F354966
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 242 | 203 | 218 | 203 |
Family's Representative Sequence
| Representative Sequence | 3300046501|Ga0495607_0041605|Ga0495607_0041605_533_1213 |
| Length | 226 |
| Sequence | MDAIDFYFDFASPYGYFAATCIDELAARHRRAVRWHPIMMAAVFQETGGMPLPMVPIKGHYVLHDIDRTARQHGIAYRQPATFPQLLLGAPRAMLWIRQQYGEEQAVRYAKRCMHAYFADRVDLADDEVLGGIAAGLGIPAEAVLAAIRSREVKELLKQETSDAMARGVFGSPFVIADKEPFWGFDRFGQLEAWLAGGGVSWSYWARKPRIVSSLGHRTAPRVAGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 2 | 2522572158 | Azospirillum halopraeferens DSM 3675 | Isolate | Unclassified |
| 3 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 4 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 5 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 6 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 7 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 8 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 9 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 10 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 11 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 12 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 13 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 14 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 15 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 16 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 17 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 18 | 2881927736 | Candidimonas sp. SYP-B2681 | Isolate | Rhizosphere |
| 19 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 20 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 21 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 22 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 23 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 24 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 25 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 26 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 27 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 28 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 29 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 42 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 44 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 45 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 46 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 47 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 48 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 50 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 60 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 61 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 62 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 63 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 67 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 68 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 69 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 89 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 90 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 91 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 92 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 93 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 94 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 95 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 96 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 97 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 98 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 99 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 100 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 101 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 102 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 103 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 104 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 105 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 106 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 107 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 108 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 109 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 110 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 111 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 112 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 113 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 114 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 115 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 116 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 117 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 118 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 119 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 120 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 121 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 122 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 123 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 124 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 125 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 126 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 127 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 168 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 169 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 170 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 171 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 172 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 178 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 183 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 185 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 186 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 188 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 190 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 193 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 194 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 195 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 196 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 200 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 201 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 203 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.08 |
| Metatranscriptomes | 0 |
| Isolates | 9.92 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.48 |
| Nodule | 1.65 |
| Rhizoplane | 0 |
| Rhizosphere | 78.93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 16.94 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25155J39150_1000130 | 3300002704 | Bacteria | 35941 |
| 2 | JGI25155J39150_1000230 | 3300002704 | Bacteria | 22077 |
| 3 | JGI25156J39149_1000794 | 3300002705 | Bacteria | 16207 |
| 4 | JGI25156J39149_1003256 | 3300002705 | Bacteria | 5393 |
| 5 | JGI25154J39366_1000214 | 3300002738 | Bacteria | 40081 |
| 6 | JGI25154J39366_1000439 | 3300002738 | Bacteria | 22097 |
| 7 | JGI25157J39369_1000325 | 3300002741 | Bacteria | 33856 |
| 8 | JGI25157J39369_1010456 | 3300002741 | Bacteria | 1220 |
| 9 | Ga0055532_1000074 | 3300003758 | Bacteria | 125513 |
| 10 | Ga0070683_100020373 | 3300005329 | Bacteria | 5903 |
| 11 | Ga0070670_100033389 | 3300005331 | Bacteria | 4432 |
| 12 | Ga0070680_100668558 | 3300005336 | Bacteria | 893 |
| 13 | Ga0070700_100520509 | 3300005441 | Bacteria | 919 |
| 14 | Ga0070681_10032427 | 3300005458 | Bacteria | 5243 |
| 15 | Ga0070706_100470086 | 3300005467 | Bacteria | 1170 |
| 16 | Ga0070696_100025121 | 3300005546 | Bacteria | 4049 |
| 17 | Ga0070704_100030010 | 3300005549 | Bacteria | 3638 |
| 18 | Ga0068855_100022443 | 3300005563 | Bacteria | 7565 |
| 19 | Ga0068855_100332337 | 3300005563 | Bacteria | 1677 |
| 20 | Ga0068857_100554534 | 3300005577 | Bacteria | 1083 |
| 21 | Ga0068856_100066559 | 3300005614 | Bacteria | 3560 |
| 22 | Ga0068852_100019532 | 3300005616 | Bacteria | 5365 |
| 23 | Ga0068859_101037423 | 3300005617 | Bacteria | 901 |
| 24 | Ga0070716_100009970 | 3300006173 | Bacteria | 4752 |
| 25 | Ga0075366_10112404 | 3300006195 | Unclassified | 1639 |
| 26 | Ga0075428_100490553 | 3300006844 | Bacteria | 1315 |
| 27 | Ga0075431_100017790 | 3300006847 | Bacteria | 7226 |
| 28 | Ga0075431_100529835 | 3300006847 | Bacteria | 1167 |
| 29 | Ga0075433_10519110 | 3300006852 | Bacteria | 1048 |
| 30 | Ga0075436_100008852 | 3300006914 | Bacteria | 6886 |
| 31 | Ga0075436_100306448 | 3300006914 | Bacteria | 1139 |
| 32 | Ga0097620_101037563 | 3300006931 | Bacteria | 901 |
| 33 | Ga0099794_10204599 | 3300007265 | Bacteria | 1011 |
| 34 | Ga0105251_10019613 | 3300009011 | Bacteria | 3568 |
| 35 | Ga0105240_10000718 | 3300009093 | Bacteria | 60617 |
| 36 | Ga0105240_10009263 | 3300009093 | Bacteria | 13965 |
| 37 | Ga0111539_10067689 | 3300009094 | Bacteria | 4216 |
| 38 | Ga0105237_10387152 | 3300009545 | Bacteria | 1403 |
| 39 | Ga0105238_10055371 | 3300009551 | Bacteria | 3981 |
| 40 | Ga0105239_11319375 | 3300010375 | Bacteria | 832 |
| 41 | Ga0157373_10220364 | 3300013100 | Bacteria | 1338 |
| 42 | Ga0157370_10028227 | 3300013104 | Bacteria | 5523 |
| 43 | Ga0157380_10232970 | 3300014326 | Bacteria | 1655 |
| 44 | Ga0182008_10240083 | 3300014497 | Bacteria | 932 |
| 45 | Ga0182006_1015643 | 3300015261 | Bacteria | 3249 |
| 46 | Ga0213872_10000227 | 3300021361 | Bacteria | 49306 |
| 47 | Ga0209435_100055 | 3300025206 | Bacteria | 86115 |
| 48 | Ga0209435_100147 | 3300025206 | Bacteria | 23484 |
| 49 | Ga0209147_100097 | 3300025229 | Bacteria | 164034 |
| 50 | Ga0209437_100234 | 3300025233 | Bacteria | 92856 |
| 51 | Ga0209258_100192 | 3300025242 | Bacteria | 125565 |
| 52 | Ga0209646_1000103 | 3300025246 | Bacteria | 164034 |
| 53 | Ga0209646_1000317 | 3300025246 | Bacteria | 37175 |
| 54 | Ga0209026_1000134 | 3300025250 | Bacteria | 117098 |
| 55 | Ga0209026_1001192 | 3300025250 | Bacteria | 12046 |
| 56 | Ga0209759_1000091 | 3300025256 | Bacteria | 164034 |
| 57 | Ga0209759_1000545 | 3300025256 | Bacteria | 39039 |
| 58 | Ga0207713_1030952 | 3300025735 | Bacteria | 2375 |
| 59 | Ga0207699_10334788 | 3300025906 | Bacteria | 1065 |
| 60 | Ga0207707_10163549 | 3300025912 | Bacteria | 1945 |
| 61 | Ga0207695_10001004 | 3300025913 | Bacteria | 49973 |
| 62 | Ga0207695_10017674 | 3300025913 | Bacteria | 8284 |
| 63 | Ga0207660_10334278 | 3300025917 | Bacteria | 1212 |
| 64 | Ga0207665_10105671 | 3300025939 | Bacteria | 1972 |
| 65 | Ga0207667_10027152 | 3300025949 | Bacteria | 6239 |
| 66 | Ga0207667_11064434 | 3300025949 | Bacteria | 793 |
| 67 | Ga0207640_10815650 | 3300025981 | Bacteria | 809 |
| 68 | Ga0207702_10047811 | 3300026078 | Bacteria | 3606 |
| 69 | Ga0207674_10528060 | 3300026116 | Bacteria | 1140 |
| 70 | Ga0207698_10015191 | 3300026142 | Bacteria | 5150 |
| 71 | Ga0209969_1003190 | 3300027360 | Bacteria | 2268 |
| 72 | Ga0209967_1009005 | 3300027364 | Bacteria | 1381 |
| 73 | Ga0210000_1000267 | 3300027462 | Bacteria | 7437 |
| 74 | Ga0209982_1004090 | 3300027552 | Bacteria | 2081 |
| 75 | Ga0209983_1020998 | 3300027665 | Bacteria | 1364 |
| 76 | Ga0209588_1129310 | 3300027671 | Bacteria | 806 |
| 77 | Ga0209966_1012882 | 3300027695 | Bacteria | 1540 |
| 78 | Ga0209966_1018274 | 3300027695 | Bacteria | 1342 |
| 79 | Ga0209974_10004004 | 3300027876 | Bacteria | 5267 |
| 80 | Ga0265324_10018067 | 3300029957 | Bacteria | 2558 |
| 81 | Ga0265327_10102452 | 3300031251 | Bacteria | 1379 |
| 82 | Ga0307408_100229926 | 3300031548 | Bacteria | 1518 |
| 83 | Ga0265313_10001244 | 3300031595 | Bacteria | 24297 |
| 84 | Ga0307413_10134284 | 3300031824 | Bacteria | 1699 |
| 85 | Ga0307410_10246229 | 3300031852 | Bacteria | 1388 |
| 86 | Ga0307412_10676497 | 3300031911 | Unclassified | 883 |
| 87 | Ga0307409_100348297 | 3300031995 | Bacteria | 1397 |
| 88 | Ga0307416_100104431 | 3300032002 | Bacteria | 2477 |
| 89 | Ga0307416_101884974 | 3300032002 | Bacteria | 701 |
| 90 | Ga0307415_100106293 | 3300032126 | Bacteria | 2071 |
| 91 | Ga0373934_0004491 | 3300035086 | Bacteria | 5153 |
| 92 | Ga0373932_0208041 | 3300035112 | Bacteria | 698 |
| 93 | Ga0373936_0001316 | 3300035113 | Bacteria | 8999 |
| 94 | Ga0373953_0026561 | 3300035117 | Bacteria | 2218 |
| 95 | Ga0373954_0068663 | 3300035118 | Bacteria | 1681 |
| 96 | Ga0373956_0013099 | 3300035119 | Bacteria | 3447 |
| 97 | Ga0373957_0003311 | 3300035120 | Bacteria | 4747 |
| 98 | Ga0373955_0060073 | 3300035172 | Bacteria | 2095 |
| 99 | Ga0373955_0589615 | 3300035172 | Bacteria | 680 |
| 100 | Ga0373924_0004686 | 3300035410 | Bacteria | 4796 |
| 101 | Ga0373924_0032944 | 3300035410 | Bacteria | 2089 |
| 102 | Ga0373935_0013239 | 3300035692 | Bacteria | 4975 |
| 103 | Ga0373927_0170552 | 3300035695 | Bacteria | 1426 |
| 104 | Ga0373933_0014702 | 3300035724 | Bacteria | 4355 |
| 105 | Ga0373937_0111170 | 3300036401 | Bacteria | 2548 |
| 106 | Ga0373937_0634470 | 3300036401 | Bacteria | 1013 |
| 107 | Ga0373925_0247027 | 3300037068 | Bacteria | 1430 |
| 108 | Ga0436360_0629881 | 3300039438 | Bacteria | 2379 |
| 109 | Ga0436361_0756053 | 3300039447 | Bacteria | 1332 |
| 110 | Ga0439436_0040102 | 3300041404 | Bacteria | 1343 |
| 111 | Ga0451577_0441145 | 3300042876 | Bacteria | 1182 |
| 112 | Ga0466969_0047514 | 3300044656 | Bacteria | 2124 |
| 113 | Ga0466972_0003540 | 3300044658 | Bacteria | 7753 |
| 114 | Ga0466977_0005295 | 3300044666 | Bacteria | 6687 |
| 115 | Ga0453683_0006473 | 3300044673 | Bacteria | 8039 |
| 116 | Ga0466965_0009867 | 3300044683 | Bacteria | 4441 |
| 117 | Ga0466961_0132302 | 3300044693 | Bacteria | 1563 |
| 118 | Ga0466964_0011217 | 3300044706 | Bacteria | 3384 |
| 119 | Ga0453684_0000204 | 3300044712 | Bacteria | 258105 |
| 120 | Ga0466968_0002257 | 3300044735 | Bacteria | 7040 |
| 121 | Ga0466957_0338848 | 3300044842 | Bacteria | 1018 |
| 122 | Ga0451576_0000947 | 3300045051 | Bacteria | 54449 |
| 123 | Ga0495592_0004707 | 3300046454 | Bacteria | 10009 |
| 124 | Ga0495592_0022956 | 3300046454 | Bacteria | 4747 |
| 125 | Ga0495641_0033131 | 3300046461 | Bacteria | 2454 |
| 126 | Ga0495651_0087177 | 3300046462 | Bacteria | 2347 |
| 127 | Ga0495653_0002016 | 3300046463 | Bacteria | 15984 |
| 128 | Ga0495580_0046680 | 3300046472 | Bacteria | 3072 |
| 129 | Ga0495582_0019189 | 3300046473 | Bacteria | 3740 |
| 130 | Ga0495639_0029705 | 3300046475 | Bacteria | 2426 |
| 131 | Ga0495664_0123430 | 3300046477 | Bacteria | 1566 |
| 132 | Ga0495607_0041605 | 3300046501 | Bacteria | 2728 |
| 133 | Ga0495606_0016384 | 3300046507 | Bacteria | 5654 |
| 134 | Ga0495606_0034154 | 3300046507 | Bacteria | 3495 |
| 135 | Ga0495608_0130473 | 3300046511 | Bacteria | 1608 |
| 136 | Ga0495618_0119563 | 3300046514 | Bacteria | 1687 |
| 137 | Ga0495628_0012812 | 3300046516 | Bacteria | 7060 |
| 138 | Ga0495628_0056524 | 3300046516 | Bacteria | 3088 |
| 139 | Ga0495630_0200025 | 3300046517 | Bacteria | 1524 |
| 140 | Ga0495652_0127523 | 3300046529 | Bacteria | 2019 |
| 141 | Ga0495652_0205506 | 3300046529 | Bacteria | 1491 |
| 142 | Ga0495654_0025488 | 3300046530 | Bacteria | 3045 |
| 143 | Ga0495654_0109020 | 3300046530 | Bacteria | 1265 |
| 144 | Ga0495665_0011435 | 3300046531 | Bacteria | 4803 |
| 145 | Ga0495640_0568890 | 3300046533 | Bacteria | 686 |
| 146 | Ga0495586_0013106 | 3300046535 | Bacteria | 4394 |
| 147 | Ga0495587_0092767 | 3300046536 | Bacteria | 1743 |
| 148 | Ga0495609_0117798 | 3300046538 | Bacteria | 1143 |
| 149 | Ga0495656_0314362 | 3300046615 | Bacteria | 805 |
| 150 | Ga0495625_0005458 | 3300046660 | Bacteria | 11588 |
| 151 | Ga0495625_0007156 | 3300046660 | Bacteria | 9793 |
| 152 | Ga0495625_0125848 | 3300046660 | Bacteria | 1740 |
| 153 | Ga0495635_0081383 | 3300046663 | Bacteria | 2216 |
| 154 | Ga0495659_0000469 | 3300046664 | Bacteria | 14940 |
| 155 | Ga0495657_0053069 | 3300046675 | Bacteria | 2714 |
| 156 | Ga0495599_0001808 | 3300046678 | Bacteria | 12415 |
| 157 | Ga0495613_0035917 | 3300046689 | Bacteria | 3675 |
| 158 | Ga0495624_0059380 | 3300046690 | Bacteria | 2400 |
| 159 | Ga0495671_0002480 | 3300046692 | Bacteria | 11642 |
| 160 | Ga0495660_0001040 | 3300046810 | Bacteria | 20119 |
| 161 | Ga0495581_0095873 | 3300047315 | Bacteria | 1723 |
| 162 | Ga0495604_0008981 | 3300047317 | Bacteria | 7904 |
| 163 | Ga0495604_0055084 | 3300047317 | Bacteria | 3066 |
| 164 | Ga0495636_0004542 | 3300047318 | Bacteria | 5440 |
| 165 | Ga0495674_0036674 | 3300047319 | Bacteria | 4411 |
| 166 | Ga0495672_0002908 | 3300047320 | Bacteria | 15156 |
| 167 | Ga0495680_0107087 | 3300047322 | Bacteria | 2076 |
| 168 | Ga0495684_0018122 | 3300047471 | Bacteria | 5427 |
| 169 | Ga0495686_0033413 | 3300047472 | Bacteria | 3321 |
| 170 | Ga0495614_0034009 | 3300048089 | Bacteria | 2192 |
| 171 | Ga0496116_0019852 | 3300048919 | Bacteria | 5129 |
| 172 | Ga0496121_0012066 | 3300048924 | Bacteria | 9494 |
| 173 | Ga0496121_0083479 | 3300048924 | Bacteria | 2522 |
| 174 | Ga0496121_0563308 | 3300048924 | Bacteria | 710 |
| 175 | Ga0496122_0004071 | 3300048925 | Bacteria | 18553 |
| 176 | Ga0496123_0000912 | 3300048926 | Bacteria | 46427 |
| 177 | Ga0496125_0008520 | 3300048928 | Bacteria | 10718 |
| 178 | Ga0496125_0078443 | 3300048928 | Bacteria | 2538 |
| 179 | Ga0501031_0363480 | 3300049568 | Bacteria | 936 |
| 180 | Ga0501036_0022007 | 3300049572 | Bacteria | 5361 |
| 181 | Ga0501037_0181926 | 3300049573 | Bacteria | 1491 |
| 182 | Ga0501038_0003880 | 3300049574 | Bacteria | 13899 |
| 183 | Ga0501039_0003424 | 3300049575 | Bacteria | 11840 |
| 184 | Ga0501039_0230562 | 3300049575 | Bacteria | 1456 |
| 185 | Ga0501040_0163030 | 3300049576 | Bacteria | 1576 |
| 186 | Ga0501041_0353584 | 3300049577 | Bacteria | 929 |
| 187 | Ga0501046_0384369 | 3300049580 | Bacteria | 1015 |
| 188 | Ga0501048_0011158 | 3300049582 | Bacteria | 6699 |
| 189 | Ga0501068_0050376 | 3300049584 | Bacteria | 2517 |
| 190 | Ga0501069_0120719 | 3300049585 | Bacteria | 1497 |
| 191 | Ga0501072_0042743 | 3300049588 | Bacteria | 3560 |
| 192 | Ga0501075_0000416 | 3300049591 | Bacteria | 24892 |
| 193 | Ga0501075_0006388 | 3300049591 | Bacteria | 8114 |
| 194 | Ga0501076_0063958 | 3300049592 | Bacteria | 2932 |
| 195 | Ga0501076_0093304 | 3300049592 | Bacteria | 2422 |
| 196 | Ga0501077_0040900 | 3300049593 | Bacteria | 2952 |
| 197 | Ga0501079_0005377 | 3300049741 | Bacteria | 9535 |
| 198 | Ga0501079_0109960 | 3300049741 | Bacteria | 2141 |
| 199 | Ga0501079_0218794 | 3300049741 | Bacteria | 1488 |
| 200 | Ga0501080_0020095 | 3300049742 | Bacteria | 6180 |
| 201 | Ga0501081_0001594 | 3300049743 | Bacteria | 13990 |
| 202 | Ga0501035_0004307 | 3300049822 | Bacteria | 13522 |
| 203 | Ga0501035_0165706 | 3300049822 | Bacteria | 1911 |
| 204 | Ga0501044_0037774 | 3300049823 | Bacteria | 5046 |
| 205 | Ga0501044_0592615 | 3300049823 | Unclassified | 1002 |
| 206 | Ga0501045_0000120 | 3300049824 | Bacteria | 40494 |
| 207 | Ga0501045_0329513 | 3300049824 | Bacteria | 1136 |
| 208 | nmdc:mga06r32_99680_c1 | 3300050510 | Bacteria | 2850 |
| 209 | nmdc:mga08x19_15821_c1 | 3300050514 | Bacteria | 4594 |
| 210 | nmdc:mga0a205_569255_c1 | 3300050515 | Bacteria | 987 |
| 211 | Ga0495601_0004413 | 3300053077 | Bacteria | 8130 |
| 212 | Ga0495595_0147464 | 3300053084 | Bacteria | 1156 |
| 213 | Ga0495619_0134922 | 3300053085 | Bacteria | 1697 |
| 214 | Ga0500618_001830 | 3300053125 | Bacteria | 8892 |
| 215 | Ga0501084_0000861 | 3300054114 | Bacteria | 23412 |
| 216 | Ga0501082_0020433 | 3300060353 | Bacteria | 5709 |
| 217 | Ga0530510_0001230 | 3300061734 | Bacteria | 17093 |
| 218 | Ga0530510_0493729 | 3300061734 | Bacteria | 928 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031251 | Ga0265327_10102452 | Ga0265327_101024522 | 184 |
| 2 | 3300002705 | JGI25156J39149_1003256 | JGI25156J39149_10032563 | 193 |
| 3 | iso_pu_bacteria | 2739367655 | 2739612262 | 193 |
| 4 | iso_pu_bacteria | 2643221645 | 2644250473 | 195 |
| 5 | iso_pu_bacteria | 2643221664 | 2644358791 | 195 |
| 6 | iso_pu_bacteria | 2738541280 | 2738738749 | 195 |
| 7 | iso_pu_bacteria | 2738541300 | 2738842432 | 195 |
| 8 | iso_pu_bacteria | 2738543018 | 2739273179 | 195 |
| 9 | iso_pu_bacteria | 2738543030 | 2739342223 | 195 |
| 10 | iso_pu_bacteria | 2522572158 | 2523104843 | 196 |
| 11 | iso_pu_bacteria | 2596583598 | 2597031384 | 196 |
| 12 | iso_pu_bacteria | 2765235838 | 2765571858 | 196 |
| 13 | iso_pu_bacteria | 2818991449 | 2819617299 | 196 |
| 14 | iso_pu_bacteria | 2839094727 | 2839098421 | 196 |
| 15 | iso_pu_bacteria | 2881927736 | 2881930369 | 196 |
| 16 | iso_pu_bacteria | 2885266251 | 2885270065 | 196 |
| 17 | iso_pu_bacteria | 2834641062 | 2834644137 | 197 |
| 18 | iso_pu_bacteria | 8003400568 | 8003404290 | 197 |
| 19 | iso_pu_bacteria | 2721755763 | 2723876137 | 198 |
| 20 | 3300005336 | Ga0070680_100668558 | Ga0070680_1006685581 | 199 |
| 21 | 3300009094 | Ga0111539_10067689 | Ga0111539_100676894 | 199 |
| 22 | 3300014326 | Ga0157380_10232970 | Ga0157380_102329702 | 199 |
| 23 | 3300025917 | Ga0207660_10334278 | Ga0207660_103342782 | 199 |
| 24 | 3300046501 | Ga0495607_0041605 | Ga0495607_0041605_533_1213 | 199 |
| 25 | 3300046507 | Ga0495606_0016384 | Ga0495606_0016384_3287_3964 | 199 |
| 26 | 3300046507 | Ga0495606_0034154 | Ga0495606_0034154_2018_2698 | 199 |
| 27 | 3300046530 | Ga0495654_0025488 | Ga0495654_0025488_257_934 | 199 |
| 28 | 3300046538 | Ga0495609_0117798 | Ga0495609_0117798_244_924 | 199 |
| 29 | 3300046615 | Ga0495656_0314362 | Ga0495656_0314362_80_760 | 199 |
| 30 | 3300046660 | Ga0495625_0005458 | Ga0495625_0005458_261_938 | 199 |
| 31 | 3300046660 | Ga0495625_0125848 | Ga0495625_0125848_30_710 | 199 |
| 32 | 3300046664 | Ga0495659_0000469 | Ga0495659_0000469_9140_9817 | 199 |
| 33 | 3300046692 | Ga0495671_0002480 | Ga0495671_0002480_3319_3996 | 199 |
| 34 | 3300046810 | Ga0495660_0001040 | Ga0495660_0001040_16440_17120 | 199 |
| 35 | 3300047320 | Ga0495672_0002908 | Ga0495672_0002908_8260_8937 | 199 |
| 36 | 3300047472 | Ga0495686_0033413 | Ga0495686_0033413_1702_2382 | 199 |
| 37 | iso_pu_bacteria | 2511231003 | 2511250534 | 199 |
| 38 | iso_pu_bacteria | 2548876994 | 2550694175 | 199 |
| 39 | iso_pu_bacteria | 2818991445 | 2819595390 | 199 |
| 40 | iso_pu_bacteria | 2884811622 | 2884816212 | 199 |
| 41 | iso_pu_bacteria | 2884836552 | 2884839345 | 199 |
| 42 | iso_pu_bacteria | 2884852848 | 2884856845 | 199 |
| 43 | iso_pu_bacteria | 2896154374 | 2896158191 | 199 |
| 44 | 3300005329 | Ga0070683_100020373 | Ga0070683_1000203731 | 200 |
| 45 | 3300005441 | Ga0070700_100520509 | Ga0070700_1005205092 | 200 |
| 46 | 3300005458 | Ga0070681_10032427 | Ga0070681_100324276 | 200 |
| 47 | 3300005467 | Ga0070706_100470086 | Ga0070706_1004700861 | 200 |
| 48 | 3300005546 | Ga0070696_100025121 | Ga0070696_1000251213 | 200 |
| 49 | 3300005549 | Ga0070704_100030010 | Ga0070704_1000300103 | 200 |
| 50 | 3300005617 | Ga0068859_101037423 | Ga0068859_1010374232 | 200 |
| 51 | 3300006173 | Ga0070716_100009970 | Ga0070716_1000099702 | 200 |
| 52 | 3300006195 | Ga0075366_10112404 | Ga0075366_101124042 | 200 |
| 53 | 3300006844 | Ga0075428_100490553 | Ga0075428_1004905532 | 200 |
| 54 | 3300006847 | Ga0075431_100017790 | Ga0075431_1000177903 | 200 |
| 55 | 3300006847 | Ga0075431_100529835 | Ga0075431_1005298352 | 200 |
| 56 | 3300006852 | Ga0075433_10519110 | Ga0075433_105191102 | 200 |
| 57 | 3300006914 | Ga0075436_100008852 | Ga0075436_1000088524 | 200 |
| 58 | 3300006914 | Ga0075436_100306448 | Ga0075436_1003064482 | 200 |
| 59 | 3300006931 | Ga0097620_101037563 | Ga0097620_1010375632 | 200 |
| 60 | 3300007265 | Ga0099794_10204599 | Ga0099794_102045991 | 200 |
| 61 | 3300013104 | Ga0157370_10028227 | Ga0157370_100282275 | 200 |
| 62 | 3300021361 | Ga0213872_10000227 | Ga0213872_1000022723 | 200 |
| 63 | 3300025906 | Ga0207699_10334788 | Ga0207699_103347882 | 200 |
| 64 | 3300025912 | Ga0207707_10163549 | Ga0207707_101635492 | 200 |
| 65 | 3300025939 | Ga0207665_10105671 | Ga0207665_101056712 | 200 |
| 66 | 3300027360 | Ga0209969_1003190 | Ga0209969_10031903 | 200 |
| 67 | 3300027364 | Ga0209967_1009005 | Ga0209967_10090052 | 200 |
| 68 | 3300027462 | Ga0210000_1000267 | Ga0210000_10002672 | 200 |
| 69 | 3300027552 | Ga0209982_1004090 | Ga0209982_10040902 | 200 |
| 70 | 3300027665 | Ga0209983_1020998 | Ga0209983_10209982 | 200 |
| 71 | 3300027671 | Ga0209588_1129310 | Ga0209588_11293102 | 200 |
| 72 | 3300027695 | Ga0209966_1012882 | Ga0209966_10128822 | 200 |
| 73 | 3300027695 | Ga0209966_1018274 | Ga0209966_10182742 | 200 |
| 74 | 3300027876 | Ga0209974_10004004 | Ga0209974_100040045 | 200 |
| 75 | 3300029957 | Ga0265324_10018067 | Ga0265324_100180673 | 200 |
| 76 | 3300031548 | Ga0307408_100229926 | Ga0307408_1002299262 | 200 |
| 77 | 3300031595 | Ga0265313_10001244 | Ga0265313_1000124422 | 200 |
| 78 | 3300031824 | Ga0307413_10134284 | Ga0307413_101342842 | 200 |
| 79 | 3300031852 | Ga0307410_10246229 | Ga0307410_102462292 | 200 |
| 80 | 3300031911 | Ga0307412_10676497 | Ga0307412_106764971 | 200 |
| 81 | 3300031995 | Ga0307409_100348297 | Ga0307409_1003482972 | 200 |
| 82 | 3300032002 | Ga0307416_100104431 | Ga0307416_1001044312 | 200 |
| 83 | 3300032002 | Ga0307416_101884974 | Ga0307416_1018849741 | 200 |
| 84 | 3300032126 | Ga0307415_100106293 | Ga0307415_1001062932 | 200 |
| 85 | 3300035086 | Ga0373934_0004491 | Ga0373934_0004491_1352_1954 | 200 |
| 86 | 3300035112 | Ga0373932_0208041 | Ga0373932_0208041_11_616 | 200 |
| 87 | 3300035113 | Ga0373936_0001316 | Ga0373936_0001316_3161_3763 | 200 |
| 88 | 3300035117 | Ga0373953_0026561 | Ga0373953_0026561_18_620 | 200 |
| 89 | 3300035118 | Ga0373954_0068663 | Ga0373954_0068663_925_1527 | 200 |
| 90 | 3300035119 | Ga0373956_0013099 | Ga0373956_0013099_464_1066 | 200 |
| 91 | 3300035120 | Ga0373957_0003311 | Ga0373957_0003311_3501_4103 | 200 |
| 92 | 3300035172 | Ga0373955_0060073 | Ga0373955_0060073_1476_2078 | 200 |
| 93 | 3300035172 | Ga0373955_0589615 | Ga0373955_0589615_18_620 | 200 |
| 94 | 3300035410 | Ga0373924_0004686 | Ga0373924_0004686_1219_1821 | 200 |
| 95 | 3300035410 | Ga0373924_0032944 | Ga0373924_0032944_151_753 | 200 |
| 96 | 3300035692 | Ga0373935_0013239 | Ga0373935_0013239_3449_4051 | 200 |
| 97 | 3300035695 | Ga0373927_0170552 | Ga0373927_0170552_778_1380 | 200 |
| 98 | 3300035724 | Ga0373933_0014702 | Ga0373933_0014702_3610_4212 | 200 |
| 99 | 3300036401 | Ga0373937_0111170 | Ga0373937_0111170_1370_1972 | 200 |
| 100 | 3300036401 | Ga0373937_0634470 | Ga0373937_0634470_75_677 | 200 |
| 101 | 3300037068 | Ga0373925_0247027 | Ga0373925_0247027_778_1380 | 200 |
| 102 | 3300039438 | Ga0436360_0629881 | Ga0436360_0629881_1033_1635 | 200 |
| 103 | 3300039447 | Ga0436361_0756053 | Ga0436361_0756053_105_710 | 200 |
| 104 | 3300041404 | Ga0439436_0040102 | Ga0439436_0040102_365_973 | 200 |
| 105 | 3300042876 | Ga0451577_0441145 | Ga0451577_0441145_412_1014 | 200 |
| 106 | 3300044656 | Ga0466969_0047514 | Ga0466969_0047514_698_1303 | 200 |
| 107 | 3300044658 | Ga0466972_0003540 | Ga0466972_0003540_2044_2649 | 200 |
| 108 | 3300044666 | Ga0466977_0005295 | Ga0466977_0005295_1008_1613 | 200 |
| 109 | 3300044673 | Ga0453683_0006473 | Ga0453683_0006473_6577_7188 | 200 |
| 110 | 3300044683 | Ga0466965_0009867 | Ga0466965_0009867_2040_2645 | 200 |
| 111 | 3300044693 | Ga0466961_0132302 | Ga0466961_0132302_64_669 | 200 |
| 112 | 3300044706 | Ga0466964_0011217 | Ga0466964_0011217_906_1511 | 200 |
| 113 | 3300044712 | Ga0453684_0000204 | Ga0453684_0000204_40824_41429 | 200 |
| 114 | 3300044735 | Ga0466968_0002257 | Ga0466968_0002257_1841_2446 | 200 |
| 115 | 3300044842 | Ga0466957_0338848 | Ga0466957_0338848_395_1000 | 200 |
| 116 | 3300045051 | Ga0451576_0000947 | Ga0451576_0000947_11923_12534 | 200 |
| 117 | 3300046454 | Ga0495592_0004707 | Ga0495592_0004707_2997_3599 | 200 |
| 118 | 3300046454 | Ga0495592_0022956 | Ga0495592_0022956_2465_3067 | 200 |
| 119 | 3300046461 | Ga0495641_0033131 | Ga0495641_0033131_105_707 | 200 |
| 120 | 3300046462 | Ga0495651_0087177 | Ga0495651_0087177_55_657 | 200 |
| 121 | 3300046463 | Ga0495653_0002016 | Ga0495653_0002016_1083_1685 | 200 |
| 122 | 3300046472 | Ga0495580_0046680 | Ga0495580_0046680_1022_1624 | 200 |
| 123 | 3300046473 | Ga0495582_0019189 | Ga0495582_0019189_774_1376 | 200 |
| 124 | 3300046475 | Ga0495639_0029705 | Ga0495639_0029705_1340_1942 | 200 |
| 125 | 3300046477 | Ga0495664_0123430 | Ga0495664_0123430_883_1485 | 200 |
| 126 | 3300046511 | Ga0495608_0130473 | Ga0495608_0130473_150_752 | 200 |
| 127 | 3300046514 | Ga0495618_0119563 | Ga0495618_0119563_726_1328 | 200 |
| 128 | 3300046516 | Ga0495628_0012812 | Ga0495628_0012812_4754_5356 | 200 |
| 129 | 3300046516 | Ga0495628_0056524 | Ga0495628_0056524_1470_2072 | 200 |
| 130 | 3300046517 | Ga0495630_0200025 | Ga0495630_0200025_33_635 | 200 |
| 131 | 3300046529 | Ga0495652_0127523 | Ga0495652_0127523_1180_1782 | 200 |
| 132 | 3300046529 | Ga0495652_0205506 | Ga0495652_0205506_139_741 | 200 |
| 133 | 3300046531 | Ga0495665_0011435 | Ga0495665_0011435_3397_3999 | 200 |
| 134 | 3300046533 | Ga0495640_0568890 | Ga0495640_0568890_56_658 | 200 |
| 135 | 3300046535 | Ga0495586_0013106 | Ga0495586_0013106_645_1247 | 200 |
| 136 | 3300046536 | Ga0495587_0092767 | Ga0495587_0092767_973_1575 | 200 |
| 137 | 3300046663 | Ga0495635_0081383 | Ga0495635_0081383_480_1082 | 200 |
| 138 | 3300046675 | Ga0495657_0053069 | Ga0495657_0053069_1468_2070 | 200 |
| 139 | 3300046678 | Ga0495599_0001808 | Ga0495599_0001808_3666_4268 | 200 |
| 140 | 3300046689 | Ga0495613_0035917 | Ga0495613_0035917_1387_1989 | 200 |
| 141 | 3300046690 | Ga0495624_0059380 | Ga0495624_0059380_1318_1920 | 200 |
| 142 | 3300047315 | Ga0495581_0095873 | Ga0495581_0095873_1017_1619 | 200 |
| 143 | 3300047317 | Ga0495604_0008981 | Ga0495604_0008981_6774_7529 | 200 |
| 144 | 3300047317 | Ga0495604_0055084 | Ga0495604_0055084_1220_1822 | 200 |
| 145 | 3300047318 | Ga0495636_0004542 | Ga0495636_0004542_24_626 | 200 |
| 146 | 3300047319 | Ga0495674_0036674 | Ga0495674_0036674_2233_2835 | 200 |
| 147 | 3300047322 | Ga0495680_0107087 | Ga0495680_0107087_1370_1972 | 200 |
| 148 | 3300047471 | Ga0495684_0018122 | Ga0495684_0018122_4466_5068 | 200 |
| 149 | 3300048089 | Ga0495614_0034009 | Ga0495614_0034009_786_1388 | 200 |
| 150 | 3300049568 | Ga0501031_0363480 | Ga0501031_0363480_147_749 | 200 |
| 151 | 3300049572 | Ga0501036_0022007 | Ga0501036_0022007_4110_4712 | 200 |
| 152 | 3300049573 | Ga0501037_0181926 | Ga0501037_0181926_482_1090 | 200 |
| 153 | 3300049574 | Ga0501038_0003880 | Ga0501038_0003880_10839_11441 | 200 |
| 154 | 3300049575 | Ga0501039_0003424 | Ga0501039_0003424_5485_6087 | 200 |
| 155 | 3300049575 | Ga0501039_0230562 | Ga0501039_0230562_783_1385 | 200 |
| 156 | 3300049576 | Ga0501040_0163030 | Ga0501040_0163030_599_1201 | 200 |
| 157 | 3300049577 | Ga0501041_0353584 | Ga0501041_0353584_127_729 | 200 |
| 158 | 3300049580 | Ga0501046_0384369 | Ga0501046_0384369_20_622 | 200 |
| 159 | 3300049582 | Ga0501048_0011158 | Ga0501048_0011158_4682_5284 | 200 |
| 160 | 3300049584 | Ga0501068_0050376 | Ga0501068_0050376_693_1295 | 200 |
| 161 | 3300049585 | Ga0501069_0120719 | Ga0501069_0120719_637_1239 | 200 |
| 162 | 3300049588 | Ga0501072_0042743 | Ga0501072_0042743_2316_2918 | 200 |
| 163 | 3300049591 | Ga0501075_0000416 | Ga0501075_0000416_23472_24074 | 200 |
| 164 | 3300049591 | Ga0501075_0006388 | Ga0501075_0006388_7078_7680 | 200 |
| 165 | 3300049592 | Ga0501076_0063958 | Ga0501076_0063958_434_1036 | 200 |
| 166 | 3300049592 | Ga0501076_0093304 | Ga0501076_0093304_993_1595 | 200 |
| 167 | 3300049593 | Ga0501077_0040900 | Ga0501077_0040900_1788_2390 | 200 |
| 168 | 3300049741 | Ga0501079_0005377 | Ga0501079_0005377_7198_7800 | 200 |
| 169 | 3300049741 | Ga0501079_0109960 | Ga0501079_0109960_1102_1704 | 200 |
| 170 | 3300049741 | Ga0501079_0218794 | Ga0501079_0218794_798_1400 | 200 |
| 171 | 3300049742 | Ga0501080_0020095 | Ga0501080_0020095_3653_4255 | 200 |
| 172 | 3300049743 | Ga0501081_0001594 | Ga0501081_0001594_13327_13929 | 200 |
| 173 | 3300049822 | Ga0501035_0004307 | Ga0501035_0004307_11119_11727 | 200 |
| 174 | 3300049822 | Ga0501035_0165706 | Ga0501035_0165706_536_1138 | 200 |
| 175 | 3300049823 | Ga0501044_0037774 | Ga0501044_0037774_3619_4227 | 200 |
| 176 | 3300049823 | Ga0501044_0592615 | Ga0501044_0592615_337_942 | 200 |
| 177 | 3300049824 | Ga0501045_0000120 | Ga0501045_0000120_19496_20098 | 200 |
| 178 | 3300049824 | Ga0501045_0329513 | Ga0501045_0329513_93_695 | 200 |
| 179 | 3300050510 | nmdc:mga06r32_99680_c1 | nmdc:mga06r32_99680_c1_512_1114 | 200 |
| 180 | 3300050514 | nmdc:mga08x19_15821_c1 | nmdc:mga08x19_15821_c1_417_1019 | 200 |
| 181 | 3300050515 | nmdc:mga0a205_569255_c1 | nmdc:mga0a205_569255_c1_269_871 | 200 |
| 182 | 3300053077 | Ga0495601_0004413 | Ga0495601_0004413_2636_3238 | 200 |
| 183 | 3300053084 | Ga0495595_0147464 | Ga0495595_0147464_487_1089 | 200 |
| 184 | 3300053085 | Ga0495619_0134922 | Ga0495619_0134922_926_1528 | 200 |
| 185 | 3300053125 | Ga0500618_001830 | Ga0500618_001830_1082_1684 | 200 |
| 186 | 3300054114 | Ga0501084_0000861 | Ga0501084_0000861_20464_21066 | 200 |
| 187 | 3300060353 | Ga0501082_0020433 | Ga0501082_0020433_4481_5083 | 200 |
| 188 | 3300061734 | Ga0530510_0001230 | Ga0530510_0001230_3573_4175 | 200 |
| 189 | 3300061734 | Ga0530510_0493729 | Ga0530510_0493729_312_914 | 200 |
| 190 | 3300002704 | JGI25155J39150_1000130 | JGI25155J39150_10001309 | 203 |
| 191 | 3300002704 | JGI25155J39150_1000230 | JGI25155J39150_10002308 | 203 |
| 192 | 3300002705 | JGI25156J39149_1000794 | JGI25156J39149_10007948 | 203 |
| 193 | 3300002738 | JGI25154J39366_1000214 | JGI25154J39366_10002148 | 203 |
| 194 | 3300002738 | JGI25154J39366_1000439 | JGI25154J39366_10004398 | 203 |
| 195 | 3300002741 | JGI25157J39369_1000325 | JGI25157J39369_10003258 | 203 |
| 196 | 3300002741 | JGI25157J39369_1010456 | JGI25157J39369_10104562 | 203 |
| 197 | 3300003758 | Ga0055532_1000074 | Ga0055532_100007450 | 203 |
| 198 | 3300005331 | Ga0070670_100033389 | Ga0070670_1000333893 | 203 |
| 199 | 3300005563 | Ga0068855_100022443 | Ga0068855_1000224436 | 203 |
| 200 | 3300005563 | Ga0068855_100332337 | Ga0068855_1003323372 | 203 |
| 201 | 3300005577 | Ga0068857_100554534 | Ga0068857_1005545341 | 203 |
| 202 | 3300005614 | Ga0068856_100066559 | Ga0068856_1000665592 | 203 |
| 203 | 3300005616 | Ga0068852_100019532 | Ga0068852_1000195323 | 203 |
| 204 | 3300009011 | Ga0105251_10019613 | Ga0105251_100196133 | 203 |
| 205 | 3300009093 | Ga0105240_10000718 | Ga0105240_1000071849 | 203 |
| 206 | 3300009093 | Ga0105240_10009263 | Ga0105240_100092636 | 203 |
| 207 | 3300009545 | Ga0105237_10387152 | Ga0105237_103871522 | 203 |
| 208 | 3300009551 | Ga0105238_10055371 | Ga0105238_100553713 | 203 |
| 209 | 3300010375 | Ga0105239_11319375 | Ga0105239_113193751 | 203 |
| 210 | 3300013100 | Ga0157373_10220364 | Ga0157373_102203642 | 203 |
| 211 | 3300014497 | Ga0182008_10240083 | Ga0182008_102400832 | 203 |
| 212 | 3300015261 | Ga0182006_1015643 | Ga0182006_10156433 | 203 |
| 213 | 3300025206 | Ga0209435_100055 | Ga0209435_10005549 | 203 |
| 214 | 3300025206 | Ga0209435_100147 | Ga0209435_10014717 | 203 |
| 215 | 3300025229 | Ga0209147_100097 | Ga0209147_10009783 | 203 |
| 216 | 3300025233 | Ga0209437_100234 | Ga0209437_10023481 | 203 |
| 217 | 3300025242 | Ga0209258_100192 | Ga0209258_10019249 | 203 |
| 218 | 3300025246 | Ga0209646_1000103 | Ga0209646_100010383 | 203 |
| 219 | 3300025246 | Ga0209646_1000317 | Ga0209646_100031711 | 203 |
| 220 | 3300025250 | Ga0209026_1000134 | Ga0209026_100013449 | 203 |
| 221 | 3300025250 | Ga0209026_1001192 | Ga0209026_10011924 | 203 |
| 222 | 3300025256 | Ga0209759_1000091 | Ga0209759_100009183 | 203 |
| 223 | 3300025256 | Ga0209759_1000545 | Ga0209759_10005458 | 203 |
| 224 | 3300025735 | Ga0207713_1030952 | Ga0207713_10309523 | 203 |
| 225 | 3300025913 | Ga0207695_10001004 | Ga0207695_100010049 | 203 |
| 226 | 3300025913 | Ga0207695_10017674 | Ga0207695_100176746 | 203 |
| 227 | 3300025949 | Ga0207667_10027152 | Ga0207667_100271523 | 203 |
| 228 | 3300025949 | Ga0207667_11064434 | Ga0207667_110644341 | 203 |
| 229 | 3300025981 | Ga0207640_10815650 | Ga0207640_108156501 | 203 |
| 230 | 3300026078 | Ga0207702_10047811 | Ga0207702_100478112 | 203 |
| 231 | 3300026116 | Ga0207674_10528060 | Ga0207674_105280602 | 203 |
| 232 | 3300026142 | Ga0207698_10015191 | Ga0207698_100151914 | 203 |
| 233 | 3300046530 | Ga0495654_0109020 | Ga0495654_0109020_380_991 | 203 |
| 234 | 3300046660 | Ga0495625_0007156 | Ga0495625_0007156_924_1535 | 203 |
| 235 | 3300048919 | Ga0496116_0019852 | Ga0496116_0019852_4245_4856 | 203 |
| 236 | 3300048924 | Ga0496121_0012066 | Ga0496121_0012066_1462_2073 | 203 |
| 237 | 3300048924 | Ga0496121_0083479 | Ga0496121_0083479_465_1076 | 203 |
| 238 | 3300048924 | Ga0496121_0563308 | Ga0496121_0563308_69_680 | 203 |
| 239 | 3300048925 | Ga0496122_0004071 | Ga0496122_0004071_9752_10363 | 203 |
| 240 | 3300048926 | Ga0496123_0000912 | Ga0496123_0000912_37440_38051 | 203 |
| 241 | 3300048928 | Ga0496125_0008520 | Ga0496125_0008520_8254_8865 | 203 |
| 242 | 3300048928 | Ga0496125_0078443 | Ga0496125_0078443_1452_2063 | 203 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3fz5-assembly2.cif.gz_D | crystal structure of possible 2-hydroxychromene-2-carboxylate isomerase from rhodobacter sphaeroides | 0.9581 | 7 | 203 |
| 3fz5-assembly2.cif.gz_D | crystal structure of possible 2-hydroxychromene-2-carboxylate isomerase from rhodobacter sphaeroides | 0.9432 | 7 | 203 |
| 3fz5-assembly1.cif.gz_A | crystal structure of possible 2-hydroxychromene-2-carboxylate isomerase from rhodobacter sphaeroides | 0.9321 | 7 | 203 |
| 3fz5-assembly1.cif.gz_A | crystal structure of possible 2-hydroxychromene-2-carboxylate isomerase from rhodobacter sphaeroides | 0.9133 | 7 | 203 |
| 2imd-assembly1.cif.gz_A | structure of semet 2-hydroxychromene-2-carboxylate isomerase (hcca isomerase) | 0.911 | 8 | 199 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3fz5D00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9534 | 7 | 203 | 3.40.30.10 |
| 3fz5D00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9433 | 7 | 203 | 3.40.30.10 |
| af_Q09652_5_211_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9281 | 7 | 200 | 3.40.30.10 |
| af_Q18973_4_212_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9162 | 7 | 200 | 3.40.30.10 |
| 2imdA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8954 | 9 | 199 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V8FYP5-F1-model_v4 | 2-hydroxychromene-2-carboxylate isomerase (EC 5.99.1.4) | 0.9934 | 5 | 203 |
GO:0004364
GO:0004602 GO:0006749 GO:0018845 GO:1901170 |
| AF-A0A5C1E434-F1-model_v4 | 2-hydroxychromene-2-carboxylate isomerase (EC 5.99.1.4) | 0.9923 | 5 | 201 |
GO:0004364
GO:0004602 GO:0006749 GO:0018845 GO:1901170 |
| AF-A0A4R6E3M5-F1-model_v4 | 2-hydroxychromene-2-carboxylate isomerase (EC 5.99.1.4) | 0.9911 | 9 | 203 |
GO:0004364
GO:0004602 GO:0006749 GO:0018845 GO:1901170 |
| AF-A0A011QJD9-F1-model_v4 | 2-hydroxychromene-2-carboxylate isomerase | 0.9903 | 1 | 203 |
GO:0004364
GO:0004602 GO:0006749 GO:0018845 GO:1901170 |
| AF-A0A178MDZ7-F1-model_v4 | 2-hydroxychromene-2-carboxylate isomerase (EC 5.99.1.4) | 0.988 | 5 | 203 |
GO:0004364
GO:0004602 GO:0006749 GO:0018845 GO:1901170 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar