F354853

General Info

Members Datasets Scaffolds Average Seq Length
242 164 484 224

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0207958|Ga0373937_0207958_602_1288
Length 228
Sequence MNSFKQTEQSKVRRLAERGKYDHETVYSILDEGFICHVGFVASDGRPVVIPTAYGRDGERVYIHGSAGSRMQRMLATGIDVSITVTLVDGLVLARSGFNSSINYRSVVMMGKANPVTDLEEKARALYLFSEHLLPGRWDEIRGPSEKELKQTSVLVIDLDEVSAKVRGGPPHDDEEDYALPVWAGVLPMEVKFGEPEPDPQLADGARVPEYVRKASRKRNHEDTKARS

Samples

Sample ID Description Type Environment
1 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
125 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
133 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
134 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
135 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
136 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
137 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
138 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
139 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
140 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
141 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
142 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
143 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
144 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
145 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
146 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
147 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
148 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
149 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
150 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
151 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
152 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
153 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
154 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
155 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
157 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
159 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
160 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
161 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
162 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
163 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
164 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.13
Rhizosphere 92.98
Stem 0
Stem Tuber 0
Unclassified 16.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373937_0207958 3300036401 Bacteria 1841
2 JGI24748J21848_1000011 3300002074 Bacteria 157004
3 JGI24034J26672_10000023 3300002239 Bacteria 115999
4 JGI25406J46586_10008754 3300003203 Bacteria 4559
5 Ga0065715_10000611 3300005293 Bacteria 10141
6 Ga0065707_10120299 3300005295 Bacteria 2138
7 Ga0070676_10214104 3300005328 Bacteria 1269
8 Ga0070676_10422782 3300005328 Bacteria 931
9 Ga0070683_100347578 3300005329 Bacteria 1412
10 Ga0070690_100162681 3300005330 Bacteria 1531
11 Ga0070670_100271488 3300005331 Bacteria 1480
12 Ga0068869_100002665 3300005334 Bacteria 10784
13 Ga0068869_100429135 3300005334 Bacteria 1092
14 Ga0070680_100030102 3300005336 Unclassified 4360
15 Ga0070680_100177266 3300005336 Bacteria 1794
16 Ga0070682_100000091 3300005337 Bacteria 82460
17 Ga0068868_100000360 3300005338 Bacteria 30934
18 Ga0070660_100367790 3300005339 Bacteria 1186
19 Ga0070692_10124243 3300005345 Bacteria 1443
20 Ga0070669_100574770 3300005353 Bacteria 942
21 Ga0070669_100684199 3300005353 Bacteria 865
22 Ga0070673_100161154 3300005364 Bacteria 1908
23 Ga0070673_100183002 3300005364 Bacteria 1795
24 Ga0070709_10039775 3300005434 Unclassified 2887
25 Ga0070709_10221000 3300005434 Unclassified 1351
26 Ga0070709_10264632 3300005434 Unclassified 1244
27 Ga0070714_100039440 3300005435 Bacteria 3976
28 Ga0070714_100722798 3300005435 Bacteria 962
29 Ga0070713_100714294 3300005436 Bacteria 957
30 Ga0070710_10011293 3300005437 Bacteria 4410
31 Ga0070710_10118705 3300005437 Unclassified 1598
32 Ga0070711_100537663 3300005439 Bacteria 968
33 Ga0070705_100116708 3300005440 Bacteria 1716
34 Ga0070705_100252373 3300005440 Bacteria 1239
35 Ga0070700_100128796 3300005441 Unclassified 1705
36 Ga0070708_100196586 3300005445 Bacteria 1887
37 Ga0070708_100243894 3300005445 Bacteria 1687
38 Ga0070678_100190240 3300005456 Bacteria 1687
39 Ga0070662_100267745 3300005457 Bacteria 1378
40 Ga0070681_10003283 3300005458 Bacteria 15101
41 Ga0068867_100829085 3300005459 Bacteria 827
42 Ga0070706_100001376 3300005467 Bacteria 25835
43 Ga0070706_100065317 3300005467 Unclassified 3365
44 Ga0070706_100373971 3300005467 Bacteria 1327
45 Ga0070707_100000228 3300005468 Bacteria 56180
46 Ga0070707_100016518 3300005468 Bacteria 6927
47 Ga0070707_100679664 3300005468 Bacteria 992
48 Ga0070698_100003051 3300005471 Bacteria 18455
49 Ga0070698_100152967 3300005471 Bacteria 2253
50 Ga0070699_100524326 3300005518 Bacteria 1077
51 Ga0070684_100008136 3300005535 Bacteria 8186
52 Ga0070697_100418896 3300005536 Bacteria 1164
53 Ga0070697_100452491 3300005536 Bacteria 1118
54 Ga0068853_100073362 3300005539 Bacteria 2984
55 Ga0070672_100637266 3300005543 Bacteria 930
56 Ga0070686_100736737 3300005544 Bacteria 789
57 Ga0070695_100106171 3300005545 Unclassified 1899
58 Ga0070695_100164717 3300005545 Unclassified 1559
59 Ga0070696_100129995 3300005546 Bacteria 1831
60 Ga0070696_100180290 3300005546 Unclassified 1567
61 Ga0070704_100000631 3300005549 Bacteria 16995
62 Ga0070704_100062634 3300005549 Bacteria 2667
63 Ga0070664_100001848 3300005564 Bacteria 16955
64 Ga0068857_100069193 3300005577 Bacteria 3143
65 Ga0068857_100421861 3300005577 Bacteria 1244
66 Ga0070702_100178891 3300005615 Bacteria 1386
67 Ga0070702_100493071 3300005615 Bacteria 898
68 Ga0068864_100089231 3300005618 Bacteria 2716
69 Ga0068864_100578840 3300005618 Unclassified 1088
70 Ga0068864_100650576 3300005618 Unclassified 1026
71 Ga0068861_100063694 3300005719 Bacteria 2834
72 Ga0068870_10384772 3300005840 Bacteria 909
73 Ga0068863_100035115 3300005841 Bacteria 4776
74 Ga0068858_100000213 3300005842 Bacteria 62602
75 Ga0068860_100647610 3300005843 Bacteria 1064
76 Ga0068860_100751958 3300005843 Bacteria 986
77 Ga0081539_10014797 3300005985 Bacteria 5732
78 Ga0070717_10063165 3300006028 Bacteria 3072
79 Ga0070717_10074193 3300006028 Bacteria 2843
80 Ga0070717_10332837 3300006028 Bacteria 1355
81 Ga0070715_10000005 3300006163 Bacteria 298716
82 Ga0070715_10005605 3300006163 Unclassified 4200
83 Ga0070716_100000034 3300006173 Bacteria 56620
84 Ga0070716_100030833 3300006173 Unclassified 2913
85 Ga0070712_100075695 3300006175 Bacteria 2421
86 Ga0075428_100024352 3300006844 Bacteria 6698
87 Ga0075428_100093181 3300006844 Bacteria 3284
88 Ga0075431_100123712 3300006847 Bacteria 2668
89 Ga0075429_100359357 3300006880 Unclassified 1275
90 Ga0068865_100312180 3300006881 Bacteria 1262
91 Ga0068865_100691524 3300006881 Bacteria 871
92 Ga0075436_100000194 3300006914 Bacteria 37539
93 Ga0075435_100001642 3300007076 Bacteria 14497
94 Ga0105245_10000004 3300009098 Bacteria 470684
95 Ga0105247_10000003 3300009101 Bacteria 694517
96 Ga0105247_10212992 3300009101 Bacteria 1304
97 Ga0114129_10194058 3300009147 Unclassified 2755
98 Ga0114129_10202698 3300009147 Bacteria 2686
99 Ga0114129_10502736 3300009147 Unclassified 1583
100 Ga0105243_10006379 3300009148 Bacteria 9110
101 Ga0105241_10162961 3300009174 Bacteria 1835
102 Ga0105241_10186103 3300009174 Bacteria 1726
103 Ga0105241_10262009 3300009174 Unclassified 1469
104 Ga0105242_10001067 3300009176 Bacteria 21543
105 Ga0105242_10441213 3300009176 Bacteria 1225
106 Ga0105242_10696774 3300009176 Bacteria 993
107 Ga0105248_10536440 3300009177 Bacteria 1320
108 Ga0105237_10626605 3300009545 Bacteria 1082
109 Ga0105246_10138916 3300011119 Unclassified 1825
110 Ga0157373_10373973 3300013100 Bacteria 1019
111 Ga0157369_10000250 3300013105 Bacteria 73944
112 Ga0157369_10417952 3300013105 Bacteria 1390
113 Ga0157378_10000306 3300013297 Bacteria 47715
114 Ga0157378_10001103 3300013297 Bacteria 24605
115 Ga0157378_10001336 3300013297 Bacteria 22157
116 Ga0157378_10042489 3300013297 Bacteria 4035
117 Ga0163162_10076175 3300013306 Unclassified 3416
118 Ga0163162_10236119 3300013306 Bacteria 1959
119 Ga0163162_10575845 3300013306 Bacteria 1253
120 Ga0163162_10821485 3300013306 Bacteria 1046
121 Ga0157372_10374961 3300013307 Bacteria 1658
122 Ga0157375_10000015 3300013308 Bacteria 308254
123 Ga0157375_10000303 3300013308 Bacteria 44672
124 Ga0157375_10002534 3300013308 Bacteria 15857
125 Ga0157375_10167720 3300013308 Bacteria 2341
126 Ga0157375_10805955 3300013308 Bacteria 1087
127 Ga0163163_10001469 3300014325 Bacteria 19935
128 Ga0163163_10004747 3300014325 Bacteria 11651
129 Ga0163163_10576034 3300014325 Bacteria 1189
130 Ga0157380_10046327 3300014326 Bacteria 3415
131 Ga0157380_10952444 3300014326 Bacteria 888
132 Ga0157379_10040304 3300014968 Bacteria 4168
133 Ga0157379_10124095 3300014968 Unclassified 2323
134 Ga0157379_10182823 3300014968 Bacteria 1894
135 Ga0157376_10000049 3300014969 Bacteria 104672
136 Ga0163161_10510696 3300017792 Bacteria 980
137 Ga0213873_10001980 3300021358 Bacteria 3495
138 Ga0213876_10000012 3300021384 Bacteria 396530
139 Ga0213876_10000022 3300021384 Bacteria 259520
140 Ga0207672_1000021 3300025223 Bacteria 19763
141 Ga0207710_10000001 3300025900 Bacteria 1797433
142 Ga0207699_10185713 3300025906 Unclassified 1400
143 Ga0207645_10141812 3300025907 Bacteria 1566
144 Ga0207684_10001470 3300025910 Bacteria 25353
145 Ga0207684_10027615 3300025910 Bacteria 4834
146 Ga0207684_10134066 3300025910 Bacteria 2126
147 Ga0207684_10381176 3300025910 Unclassified 1213
148 Ga0207654_10107965 3300025911 Bacteria 1726
149 Ga0207707_10286314 3300025912 Bacteria 1426
150 Ga0207693_10027974 3300025915 Bacteria 4456
151 Ga0207693_10182121 3300025915 Bacteria 1653
152 Ga0207663_10486504 3300025916 Bacteria 957
153 Ga0207660_10197281 3300025917 Bacteria 1571
154 Ga0207660_10272598 3300025917 Bacteria 1341
155 Ga0207662_10123738 3300025918 Bacteria 1624
156 Ga0207657_10316906 3300025919 Bacteria 1234
157 Ga0207649_10254830 3300025920 Unclassified 1265
158 Ga0207646_10001363 3300025922 Bacteria 30260
159 Ga0207646_10053012 3300025922 Unclassified 3629
160 Ga0207646_10098737 3300025922 Unclassified 2617
161 Ga0207646_10237030 3300025922 Bacteria 1648
162 Ga0207650_10000088 3300025925 Bacteria 123236
163 Ga0207650_10011518 3300025925 Bacteria 6089
164 Ga0207687_10000003 3300025927 Bacteria 875159
165 Ga0207700_10011890 3300025928 Bacteria 5579
166 Ga0207664_10090965 3300025929 Bacteria 2501
167 Ga0207664_10354908 3300025929 Bacteria 1298
168 Ga0207664_10506988 3300025929 Bacteria 1081
169 Ga0207644_10000095 3300025931 Bacteria 64023
170 Ga0207686_10172205 3300025934 Bacteria 1528
171 Ga0207709_10007379 3300025935 Bacteria 6126
172 Ga0207670_10484131 3300025936 Bacteria 1002
173 Ga0207704_10273723 3300025938 Bacteria 1280
174 Ga0207704_10485658 3300025938 Bacteria 993
175 Ga0207665_10008042 3300025939 Bacteria 6958
176 Ga0207665_10035449 3300025939 Unclassified 3312
177 Ga0207665_10233316 3300025939 Unclassified 1353
178 Ga0207691_10601272 3300025940 Bacteria 931
179 Ga0207689_10014274 3300025942 Bacteria 6760
180 Ga0207689_10203252 3300025942 Bacteria 1635
181 Ga0207661_10000001 3300025944 Bacteria 937688
182 Ga0207661_10259353 3300025944 Bacteria 1548
183 Ga0207679_10138718 3300025945 Bacteria 1962
184 Ga0207640_10002546 3300025981 Bacteria 9774
185 Ga0207677_10000089 3300026023 Bacteria 76102
186 Ga0207703_10000055 3300026035 Bacteria 143420
187 Ga0207639_10334458 3300026041 Bacteria 1349
188 Ga0207639_10532112 3300026041 Unclassified 1077
189 Ga0207708_10208250 3300026075 Bacteria 1562
190 Ga0207702_10312075 3300026078 Unclassified 1495
191 Ga0207648_10098192 3300026089 Bacteria 2564
192 Ga0207676_10090326 3300026095 Bacteria 2513
193 Ga0207674_10000841 3300026116 Bacteria 40016
194 Ga0268265_10021068 3300028380 Bacteria 4561
195 Ga0268265_10333693 3300028380 Unclassified 1378
196 Ga0268264_10357521 3300028381 Bacteria 1392
197 Ga0307513_10001314 3300031456 Bacteria 35933
198 Ga0307509_10000001 3300031507 Bacteria 629324
199 Ga0307410_10428293 3300031852 Bacteria 1075
200 Ga0373935_0299233 3300035692 Bacteria 1137
201 Ga0395900_0893556 3300037418 Bacteria 812
202 Ga0395905_0003536 3300037471 Bacteria 16647
203 Ga0436364_1231522 3300037853 Bacteria 1847
204 Ga0436365_0633640 3300039437 Bacteria 46218
205 Ga0436365_0800228 3300039437 Bacteria 36005
206 Ga0436360_0029365 3300039438 Bacteria 2874
207 Ga0436360_0285542 3300039438 Bacteria 2949
208 Ga0436361_0285854 3300039447 Bacteria 2143
209 Ga0436362_0539963 3300039453 Bacteria 2686
210 Ga0436362_0715772 3300039453 Bacteria 11802
211 Ga0439434_0007525 3300042435 Unclassified 3192
212 Ga0466967_0083356 3300045976 Bacteria 2891
213 Ga0495629_0295946 3300046459 Bacteria 1109
214 Ga0495580_0033022 3300046472 Bacteria 3730
215 Ga0495582_0155405 3300046473 Unclassified 1300
216 Ga0495586_0146288 3300046535 Bacteria 1328
217 Ga0495621_0000074 3300046539 Bacteria 20037
218 Ga0495635_0091526 3300046663 Bacteria 2080
219 Ga0495659_0053181 3300046664 Bacteria 1479
220 Ga0495588_0152850 3300046674 Unclassified 1220
221 Ga0495669_0262700 3300046684 Unclassified 829
222 Ga0495581_0088057 3300047315 Bacteria 1800
223 Ga0496101_0016865 3300048904 Bacteria 4944
224 Ga0496102_0343389 3300048905 Unclassified 1406
225 Ga0496105_0130310 3300048908 Unclassified 2074
226 Ga0496106_0018583 3300048909 Bacteria 5144
227 Ga0496107_0219795 3300048910 Bacteria 1413
228 Ga0496108_0032354 3300048911 Bacteria 4345
229 Ga0496109_0005495 3300048912 Bacteria 10610
230 Ga0496112_0071113 3300048915 Unclassified 3439
231 Ga0496113_0014651 3300048916 Bacteria 5359
232 Ga0496115_0065496 3300048918 Unclassified 2935
233 Ga0501067_0418960 3300049583 Bacteria 747
234 nmdc:mga05p37_164723_c1 3300050507 Bacteria 2706
235 nmdc:mga05p37_700876_c1 3300050507 Bacteria 1125
236 nmdc:mga09592_351704_c1 3300050508 Unclassified 1275
237 nmdc:mga0qj67_233803_c1 3300050509 Bacteria 1491
238 nmdc:mga08y16_768027_c1 3300050511 Archaea 959
239 nmdc:mga0rr50_102321_c1 3300050513 Bacteria 2253
240 nmdc:mga0rr50_1132_c1 3300050513 Bacteria 14505
241 nmdc:mga08x19_5_c1 3300050514 Bacteria 464292
242 nmdc:mga0a205_254925_c1 3300050515 Unclassified 1633
243 Ga0373937_0207958
244 JGI24748J21848_1000011
245 JGI24034J26672_10000023
246 JGI25406J46586_10008754
247 Ga0065715_10000611
248 Ga0065707_10120299
249 Ga0070676_10214104
250 Ga0070676_10422782
251 Ga0070683_100347578
252 Ga0070690_100162681
253 Ga0070670_100271488
254 Ga0068869_100002665
255 Ga0068869_100429135
256 Ga0070680_100030102
257 Ga0070680_100177266
258 Ga0070682_100000091
259 Ga0068868_100000360
260 Ga0070660_100367790
261 Ga0070692_10124243
262 Ga0070669_100574770
263 Ga0070669_100684199
264 Ga0070673_100161154
265 Ga0070673_100183002
266 Ga0070709_10039775
267 Ga0070709_10221000
268 Ga0070709_10264632
269 Ga0070714_100039440
270 Ga0070714_100722798
271 Ga0070713_100714294
272 Ga0070710_10011293
273 Ga0070710_10118705
274 Ga0070711_100537663
275 Ga0070705_100116708
276 Ga0070705_100252373
277 Ga0070700_100128796
278 Ga0070708_100196586
279 Ga0070708_100243894
280 Ga0070678_100190240
281 Ga0070662_100267745
282 Ga0070681_10003283
283 Ga0068867_100829085
284 Ga0070706_100001376
285 Ga0070706_100065317
286 Ga0070706_100373971
287 Ga0070707_100000228
288 Ga0070707_100016518
289 Ga0070707_100679664
290 Ga0070698_100003051
291 Ga0070698_100152967
292 Ga0070699_100524326
293 Ga0070684_100008136
294 Ga0070697_100418896
295 Ga0070697_100452491
296 Ga0068853_100073362
297 Ga0070672_100637266
298 Ga0070686_100736737
299 Ga0070695_100106171
300 Ga0070695_100164717
301 Ga0070696_100129995
302 Ga0070696_100180290
303 Ga0070704_100000631
304 Ga0070704_100062634
305 Ga0070664_100001848
306 Ga0068857_100069193
307 Ga0068857_100421861
308 Ga0070702_100178891
309 Ga0070702_100493071
310 Ga0068864_100089231
311 Ga0068864_100578840
312 Ga0068864_100650576
313 Ga0068861_100063694
314 Ga0068870_10384772
315 Ga0068863_100035115
316 Ga0068858_100000213
317 Ga0068860_100647610
318 Ga0068860_100751958
319 Ga0081539_10014797
320 Ga0070717_10063165
321 Ga0070717_10074193
322 Ga0070717_10332837
323 Ga0070715_10000005
324 Ga0070715_10005605
325 Ga0070716_100000034
326 Ga0070716_100030833
327 Ga0070712_100075695
328 Ga0075428_100024352
329 Ga0075428_100093181
330 Ga0075431_100123712
331 Ga0075429_100359357
332 Ga0068865_100312180
333 Ga0068865_100691524
334 Ga0075436_100000194
335 Ga0075435_100001642
336 Ga0105245_10000004
337 Ga0105247_10000003
338 Ga0105247_10212992
339 Ga0114129_10194058
340 Ga0114129_10202698
341 Ga0114129_10502736
342 Ga0105243_10006379
343 Ga0105241_10162961
344 Ga0105241_10186103
345 Ga0105241_10262009
346 Ga0105242_10001067
347 Ga0105242_10441213
348 Ga0105242_10696774
349 Ga0105248_10536440
350 Ga0105237_10626605
351 Ga0105246_10138916
352 Ga0157373_10373973
353 Ga0157369_10000250
354 Ga0157369_10417952
355 Ga0157378_10000306
356 Ga0157378_10001103
357 Ga0157378_10001336
358 Ga0157378_10042489
359 Ga0163162_10076175
360 Ga0163162_10236119
361 Ga0163162_10575845
362 Ga0163162_10821485
363 Ga0157372_10374961
364 Ga0157375_10000015
365 Ga0157375_10000303
366 Ga0157375_10002534
367 Ga0157375_10167720
368 Ga0157375_10805955
369 Ga0163163_10001469
370 Ga0163163_10004747
371 Ga0163163_10576034
372 Ga0157380_10046327
373 Ga0157380_10952444
374 Ga0157379_10040304
375 Ga0157379_10124095
376 Ga0157379_10182823
377 Ga0157376_10000049
378 Ga0163161_10510696
379 Ga0213873_10001980
380 Ga0213876_10000012
381 Ga0213876_10000022
382 Ga0207672_1000021
383 Ga0207710_10000001
384 Ga0207699_10185713
385 Ga0207645_10141812
386 Ga0207684_10001470
387 Ga0207684_10027615
388 Ga0207684_10134066
389 Ga0207684_10381176
390 Ga0207654_10107965
391 Ga0207707_10286314
392 Ga0207693_10027974
393 Ga0207693_10182121
394 Ga0207663_10486504
395 Ga0207660_10197281
396 Ga0207660_10272598
397 Ga0207662_10123738
398 Ga0207657_10316906
399 Ga0207649_10254830
400 Ga0207646_10001363
401 Ga0207646_10053012
402 Ga0207646_10098737
403 Ga0207646_10237030
404 Ga0207650_10000088
405 Ga0207650_10011518
406 Ga0207687_10000003
407 Ga0207700_10011890
408 Ga0207664_10090965
409 Ga0207664_10354908
410 Ga0207664_10506988
411 Ga0207644_10000095
412 Ga0207686_10172205
413 Ga0207709_10007379
414 Ga0207670_10484131
415 Ga0207704_10273723
416 Ga0207704_10485658
417 Ga0207665_10008042
418 Ga0207665_10035449
419 Ga0207665_10233316
420 Ga0207691_10601272
421 Ga0207689_10014274
422 Ga0207689_10203252
423 Ga0207661_10000001
424 Ga0207661_10259353
425 Ga0207679_10138718
426 Ga0207640_10002546
427 Ga0207677_10000089
428 Ga0207703_10000055
429 Ga0207639_10334458
430 Ga0207639_10532112
431 Ga0207708_10208250
432 Ga0207702_10312075
433 Ga0207648_10098192
434 Ga0207676_10090326
435 Ga0207674_10000841
436 Ga0268265_10021068
437 Ga0268265_10333693
438 Ga0268264_10357521
439 Ga0307513_10001314
440 Ga0307509_10000001
441 Ga0307410_10428293
442 Ga0373935_0299233
443 Ga0395900_0893556
444 Ga0395905_0003536
445 Ga0436364_1231522
446 Ga0436365_0633640
447 Ga0436365_0800228
448 Ga0436360_0029365
449 Ga0436360_0285542
450 Ga0436361_0285854
451 Ga0436362_0539963
452 Ga0436362_0715772
453 Ga0439434_0007525
454 Ga0466967_0083356
455 Ga0495629_0295946
456 Ga0495580_0033022
457 Ga0495582_0155405
458 Ga0495586_0146288
459 Ga0495621_0000074
460 Ga0495635_0091526
461 Ga0495659_0053181
462 Ga0495588_0152850
463 Ga0495669_0262700
464 Ga0495581_0088057
465 Ga0496101_0016865
466 Ga0496102_0343389
467 Ga0496105_0130310
468 Ga0496106_0018583
469 Ga0496107_0219795
470 Ga0496108_0032354
471 Ga0496109_0005495
472 Ga0496112_0071113
473 Ga0496113_0014651
474 Ga0496115_0065496
475 Ga0501067_0418960
476 nmdc:mga05p37_164723_c1
477 nmdc:mga05p37_700876_c1
478 nmdc:mga09592_351704_c1
479 nmdc:mga0qj67_233803_c1
480 nmdc:mga08y16_768027_c1
481 nmdc:mga0rr50_102321_c1
482 nmdc:mga0rr50_1132_c1
483 nmdc:mga08x19_5_c1
484 nmdc:mga0a205_254925_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12900

Pyridox_ox_2

Pyridoxamine 5'-phosphate oxidase

22

166

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ybn-assembly1.cif.gz_B structure of the fad and heme binding protein msmeg_4975 from mycobacterium smegmatis 0.9617 18 210
6rk0-assembly1.cif.gz_B structure of the flavocytochrome anf3 from azotobacter vinelandii 0.9208 5 217
6rk0-assembly1.cif.gz_B structure of the flavocytochrome anf3 from azotobacter vinelandii 0.9127 5 217
2fur-assembly1.cif.gz_B crystal structure of a putative fmn-binding protein (ta1372) from thermoplasma acidophilum at 1.80 a resolution 0.911 24 210
4ybn-assembly1.cif.gz_B structure of the fad and heme binding protein msmeg_4975 from mycobacterium smegmatis 0.9024 18 210
ID Description Score Start End Superfamily
4ybnB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9617 18 210 2.30.110.10
4ybnB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9025 18 210 2.30.110.10
2furB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8966 24 210 2.30.110.10
6eciG00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8551 19 167 2.30.110.10
6eciG00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8405 19 167 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A3B8W888-F1-model_v4 Pyridoxamine 5'-phosphate oxidase 0.9875 1 211
AF-A0A4Q5M6Q6-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.987 4 216
AF-A0A7W1ZK43-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9864 3 218 GO:0016020
AF-A0A538LPS6-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9858 7 216
AF-A0A7Y2ITR1-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9824 7 216

Map