F354966

General Info

Members Datasets Scaffolds Average Seq Length
242 203 218 203

Family's Representative Sequence

Representative Sequence 3300046501|Ga0495607_0041605|Ga0495607_0041605_533_1213
Length 226
Sequence MDAIDFYFDFASPYGYFAATCIDELAARHRRAVRWHPIMMAAVFQETGGMPLPMVPIKGHYVLHDIDRTARQHGIAYRQPATFPQLLLGAPRAMLWIRQQYGEEQAVRYAKRCMHAYFADRVDLADDEVLGGIAAGLGIPAEAVLAAIRSREVKELLKQETSDAMARGVFGSPFVIADKEPFWGFDRFGQLEAWLAGGGVSWSYWARKPRIVSSLGHRTAPRVAGA

Samples

Sample ID Description Type Environment
1 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
2 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
3 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
4 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
5 2643221645 Massilia sp. Root351 Isolate Unclassified
6 2643221664 Massilia sp. Root418 Isolate Unclassified
7 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
8 2738541280 Massilia sp. GV090 Isolate Unclassified
9 2738541300 Massilia sp. GV016 Isolate Unclassified
10 2738543018 Massilia sp. GV045 Isolate Unclassified
11 2738543030 Massilia sp. GV097 Isolate Unclassified
12 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
13 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
14 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
15 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
16 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
17 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
18 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
19 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
20 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
21 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
22 2885266251 Ralstonia sp. SET104 Isolate Nodule
23 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
24 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
25 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
26 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
27 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
28 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
50 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
60 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
61 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
62 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
63 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
65 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
67 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
68 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
69 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
89 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
92 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
93 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
94 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
95 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
98 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
99 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
100 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
101 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
102 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
103 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
104 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
105 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
106 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
107 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
109 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
113 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
114 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
115 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
116 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
117 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
118 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
119 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
120 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
121 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
122 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
123 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
124 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
125 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
126 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
127 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
128 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
129 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
130 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
131 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
132 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
133 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
134 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
135 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
136 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
137 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
138 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
139 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
140 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
141 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
142 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
143 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
144 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
145 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
146 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
147 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
148 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
149 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
150 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
151 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
152 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
153 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
154 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
155 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
156 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
157 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
158 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
159 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
160 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
161 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
162 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
163 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
164 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
165 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
166 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
167 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
168 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
169 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
170 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
171 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
172 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
182 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
183 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
184 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
185 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
186 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
187 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
188 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
189 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
190 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
193 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
194 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
195 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
196 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
197 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
198 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
199 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
200 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
201 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
202 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
203 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.08
Metatranscriptomes 0
Isolates 9.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.48
Nodule 1.65
Rhizoplane 0
Rhizosphere 78.93
Stem 0
Stem Tuber 0
Unclassified 16.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000130 3300002704 Bacteria 35941
2 JGI25155J39150_1000230 3300002704 Bacteria 22077
3 JGI25156J39149_1000794 3300002705 Bacteria 16207
4 JGI25156J39149_1003256 3300002705 Bacteria 5393
5 JGI25154J39366_1000214 3300002738 Bacteria 40081
6 JGI25154J39366_1000439 3300002738 Bacteria 22097
7 JGI25157J39369_1000325 3300002741 Bacteria 33856
8 JGI25157J39369_1010456 3300002741 Bacteria 1220
9 Ga0055532_1000074 3300003758 Bacteria 125513
10 Ga0070683_100020373 3300005329 Bacteria 5903
11 Ga0070670_100033389 3300005331 Bacteria 4432
12 Ga0070680_100668558 3300005336 Bacteria 893
13 Ga0070700_100520509 3300005441 Bacteria 919
14 Ga0070681_10032427 3300005458 Bacteria 5243
15 Ga0070706_100470086 3300005467 Bacteria 1170
16 Ga0070696_100025121 3300005546 Bacteria 4049
17 Ga0070704_100030010 3300005549 Bacteria 3638
18 Ga0068855_100022443 3300005563 Bacteria 7565
19 Ga0068855_100332337 3300005563 Bacteria 1677
20 Ga0068857_100554534 3300005577 Bacteria 1083
21 Ga0068856_100066559 3300005614 Bacteria 3560
22 Ga0068852_100019532 3300005616 Bacteria 5365
23 Ga0068859_101037423 3300005617 Bacteria 901
24 Ga0070716_100009970 3300006173 Bacteria 4752
25 Ga0075366_10112404 3300006195 Unclassified 1639
26 Ga0075428_100490553 3300006844 Bacteria 1315
27 Ga0075431_100017790 3300006847 Bacteria 7226
28 Ga0075431_100529835 3300006847 Bacteria 1167
29 Ga0075433_10519110 3300006852 Bacteria 1048
30 Ga0075436_100008852 3300006914 Bacteria 6886
31 Ga0075436_100306448 3300006914 Bacteria 1139
32 Ga0097620_101037563 3300006931 Bacteria 901
33 Ga0099794_10204599 3300007265 Bacteria 1011
34 Ga0105251_10019613 3300009011 Bacteria 3568
35 Ga0105240_10000718 3300009093 Bacteria 60617
36 Ga0105240_10009263 3300009093 Bacteria 13965
37 Ga0111539_10067689 3300009094 Bacteria 4216
38 Ga0105237_10387152 3300009545 Bacteria 1403
39 Ga0105238_10055371 3300009551 Bacteria 3981
40 Ga0105239_11319375 3300010375 Bacteria 832
41 Ga0157373_10220364 3300013100 Bacteria 1338
42 Ga0157370_10028227 3300013104 Bacteria 5523
43 Ga0157380_10232970 3300014326 Bacteria 1655
44 Ga0182008_10240083 3300014497 Bacteria 932
45 Ga0182006_1015643 3300015261 Bacteria 3249
46 Ga0213872_10000227 3300021361 Bacteria 49306
47 Ga0209435_100055 3300025206 Bacteria 86115
48 Ga0209435_100147 3300025206 Bacteria 23484
49 Ga0209147_100097 3300025229 Bacteria 164034
50 Ga0209437_100234 3300025233 Bacteria 92856
51 Ga0209258_100192 3300025242 Bacteria 125565
52 Ga0209646_1000103 3300025246 Bacteria 164034
53 Ga0209646_1000317 3300025246 Bacteria 37175
54 Ga0209026_1000134 3300025250 Bacteria 117098
55 Ga0209026_1001192 3300025250 Bacteria 12046
56 Ga0209759_1000091 3300025256 Bacteria 164034
57 Ga0209759_1000545 3300025256 Bacteria 39039
58 Ga0207713_1030952 3300025735 Bacteria 2375
59 Ga0207699_10334788 3300025906 Bacteria 1065
60 Ga0207707_10163549 3300025912 Bacteria 1945
61 Ga0207695_10001004 3300025913 Bacteria 49973
62 Ga0207695_10017674 3300025913 Bacteria 8284
63 Ga0207660_10334278 3300025917 Bacteria 1212
64 Ga0207665_10105671 3300025939 Bacteria 1972
65 Ga0207667_10027152 3300025949 Bacteria 6239
66 Ga0207667_11064434 3300025949 Bacteria 793
67 Ga0207640_10815650 3300025981 Bacteria 809
68 Ga0207702_10047811 3300026078 Bacteria 3606
69 Ga0207674_10528060 3300026116 Bacteria 1140
70 Ga0207698_10015191 3300026142 Bacteria 5150
71 Ga0209969_1003190 3300027360 Bacteria 2268
72 Ga0209967_1009005 3300027364 Bacteria 1381
73 Ga0210000_1000267 3300027462 Bacteria 7437
74 Ga0209982_1004090 3300027552 Bacteria 2081
75 Ga0209983_1020998 3300027665 Bacteria 1364
76 Ga0209588_1129310 3300027671 Bacteria 806
77 Ga0209966_1012882 3300027695 Bacteria 1540
78 Ga0209966_1018274 3300027695 Bacteria 1342
79 Ga0209974_10004004 3300027876 Bacteria 5267
80 Ga0265324_10018067 3300029957 Bacteria 2558
81 Ga0265327_10102452 3300031251 Bacteria 1379
82 Ga0307408_100229926 3300031548 Bacteria 1518
83 Ga0265313_10001244 3300031595 Bacteria 24297
84 Ga0307413_10134284 3300031824 Bacteria 1699
85 Ga0307410_10246229 3300031852 Bacteria 1388
86 Ga0307412_10676497 3300031911 Unclassified 883
87 Ga0307409_100348297 3300031995 Bacteria 1397
88 Ga0307416_100104431 3300032002 Bacteria 2477
89 Ga0307416_101884974 3300032002 Bacteria 701
90 Ga0307415_100106293 3300032126 Bacteria 2071
91 Ga0373934_0004491 3300035086 Bacteria 5153
92 Ga0373932_0208041 3300035112 Bacteria 698
93 Ga0373936_0001316 3300035113 Bacteria 8999
94 Ga0373953_0026561 3300035117 Bacteria 2218
95 Ga0373954_0068663 3300035118 Bacteria 1681
96 Ga0373956_0013099 3300035119 Bacteria 3447
97 Ga0373957_0003311 3300035120 Bacteria 4747
98 Ga0373955_0060073 3300035172 Bacteria 2095
99 Ga0373955_0589615 3300035172 Bacteria 680
100 Ga0373924_0004686 3300035410 Bacteria 4796
101 Ga0373924_0032944 3300035410 Bacteria 2089
102 Ga0373935_0013239 3300035692 Bacteria 4975
103 Ga0373927_0170552 3300035695 Bacteria 1426
104 Ga0373933_0014702 3300035724 Bacteria 4355
105 Ga0373937_0111170 3300036401 Bacteria 2548
106 Ga0373937_0634470 3300036401 Bacteria 1013
107 Ga0373925_0247027 3300037068 Bacteria 1430
108 Ga0436360_0629881 3300039438 Bacteria 2379
109 Ga0436361_0756053 3300039447 Bacteria 1332
110 Ga0439436_0040102 3300041404 Bacteria 1343
111 Ga0451577_0441145 3300042876 Bacteria 1182
112 Ga0466969_0047514 3300044656 Bacteria 2124
113 Ga0466972_0003540 3300044658 Bacteria 7753
114 Ga0466977_0005295 3300044666 Bacteria 6687
115 Ga0453683_0006473 3300044673 Bacteria 8039
116 Ga0466965_0009867 3300044683 Bacteria 4441
117 Ga0466961_0132302 3300044693 Bacteria 1563
118 Ga0466964_0011217 3300044706 Bacteria 3384
119 Ga0453684_0000204 3300044712 Bacteria 258105
120 Ga0466968_0002257 3300044735 Bacteria 7040
121 Ga0466957_0338848 3300044842 Bacteria 1018
122 Ga0451576_0000947 3300045051 Bacteria 54449
123 Ga0495592_0004707 3300046454 Bacteria 10009
124 Ga0495592_0022956 3300046454 Bacteria 4747
125 Ga0495641_0033131 3300046461 Bacteria 2454
126 Ga0495651_0087177 3300046462 Bacteria 2347
127 Ga0495653_0002016 3300046463 Bacteria 15984
128 Ga0495580_0046680 3300046472 Bacteria 3072
129 Ga0495582_0019189 3300046473 Bacteria 3740
130 Ga0495639_0029705 3300046475 Bacteria 2426
131 Ga0495664_0123430 3300046477 Bacteria 1566
132 Ga0495607_0041605 3300046501 Bacteria 2728
133 Ga0495606_0016384 3300046507 Bacteria 5654
134 Ga0495606_0034154 3300046507 Bacteria 3495
135 Ga0495608_0130473 3300046511 Bacteria 1608
136 Ga0495618_0119563 3300046514 Bacteria 1687
137 Ga0495628_0012812 3300046516 Bacteria 7060
138 Ga0495628_0056524 3300046516 Bacteria 3088
139 Ga0495630_0200025 3300046517 Bacteria 1524
140 Ga0495652_0127523 3300046529 Bacteria 2019
141 Ga0495652_0205506 3300046529 Bacteria 1491
142 Ga0495654_0025488 3300046530 Bacteria 3045
143 Ga0495654_0109020 3300046530 Bacteria 1265
144 Ga0495665_0011435 3300046531 Bacteria 4803
145 Ga0495640_0568890 3300046533 Bacteria 686
146 Ga0495586_0013106 3300046535 Bacteria 4394
147 Ga0495587_0092767 3300046536 Bacteria 1743
148 Ga0495609_0117798 3300046538 Bacteria 1143
149 Ga0495656_0314362 3300046615 Bacteria 805
150 Ga0495625_0005458 3300046660 Bacteria 11588
151 Ga0495625_0007156 3300046660 Bacteria 9793
152 Ga0495625_0125848 3300046660 Bacteria 1740
153 Ga0495635_0081383 3300046663 Bacteria 2216
154 Ga0495659_0000469 3300046664 Bacteria 14940
155 Ga0495657_0053069 3300046675 Bacteria 2714
156 Ga0495599_0001808 3300046678 Bacteria 12415
157 Ga0495613_0035917 3300046689 Bacteria 3675
158 Ga0495624_0059380 3300046690 Bacteria 2400
159 Ga0495671_0002480 3300046692 Bacteria 11642
160 Ga0495660_0001040 3300046810 Bacteria 20119
161 Ga0495581_0095873 3300047315 Bacteria 1723
162 Ga0495604_0008981 3300047317 Bacteria 7904
163 Ga0495604_0055084 3300047317 Bacteria 3066
164 Ga0495636_0004542 3300047318 Bacteria 5440
165 Ga0495674_0036674 3300047319 Bacteria 4411
166 Ga0495672_0002908 3300047320 Bacteria 15156
167 Ga0495680_0107087 3300047322 Bacteria 2076
168 Ga0495684_0018122 3300047471 Bacteria 5427
169 Ga0495686_0033413 3300047472 Bacteria 3321
170 Ga0495614_0034009 3300048089 Bacteria 2192
171 Ga0496116_0019852 3300048919 Bacteria 5129
172 Ga0496121_0012066 3300048924 Bacteria 9494
173 Ga0496121_0083479 3300048924 Bacteria 2522
174 Ga0496121_0563308 3300048924 Bacteria 710
175 Ga0496122_0004071 3300048925 Bacteria 18553
176 Ga0496123_0000912 3300048926 Bacteria 46427
177 Ga0496125_0008520 3300048928 Bacteria 10718
178 Ga0496125_0078443 3300048928 Bacteria 2538
179 Ga0501031_0363480 3300049568 Bacteria 936
180 Ga0501036_0022007 3300049572 Bacteria 5361
181 Ga0501037_0181926 3300049573 Bacteria 1491
182 Ga0501038_0003880 3300049574 Bacteria 13899
183 Ga0501039_0003424 3300049575 Bacteria 11840
184 Ga0501039_0230562 3300049575 Bacteria 1456
185 Ga0501040_0163030 3300049576 Bacteria 1576
186 Ga0501041_0353584 3300049577 Bacteria 929
187 Ga0501046_0384369 3300049580 Bacteria 1015
188 Ga0501048_0011158 3300049582 Bacteria 6699
189 Ga0501068_0050376 3300049584 Bacteria 2517
190 Ga0501069_0120719 3300049585 Bacteria 1497
191 Ga0501072_0042743 3300049588 Bacteria 3560
192 Ga0501075_0000416 3300049591 Bacteria 24892
193 Ga0501075_0006388 3300049591 Bacteria 8114
194 Ga0501076_0063958 3300049592 Bacteria 2932
195 Ga0501076_0093304 3300049592 Bacteria 2422
196 Ga0501077_0040900 3300049593 Bacteria 2952
197 Ga0501079_0005377 3300049741 Bacteria 9535
198 Ga0501079_0109960 3300049741 Bacteria 2141
199 Ga0501079_0218794 3300049741 Bacteria 1488
200 Ga0501080_0020095 3300049742 Bacteria 6180
201 Ga0501081_0001594 3300049743 Bacteria 13990
202 Ga0501035_0004307 3300049822 Bacteria 13522
203 Ga0501035_0165706 3300049822 Bacteria 1911
204 Ga0501044_0037774 3300049823 Bacteria 5046
205 Ga0501044_0592615 3300049823 Unclassified 1002
206 Ga0501045_0000120 3300049824 Bacteria 40494
207 Ga0501045_0329513 3300049824 Bacteria 1136
208 nmdc:mga06r32_99680_c1 3300050510 Bacteria 2850
209 nmdc:mga08x19_15821_c1 3300050514 Bacteria 4594
210 nmdc:mga0a205_569255_c1 3300050515 Bacteria 987
211 Ga0495601_0004413 3300053077 Bacteria 8130
212 Ga0495595_0147464 3300053084 Bacteria 1156
213 Ga0495619_0134922 3300053085 Bacteria 1697
214 Ga0500618_001830 3300053125 Bacteria 8892
215 Ga0501084_0000861 3300054114 Bacteria 23412
216 Ga0501082_0020433 3300060353 Bacteria 5709
217 Ga0530510_0001230 3300061734 Bacteria 17093
218 Ga0530510_0493729 3300061734 Bacteria 928

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031251 Ga0265327_10102452 Ga0265327_101024522 184
2 3300002705 JGI25156J39149_1003256 JGI25156J39149_10032563 193
3 iso_pu_bacteria 2739367655 2739612262 193
4 iso_pu_bacteria 2643221645 2644250473 195
5 iso_pu_bacteria 2643221664 2644358791 195
6 iso_pu_bacteria 2738541280 2738738749 195
7 iso_pu_bacteria 2738541300 2738842432 195
8 iso_pu_bacteria 2738543018 2739273179 195
9 iso_pu_bacteria 2738543030 2739342223 195
10 iso_pu_bacteria 2522572158 2523104843 196
11 iso_pu_bacteria 2596583598 2597031384 196
12 iso_pu_bacteria 2765235838 2765571858 196
13 iso_pu_bacteria 2818991449 2819617299 196
14 iso_pu_bacteria 2839094727 2839098421 196
15 iso_pu_bacteria 2881927736 2881930369 196
16 iso_pu_bacteria 2885266251 2885270065 196
17 iso_pu_bacteria 2834641062 2834644137 197
18 iso_pu_bacteria 8003400568 8003404290 197
19 iso_pu_bacteria 2721755763 2723876137 198
20 3300005336 Ga0070680_100668558 Ga0070680_1006685581 199
21 3300009094 Ga0111539_10067689 Ga0111539_100676894 199
22 3300014326 Ga0157380_10232970 Ga0157380_102329702 199
23 3300025917 Ga0207660_10334278 Ga0207660_103342782 199
24 3300046501 Ga0495607_0041605 Ga0495607_0041605_533_1213 199
25 3300046507 Ga0495606_0016384 Ga0495606_0016384_3287_3964 199
26 3300046507 Ga0495606_0034154 Ga0495606_0034154_2018_2698 199
27 3300046530 Ga0495654_0025488 Ga0495654_0025488_257_934 199
28 3300046538 Ga0495609_0117798 Ga0495609_0117798_244_924 199
29 3300046615 Ga0495656_0314362 Ga0495656_0314362_80_760 199
30 3300046660 Ga0495625_0005458 Ga0495625_0005458_261_938 199
31 3300046660 Ga0495625_0125848 Ga0495625_0125848_30_710 199
32 3300046664 Ga0495659_0000469 Ga0495659_0000469_9140_9817 199
33 3300046692 Ga0495671_0002480 Ga0495671_0002480_3319_3996 199
34 3300046810 Ga0495660_0001040 Ga0495660_0001040_16440_17120 199
35 3300047320 Ga0495672_0002908 Ga0495672_0002908_8260_8937 199
36 3300047472 Ga0495686_0033413 Ga0495686_0033413_1702_2382 199
37 iso_pu_bacteria 2511231003 2511250534 199
38 iso_pu_bacteria 2548876994 2550694175 199
39 iso_pu_bacteria 2818991445 2819595390 199
40 iso_pu_bacteria 2884811622 2884816212 199
41 iso_pu_bacteria 2884836552 2884839345 199
42 iso_pu_bacteria 2884852848 2884856845 199
43 iso_pu_bacteria 2896154374 2896158191 199
44 3300005329 Ga0070683_100020373 Ga0070683_1000203731 200
45 3300005441 Ga0070700_100520509 Ga0070700_1005205092 200
46 3300005458 Ga0070681_10032427 Ga0070681_100324276 200
47 3300005467 Ga0070706_100470086 Ga0070706_1004700861 200
48 3300005546 Ga0070696_100025121 Ga0070696_1000251213 200
49 3300005549 Ga0070704_100030010 Ga0070704_1000300103 200
50 3300005617 Ga0068859_101037423 Ga0068859_1010374232 200
51 3300006173 Ga0070716_100009970 Ga0070716_1000099702 200
52 3300006195 Ga0075366_10112404 Ga0075366_101124042 200
53 3300006844 Ga0075428_100490553 Ga0075428_1004905532 200
54 3300006847 Ga0075431_100017790 Ga0075431_1000177903 200
55 3300006847 Ga0075431_100529835 Ga0075431_1005298352 200
56 3300006852 Ga0075433_10519110 Ga0075433_105191102 200
57 3300006914 Ga0075436_100008852 Ga0075436_1000088524 200
58 3300006914 Ga0075436_100306448 Ga0075436_1003064482 200
59 3300006931 Ga0097620_101037563 Ga0097620_1010375632 200
60 3300007265 Ga0099794_10204599 Ga0099794_102045991 200
61 3300013104 Ga0157370_10028227 Ga0157370_100282275 200
62 3300021361 Ga0213872_10000227 Ga0213872_1000022723 200
63 3300025906 Ga0207699_10334788 Ga0207699_103347882 200
64 3300025912 Ga0207707_10163549 Ga0207707_101635492 200
65 3300025939 Ga0207665_10105671 Ga0207665_101056712 200
66 3300027360 Ga0209969_1003190 Ga0209969_10031903 200
67 3300027364 Ga0209967_1009005 Ga0209967_10090052 200
68 3300027462 Ga0210000_1000267 Ga0210000_10002672 200
69 3300027552 Ga0209982_1004090 Ga0209982_10040902 200
70 3300027665 Ga0209983_1020998 Ga0209983_10209982 200
71 3300027671 Ga0209588_1129310 Ga0209588_11293102 200
72 3300027695 Ga0209966_1012882 Ga0209966_10128822 200
73 3300027695 Ga0209966_1018274 Ga0209966_10182742 200
74 3300027876 Ga0209974_10004004 Ga0209974_100040045 200
75 3300029957 Ga0265324_10018067 Ga0265324_100180673 200
76 3300031548 Ga0307408_100229926 Ga0307408_1002299262 200
77 3300031595 Ga0265313_10001244 Ga0265313_1000124422 200
78 3300031824 Ga0307413_10134284 Ga0307413_101342842 200
79 3300031852 Ga0307410_10246229 Ga0307410_102462292 200
80 3300031911 Ga0307412_10676497 Ga0307412_106764971 200
81 3300031995 Ga0307409_100348297 Ga0307409_1003482972 200
82 3300032002 Ga0307416_100104431 Ga0307416_1001044312 200
83 3300032002 Ga0307416_101884974 Ga0307416_1018849741 200
84 3300032126 Ga0307415_100106293 Ga0307415_1001062932 200
85 3300035086 Ga0373934_0004491 Ga0373934_0004491_1352_1954 200
86 3300035112 Ga0373932_0208041 Ga0373932_0208041_11_616 200
87 3300035113 Ga0373936_0001316 Ga0373936_0001316_3161_3763 200
88 3300035117 Ga0373953_0026561 Ga0373953_0026561_18_620 200
89 3300035118 Ga0373954_0068663 Ga0373954_0068663_925_1527 200
90 3300035119 Ga0373956_0013099 Ga0373956_0013099_464_1066 200
91 3300035120 Ga0373957_0003311 Ga0373957_0003311_3501_4103 200
92 3300035172 Ga0373955_0060073 Ga0373955_0060073_1476_2078 200
93 3300035172 Ga0373955_0589615 Ga0373955_0589615_18_620 200
94 3300035410 Ga0373924_0004686 Ga0373924_0004686_1219_1821 200
95 3300035410 Ga0373924_0032944 Ga0373924_0032944_151_753 200
96 3300035692 Ga0373935_0013239 Ga0373935_0013239_3449_4051 200
97 3300035695 Ga0373927_0170552 Ga0373927_0170552_778_1380 200
98 3300035724 Ga0373933_0014702 Ga0373933_0014702_3610_4212 200
99 3300036401 Ga0373937_0111170 Ga0373937_0111170_1370_1972 200
100 3300036401 Ga0373937_0634470 Ga0373937_0634470_75_677 200
101 3300037068 Ga0373925_0247027 Ga0373925_0247027_778_1380 200
102 3300039438 Ga0436360_0629881 Ga0436360_0629881_1033_1635 200
103 3300039447 Ga0436361_0756053 Ga0436361_0756053_105_710 200
104 3300041404 Ga0439436_0040102 Ga0439436_0040102_365_973 200
105 3300042876 Ga0451577_0441145 Ga0451577_0441145_412_1014 200
106 3300044656 Ga0466969_0047514 Ga0466969_0047514_698_1303 200
107 3300044658 Ga0466972_0003540 Ga0466972_0003540_2044_2649 200
108 3300044666 Ga0466977_0005295 Ga0466977_0005295_1008_1613 200
109 3300044673 Ga0453683_0006473 Ga0453683_0006473_6577_7188 200
110 3300044683 Ga0466965_0009867 Ga0466965_0009867_2040_2645 200
111 3300044693 Ga0466961_0132302 Ga0466961_0132302_64_669 200
112 3300044706 Ga0466964_0011217 Ga0466964_0011217_906_1511 200
113 3300044712 Ga0453684_0000204 Ga0453684_0000204_40824_41429 200
114 3300044735 Ga0466968_0002257 Ga0466968_0002257_1841_2446 200
115 3300044842 Ga0466957_0338848 Ga0466957_0338848_395_1000 200
116 3300045051 Ga0451576_0000947 Ga0451576_0000947_11923_12534 200
117 3300046454 Ga0495592_0004707 Ga0495592_0004707_2997_3599 200
118 3300046454 Ga0495592_0022956 Ga0495592_0022956_2465_3067 200
119 3300046461 Ga0495641_0033131 Ga0495641_0033131_105_707 200
120 3300046462 Ga0495651_0087177 Ga0495651_0087177_55_657 200
121 3300046463 Ga0495653_0002016 Ga0495653_0002016_1083_1685 200
122 3300046472 Ga0495580_0046680 Ga0495580_0046680_1022_1624 200
123 3300046473 Ga0495582_0019189 Ga0495582_0019189_774_1376 200
124 3300046475 Ga0495639_0029705 Ga0495639_0029705_1340_1942 200
125 3300046477 Ga0495664_0123430 Ga0495664_0123430_883_1485 200
126 3300046511 Ga0495608_0130473 Ga0495608_0130473_150_752 200
127 3300046514 Ga0495618_0119563 Ga0495618_0119563_726_1328 200
128 3300046516 Ga0495628_0012812 Ga0495628_0012812_4754_5356 200
129 3300046516 Ga0495628_0056524 Ga0495628_0056524_1470_2072 200
130 3300046517 Ga0495630_0200025 Ga0495630_0200025_33_635 200
131 3300046529 Ga0495652_0127523 Ga0495652_0127523_1180_1782 200
132 3300046529 Ga0495652_0205506 Ga0495652_0205506_139_741 200
133 3300046531 Ga0495665_0011435 Ga0495665_0011435_3397_3999 200
134 3300046533 Ga0495640_0568890 Ga0495640_0568890_56_658 200
135 3300046535 Ga0495586_0013106 Ga0495586_0013106_645_1247 200
136 3300046536 Ga0495587_0092767 Ga0495587_0092767_973_1575 200
137 3300046663 Ga0495635_0081383 Ga0495635_0081383_480_1082 200
138 3300046675 Ga0495657_0053069 Ga0495657_0053069_1468_2070 200
139 3300046678 Ga0495599_0001808 Ga0495599_0001808_3666_4268 200
140 3300046689 Ga0495613_0035917 Ga0495613_0035917_1387_1989 200
141 3300046690 Ga0495624_0059380 Ga0495624_0059380_1318_1920 200
142 3300047315 Ga0495581_0095873 Ga0495581_0095873_1017_1619 200
143 3300047317 Ga0495604_0008981 Ga0495604_0008981_6774_7529 200
144 3300047317 Ga0495604_0055084 Ga0495604_0055084_1220_1822 200
145 3300047318 Ga0495636_0004542 Ga0495636_0004542_24_626 200
146 3300047319 Ga0495674_0036674 Ga0495674_0036674_2233_2835 200
147 3300047322 Ga0495680_0107087 Ga0495680_0107087_1370_1972 200
148 3300047471 Ga0495684_0018122 Ga0495684_0018122_4466_5068 200
149 3300048089 Ga0495614_0034009 Ga0495614_0034009_786_1388 200
150 3300049568 Ga0501031_0363480 Ga0501031_0363480_147_749 200
151 3300049572 Ga0501036_0022007 Ga0501036_0022007_4110_4712 200
152 3300049573 Ga0501037_0181926 Ga0501037_0181926_482_1090 200
153 3300049574 Ga0501038_0003880 Ga0501038_0003880_10839_11441 200
154 3300049575 Ga0501039_0003424 Ga0501039_0003424_5485_6087 200
155 3300049575 Ga0501039_0230562 Ga0501039_0230562_783_1385 200
156 3300049576 Ga0501040_0163030 Ga0501040_0163030_599_1201 200
157 3300049577 Ga0501041_0353584 Ga0501041_0353584_127_729 200
158 3300049580 Ga0501046_0384369 Ga0501046_0384369_20_622 200
159 3300049582 Ga0501048_0011158 Ga0501048_0011158_4682_5284 200
160 3300049584 Ga0501068_0050376 Ga0501068_0050376_693_1295 200
161 3300049585 Ga0501069_0120719 Ga0501069_0120719_637_1239 200
162 3300049588 Ga0501072_0042743 Ga0501072_0042743_2316_2918 200
163 3300049591 Ga0501075_0000416 Ga0501075_0000416_23472_24074 200
164 3300049591 Ga0501075_0006388 Ga0501075_0006388_7078_7680 200
165 3300049592 Ga0501076_0063958 Ga0501076_0063958_434_1036 200
166 3300049592 Ga0501076_0093304 Ga0501076_0093304_993_1595 200
167 3300049593 Ga0501077_0040900 Ga0501077_0040900_1788_2390 200
168 3300049741 Ga0501079_0005377 Ga0501079_0005377_7198_7800 200
169 3300049741 Ga0501079_0109960 Ga0501079_0109960_1102_1704 200
170 3300049741 Ga0501079_0218794 Ga0501079_0218794_798_1400 200
171 3300049742 Ga0501080_0020095 Ga0501080_0020095_3653_4255 200
172 3300049743 Ga0501081_0001594 Ga0501081_0001594_13327_13929 200
173 3300049822 Ga0501035_0004307 Ga0501035_0004307_11119_11727 200
174 3300049822 Ga0501035_0165706 Ga0501035_0165706_536_1138 200
175 3300049823 Ga0501044_0037774 Ga0501044_0037774_3619_4227 200
176 3300049823 Ga0501044_0592615 Ga0501044_0592615_337_942 200
177 3300049824 Ga0501045_0000120 Ga0501045_0000120_19496_20098 200
178 3300049824 Ga0501045_0329513 Ga0501045_0329513_93_695 200
179 3300050510 nmdc:mga06r32_99680_c1 nmdc:mga06r32_99680_c1_512_1114 200
180 3300050514 nmdc:mga08x19_15821_c1 nmdc:mga08x19_15821_c1_417_1019 200
181 3300050515 nmdc:mga0a205_569255_c1 nmdc:mga0a205_569255_c1_269_871 200
182 3300053077 Ga0495601_0004413 Ga0495601_0004413_2636_3238 200
183 3300053084 Ga0495595_0147464 Ga0495595_0147464_487_1089 200
184 3300053085 Ga0495619_0134922 Ga0495619_0134922_926_1528 200
185 3300053125 Ga0500618_001830 Ga0500618_001830_1082_1684 200
186 3300054114 Ga0501084_0000861 Ga0501084_0000861_20464_21066 200
187 3300060353 Ga0501082_0020433 Ga0501082_0020433_4481_5083 200
188 3300061734 Ga0530510_0001230 Ga0530510_0001230_3573_4175 200
189 3300061734 Ga0530510_0493729 Ga0530510_0493729_312_914 200
190 3300002704 JGI25155J39150_1000130 JGI25155J39150_10001309 203
191 3300002704 JGI25155J39150_1000230 JGI25155J39150_10002308 203
192 3300002705 JGI25156J39149_1000794 JGI25156J39149_10007948 203
193 3300002738 JGI25154J39366_1000214 JGI25154J39366_10002148 203
194 3300002738 JGI25154J39366_1000439 JGI25154J39366_10004398 203
195 3300002741 JGI25157J39369_1000325 JGI25157J39369_10003258 203
196 3300002741 JGI25157J39369_1010456 JGI25157J39369_10104562 203
197 3300003758 Ga0055532_1000074 Ga0055532_100007450 203
198 3300005331 Ga0070670_100033389 Ga0070670_1000333893 203
199 3300005563 Ga0068855_100022443 Ga0068855_1000224436 203
200 3300005563 Ga0068855_100332337 Ga0068855_1003323372 203
201 3300005577 Ga0068857_100554534 Ga0068857_1005545341 203
202 3300005614 Ga0068856_100066559 Ga0068856_1000665592 203
203 3300005616 Ga0068852_100019532 Ga0068852_1000195323 203
204 3300009011 Ga0105251_10019613 Ga0105251_100196133 203
205 3300009093 Ga0105240_10000718 Ga0105240_1000071849 203
206 3300009093 Ga0105240_10009263 Ga0105240_100092636 203
207 3300009545 Ga0105237_10387152 Ga0105237_103871522 203
208 3300009551 Ga0105238_10055371 Ga0105238_100553713 203
209 3300010375 Ga0105239_11319375 Ga0105239_113193751 203
210 3300013100 Ga0157373_10220364 Ga0157373_102203642 203
211 3300014497 Ga0182008_10240083 Ga0182008_102400832 203
212 3300015261 Ga0182006_1015643 Ga0182006_10156433 203
213 3300025206 Ga0209435_100055 Ga0209435_10005549 203
214 3300025206 Ga0209435_100147 Ga0209435_10014717 203
215 3300025229 Ga0209147_100097 Ga0209147_10009783 203
216 3300025233 Ga0209437_100234 Ga0209437_10023481 203
217 3300025242 Ga0209258_100192 Ga0209258_10019249 203
218 3300025246 Ga0209646_1000103 Ga0209646_100010383 203
219 3300025246 Ga0209646_1000317 Ga0209646_100031711 203
220 3300025250 Ga0209026_1000134 Ga0209026_100013449 203
221 3300025250 Ga0209026_1001192 Ga0209026_10011924 203
222 3300025256 Ga0209759_1000091 Ga0209759_100009183 203
223 3300025256 Ga0209759_1000545 Ga0209759_10005458 203
224 3300025735 Ga0207713_1030952 Ga0207713_10309523 203
225 3300025913 Ga0207695_10001004 Ga0207695_100010049 203
226 3300025913 Ga0207695_10017674 Ga0207695_100176746 203
227 3300025949 Ga0207667_10027152 Ga0207667_100271523 203
228 3300025949 Ga0207667_11064434 Ga0207667_110644341 203
229 3300025981 Ga0207640_10815650 Ga0207640_108156501 203
230 3300026078 Ga0207702_10047811 Ga0207702_100478112 203
231 3300026116 Ga0207674_10528060 Ga0207674_105280602 203
232 3300026142 Ga0207698_10015191 Ga0207698_100151914 203
233 3300046530 Ga0495654_0109020 Ga0495654_0109020_380_991 203
234 3300046660 Ga0495625_0007156 Ga0495625_0007156_924_1535 203
235 3300048919 Ga0496116_0019852 Ga0496116_0019852_4245_4856 203
236 3300048924 Ga0496121_0012066 Ga0496121_0012066_1462_2073 203
237 3300048924 Ga0496121_0083479 Ga0496121_0083479_465_1076 203
238 3300048924 Ga0496121_0563308 Ga0496121_0563308_69_680 203
239 3300048925 Ga0496122_0004071 Ga0496122_0004071_9752_10363 203
240 3300048926 Ga0496123_0000912 Ga0496123_0000912_37440_38051 203
241 3300048928 Ga0496125_0008520 Ga0496125_0008520_8254_8865 203
242 3300048928 Ga0496125_0078443 Ga0496125_0078443_1452_2063 203

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01323

DSBA

DSBA-like thioredoxin domain

3

196

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fz5-assembly2.cif.gz_D crystal structure of possible 2-hydroxychromene-2-carboxylate isomerase from rhodobacter sphaeroides 0.9581 7 203
3fz5-assembly2.cif.gz_D crystal structure of possible 2-hydroxychromene-2-carboxylate isomerase from rhodobacter sphaeroides 0.9432 7 203
3fz5-assembly1.cif.gz_A crystal structure of possible 2-hydroxychromene-2-carboxylate isomerase from rhodobacter sphaeroides 0.9321 7 203
3fz5-assembly1.cif.gz_A crystal structure of possible 2-hydroxychromene-2-carboxylate isomerase from rhodobacter sphaeroides 0.9133 7 203
2imd-assembly1.cif.gz_A structure of semet 2-hydroxychromene-2-carboxylate isomerase (hcca isomerase) 0.911 8 199
ID Description Score Start End Superfamily
3fz5D00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9534 7 203 3.40.30.10
3fz5D00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9433 7 203 3.40.30.10
af_Q09652_5_211_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9281 7 200 3.40.30.10
af_Q18973_4_212_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9162 7 200 3.40.30.10
2imdA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8954 9 199 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7V8FYP5-F1-model_v4 2-hydroxychromene-2-carboxylate isomerase (EC 5.99.1.4) 0.9934 5 203 GO:0004364
GO:0004602
GO:0006749
GO:0018845
GO:1901170
AF-A0A5C1E434-F1-model_v4 2-hydroxychromene-2-carboxylate isomerase (EC 5.99.1.4) 0.9923 5 201 GO:0004364
GO:0004602
GO:0006749
GO:0018845
GO:1901170
AF-A0A4R6E3M5-F1-model_v4 2-hydroxychromene-2-carboxylate isomerase (EC 5.99.1.4) 0.9911 9 203 GO:0004364
GO:0004602
GO:0006749
GO:0018845
GO:1901170
AF-A0A011QJD9-F1-model_v4 2-hydroxychromene-2-carboxylate isomerase 0.9903 1 203 GO:0004364
GO:0004602
GO:0006749
GO:0018845
GO:1901170
AF-A0A178MDZ7-F1-model_v4 2-hydroxychromene-2-carboxylate isomerase (EC 5.99.1.4) 0.988 5 203 GO:0004364
GO:0004602
GO:0006749
GO:0018845
GO:1901170

Feature Viewer

pLDDT pTM Quality
94.35 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map