.gz_D crystal structure of a putative uncharacterized protein from burkholderia thailandensis 0.2953 3 123
5f4y-assembly1.cif.gz_B structure of the sd2 domain of human shroom2 0.2924 6 126
ID Description Score Start End Superfamily
af_K7UC54_1_387_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.3951 81 140 1.20.1270.60
af_Q24151_1_124_1.10.532.10 Mainly Alpha;Orthogonal Bundle;Transcription Factor, Stat-4;STAT transcription factor, N-terminal domain 0.3607 8 140 1.10.532.10
af_Q24151_1_602_2.60.40.630 Mainly Beta;Sandwich;Immunoglobulin-like;STAT transcription factor, DNA-binding domain 0.3544 8 139 2.60.40.630
af_A0A1D6JZZ9_41_197_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.3429 7 140 1.20.140.40
af_Q09822_14_286_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.3382 20 138 1.20.1270.60
ID Description Score Start End GO Terms
AF-A0A660LZE0-F1-model_v4 Uncharacterized protein 0.9629 1 139
AF-A0A660LZE0-F1-model_v4 Uncharacterized protein 0.9494 1 139
AF-A0A258G2R9-F1-model_v4 Trigger factor C-terminal domain-containing protein 0.924 1 139
AF-A0A4Q7VX89-F1-model_v4 Uncharacterized protein 0.9165 1 139
AF-A0A7X4ASD6-F1-model_v4 DUF2059 domain-containing protein 0.9159 1 139

Map