F354729

General Info

Members Datasets Scaffolds Average Seq Length
242 144 484 445

Family's Representative Sequence

Representative Sequence 3300025910|Ga0207684_10017127|Ga0207684_100171275
Length 474
Sequence VARAARPCIARKMRVPLKERIKIVNWDIFRAYDIRGVYPTDIDEEAYYRIAKAYTYLFHPTTMVVGMDARASSPPLKAALTSGFVDAGVNVVDIGGITTDMLYYAVGSSDYSGGIVVSASHNPKQYNGAKMVREKATAISSDTGLFDIRDALKAEKDKEVSSASKGSITQKDVLVGYTAHVLSFIDPNVIKPFTFVGNANFGYACNTVAALVDELKLNLVPLNFEPDGTFPKGPPDPMLPDNRTETSELVKSSGATFAAAWDADADRCMFFDERGKFISGAYVTALLADILLTKYGKNKIIFDPRVIWPALKVCKQHGSEAIISKGGHAFMKERMRRENAIFAGEMSGHYYFRENFYADNGVIPFLLVLEHLSKTGKPLSALMLPYTEGHYMSGELNYRVEDIKKVISEVKARFSSRGKEDFTDGYSLEADDWRFNIRPSNTEPLLRLNLEALKPGLIEELQNEIESIIGSKPH

Samples

Sample ID Description Type Environment
1 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
110 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
111 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
112 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
113 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
114 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
117 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
118 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
119 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
122 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
123 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
124 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
125 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
126 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
127 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
128 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
129 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
130 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
131 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
132 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
133 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
134 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
135 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
136 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
137 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
138 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
139 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
140 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
141 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
142 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
143 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
144 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.41
Rhizosphere 98.76
Stem 0
Stem Tuber 0
Unclassified 12.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207684_10017127 3300025910 Bacteria 6220
2 CNAas_1000380 3300000532 Bacteria 4299
3 JGI24748J21848_1000003 3300002074 Bacteria 323921
4 JGI24034J26672_10000005 3300002239 Bacteria 404185
5 JGI24751J29686_10000249 3300002459 Bacteria 21224
6 JGI25406J46586_10004165 3300003203 Bacteria 6750
7 rootL2_10089699 3300003322 Bacteria 7677
8 Ga0065714_10064449 3300005288 Bacteria 78257
9 Ga0065714_10072925 3300005288 Bacteria 3274
10 Ga0065704_10007280 3300005289 Bacteria 3453
11 Ga0065712_10006050 3300005290 Bacteria 4798
12 Ga0065712_10067741 3300005290 Bacteria 78248
13 Ga0065712_10100504 3300005290 Bacteria 2060
14 Ga0065715_10014040 3300005293 Bacteria 2749
15 Ga0065715_10022171 3300005293 Bacteria 1945
16 Ga0065715_10089000 3300005293 Bacteria 17514
17 Ga0065715_10111812 3300005293 Unclassified 2558
18 Ga0065707_10004354 3300005295 Bacteria 5369
19 Ga0065707_10006215 3300005295 Bacteria 5480
20 Ga0065707_10114194 3300005295 Unclassified 2304
21 Ga0070670_100000118 3300005331 Bacteria 73231
22 Ga0070670_100009319 3300005331 Bacteria 8387
23 Ga0070670_100017304 3300005331 Bacteria 6182
24 Ga0070677_10036973 3300005333 Bacteria 1902
25 Ga0070682_100000068 3300005337 Bacteria 96186
26 Ga0070682_100010290 3300005337 Bacteria 5307
27 Ga0068868_100181131 3300005338 Bacteria 1748
28 Ga0070689_100049178 3300005340 Archaea 3254
29 Ga0070692_10009141 3300005345 Bacteria 4454
30 Ga0070669_100026653 3300005353 Bacteria 4160
31 Ga0070675_100147514 3300005354 Bacteria 2015
32 Ga0070673_100018176 3300005364 Bacteria 5018
33 Ga0070703_10000100 3300005406 Bacteria 44584
34 Ga0070709_10155635 3300005434 Bacteria 1584
35 Ga0070701_10047870 3300005438 Bacteria 2204
36 Ga0070701_10114826 3300005438 Bacteria 1509
37 Ga0070705_100087582 3300005440 Bacteria 1931
38 Ga0070700_100000115 3300005441 Bacteria 51077
39 Ga0070694_100015587 3300005444 Bacteria 4776
40 Ga0070694_100017691 3300005444 Bacteria 4505
41 Ga0070694_100022400 3300005444 Unclassified 4047
42 Ga0070694_100026316 3300005444 Bacteria 3769
43 Ga0070663_100220226 3300005455 Bacteria 1490
44 Ga0070662_100217963 3300005457 Bacteria 1521
45 Ga0070681_10004545 3300005458 Bacteria 13231
46 Ga0070706_100000032 3300005467 Bacteria 152892
47 Ga0070706_100001897 3300005467 Bacteria 21585
48 Ga0070707_100001239 3300005468 Bacteria 25065
49 Ga0070707_100296227 3300005468 Unclassified 1572
50 Ga0070698_100000017 3300005471 Bacteria 107963
51 Ga0070698_100028116 3300005471 Bacteria 5844
52 Ga0070698_100104549 3300005471 Bacteria 2801
53 Ga0070699_100003796 3300005518 Bacteria 13351
54 Ga0070697_100019575 3300005536 Bacteria 5347
55 Ga0070697_100026502 3300005536 Unclassified 4632
56 Ga0070695_100020245 3300005545 Bacteria 4061
57 Ga0070696_100151019 3300005546 Bacteria 1705
58 Ga0070693_100007144 3300005547 Bacteria 5445
59 Ga0070704_100016763 3300005549 Bacteria 4639
60 Ga0070704_100023740 3300005549 Bacteria 4012
61 Ga0070704_100122998 3300005549 Bacteria 1997
62 Ga0070702_100003194 3300005615 Bacteria 7276
63 Ga0070702_100031356 3300005615 Unclassified 2907
64 Ga0068859_100002426 3300005617 Bacteria 18981
65 Ga0068859_100005869 3300005617 Bacteria 12463
66 Ga0068859_100078477 3300005617 Unclassified 3342
67 Ga0068859_100087335 3300005617 Bacteria 3166
68 Ga0068859_100130899 3300005617 Bacteria 2580
69 Ga0068859_100336401 3300005617 Bacteria 1604
70 Ga0068864_100184427 3300005618 Unclassified 1909
71 Ga0068864_100223458 3300005618 Bacteria 1738
72 Ga0068866_10023597 3300005718 Bacteria 2864
73 Ga0068861_100046818 3300005719 Bacteria 3262
74 Ga0068861_100052190 3300005719 Unclassified 3107
75 Ga0068851_10001543 3300005834 Bacteria 10096
76 Ga0068863_100321272 3300005841 Bacteria 1504
77 Ga0068858_100000026 3300005842 Bacteria 153013
78 Ga0068858_100009315 3300005842 Bacteria 9375
79 Ga0068860_100006586 3300005843 Bacteria 11663
80 Ga0068860_100072803 3300005843 Unclassified 3266
81 Ga0068860_100165121 3300005843 Bacteria 2137
82 Ga0068862_100077174 3300005844 Bacteria 2884
83 Ga0081539_10001451 3300005985 Bacteria 40546
84 Ga0081539_10023609 3300005985 Bacteria 4021
85 Ga0070715_10000022 3300006163 Bacteria 118193
86 Ga0068871_100005112 3300006358 Bacteria 9166
87 Ga0075428_100338167 3300006844 Bacteria 1617
88 Ga0075433_10024859 3300006852 Bacteria 5060
89 Ga0075434_100051324 3300006871 Unclassified 4099
90 Ga0075434_100065684 3300006871 Bacteria 3614
91 Ga0075429_100050212 3300006880 Bacteria 3629
92 Ga0075436_100000011 3300006914 Bacteria 208094
93 Ga0097620_100002426 3300006931 Bacteria 18981
94 Ga0097620_100005870 3300006931 Bacteria 12463
95 Ga0097620_100078476 3300006931 Unclassified 3342
96 Ga0097620_100087341 3300006931 Bacteria 3166
97 Ga0097620_100130900 3300006931 Bacteria 2580
98 Ga0097620_100336411 3300006931 Bacteria 1604
99 Ga0075435_100000796 3300007076 Bacteria 19622
100 Ga0111539_10014333 3300009094 Bacteria 9898
101 Ga0111539_10020389 3300009094 Bacteria 8164
102 Ga0111539_10228622 3300009094 Bacteria 2166
103 Ga0105247_10000022 3300009101 Bacteria 219796
104 Ga0105247_10001628 3300009101 Bacteria 15881
105 Ga0105247_10110933 3300009101 Bacteria 1766
106 Ga0114129_10170629 3300009147 Bacteria 2966
107 Ga0114129_10177091 3300009147 Bacteria 2904
108 Ga0105243_10000084 3300009148 Bacteria 106821
109 Ga0105243_10001349 3300009148 Bacteria 21855
110 Ga0105243_10005751 3300009148 Bacteria 9629
111 Ga0105243_10031074 3300009148 Bacteria 4117
112 Ga0105243_10262684 3300009148 Bacteria 1546
113 Ga0105241_10104172 3300009174 Unclassified 2260
114 Ga0105242_10000026 3300009176 Bacteria 108155
115 Ga0105242_10001968 3300009176 Bacteria 16160
116 Ga0105248_10026777 3300009177 Bacteria 6413
117 Ga0105248_10067307 3300009177 Bacteria 4021
118 Ga0105248_10069515 3300009177 Archaea 3954
119 Ga0105248_10159993 3300009177 Unclassified 2540
120 Ga0105248_10335105 3300009177 Bacteria 1704
121 Ga0105237_10007870 3300009545 Bacteria 11617
122 Ga0105237_10088788 3300009545 Bacteria 3080
123 Ga0105238_10038181 3300009551 Bacteria 4878
124 Ga0105249_10055629 3300009553 Bacteria 3621
125 Ga0105249_10269603 3300009553 Bacteria 1695
126 Ga0105239_10072788 3300010375 Bacteria 3778
127 Ga0157373_10008416 3300013100 Bacteria 7660
128 Ga0157378_10000011 3300013297 Bacteria 158889
129 Ga0157378_10030635 3300013297 Bacteria 4753
130 Ga0157378_10065354 3300013297 Bacteria 3256
131 Ga0157378_10098290 3300013297 Bacteria 2669
132 Ga0157378_10108790 3300013297 Unclassified 2538
133 Ga0163162_10103053 3300013306 Bacteria 2947
134 Ga0163162_10142407 3300013306 Bacteria 2512
135 Ga0157372_10006976 3300013307 Bacteria 12029
136 Ga0157372_10214496 3300013307 Unclassified 2231
137 Ga0157375_10055534 3300013308 Bacteria 3906
138 Ga0157375_10131220 3300013308 Bacteria 2625
139 Ga0163163_10064270 3300014325 Bacteria 3641
140 Ga0163163_10069087 3300014325 Unclassified 3517
141 Ga0163163_10074248 3300014325 Unclassified 3392
142 Ga0163163_10216864 3300014325 Bacteria 1962
143 Ga0157379_10069746 3300014968 Bacteria 3144
144 Ga0207672_1000027 3300025223 Bacteria 18614
145 Ga0207656_10001882 3300025321 Bacteria 6984
146 Ga0207653_10000034 3300025885 Bacteria 103130
147 Ga0207653_10000638 3300025885 Bacteria 12055
148 Ga0207682_10040171 3300025893 Bacteria 1905
149 Ga0207710_10000001 3300025900 Bacteria 1797433
150 Ga0207647_10038154 3300025904 Unclassified 3039
151 Ga0207685_10000015 3300025905 Bacteria 170813
152 Ga0207643_10021809 3300025908 Unclassified 3523
153 Ga0207684_10000065 3300025910 Bacteria 194463
154 Ga0207707_10015997 3300025912 Bacteria 6543
155 Ga0207671_10016912 3300025914 Bacteria 5646
156 Ga0207671_10175410 3300025914 Bacteria 1666
157 Ga0207646_10000515 3300025922 Bacteria 51560
158 Ga0207646_10005716 3300025922 Bacteria 13043
159 Ga0207681_10036689 3300025923 Bacteria 3235
160 Ga0207694_10005990 3300025924 Bacteria 9313
161 Ga0207650_10000046 3300025925 Bacteria 178190
162 Ga0207650_10003790 3300025925 Bacteria 10341
163 Ga0207650_10030281 3300025925 Bacteria 3897
164 Ga0207659_10020048 3300025926 Unclassified 4413
165 Ga0207659_10077194 3300025926 Unclassified 2451
166 Ga0207644_10002547 3300025931 Bacteria 11731
167 Ga0207686_10000015 3300025934 Bacteria 202118
168 Ga0207686_10000581 3300025934 Bacteria 22911
169 Ga0207686_10004557 3300025934 Bacteria 7426
170 Ga0207686_10070633 3300025934 Unclassified 2244
171 Ga0207709_10000043 3300025935 Bacteria 248179
172 Ga0207709_10002880 3300025935 Bacteria 10535
173 Ga0207709_10003312 3300025935 Bacteria 9649
174 Ga0207670_10000381 3300025936 Bacteria 25536
175 Ga0207711_10030720 3300025941 Bacteria 4531
176 Ga0207651_10016522 3300025960 Bacteria 4326
177 Ga0207651_10161776 3300025960 Bacteria 1756
178 Ga0207712_10022654 3300025961 Unclassified 4139
179 Ga0207640_10039920 3300025981 Bacteria 2974
180 Ga0207703_10000110 3300026035 Bacteria 96947
181 Ga0207703_10019711 3300026035 Bacteria 5272
182 Ga0207708_10000083 3300026075 Bacteria 74423
183 Ga0207708_10028896 3300026075 Bacteria 4199
184 Ga0207708_10077974 3300026075 Bacteria 2543
185 Ga0207708_10117476 3300026075 Bacteria 2070
186 Ga0207641_10043086 3300026088 Bacteria 3788
187 Ga0207641_10174619 3300026088 Bacteria 1964
188 Ga0207641_10195172 3300026088 Bacteria 1863
189 Ga0207648_10113182 3300026089 Archaea 2383
190 Ga0207676_10006852 3300026095 Bacteria 8069
191 Ga0207675_100001228 3300026118 Bacteria 25571
192 Ga0207675_100104881 3300026118 Unclassified 2664
193 Ga0207675_100242399 3300026118 Bacteria 1742
194 Ga0207675_100289423 3300026118 Bacteria 1593
195 Ga0207428_10005872 3300027907 Bacteria 11378
196 Ga0207428_10045279 3300027907 Unclassified 3545
197 Ga0268264_10025220 3300028381 Bacteria 4857
198 Ga0268264_10113421 3300028381 Bacteria 2378
199 Ga0268264_10169564 3300028381 Bacteria 1973
200 Ga0307408_100004319 3300031548 Bacteria 9646
201 Ga0307405_10013880 3300031731 Bacteria 4311
202 Ga0307410_10038369 3300031852 Archaea 3137
203 Ga0307406_10002063 3300031901 Bacteria 10969
204 Ga0307412_10011768 3300031911 Bacteria 5076
205 Ga0307409_100290473 3300031995 Archaea 1516
206 Ga0307416_100001168 3300032002 Bacteria 14090
207 Ga0307414_10001587 3300032004 Bacteria 11795
208 Ga0307411_10029415 3300032005 Unclassified 3354
209 Ga0307415_100003112 3300032126 Bacteria 8395
210 Ga0307415_100050220 3300032126 Bacteria 2825
211 Ga0373951_0007250 3300035091 Bacteria 2522
212 Ga0395901_0085978 3300038443 Unclassified 3288
213 Ga0400490_07421 3300038726 Bacteria 6764
214 Ga0242420_006802 3300038996 Bacteria 1818
215 Ga0242420_014922 3300038996 Bacteria 1339
216 Ga0439460_0031986 3300042461 Bacteria 1504
217 Ga0450918_003545 3300042531 Bacteria 2894
218 Ga0451577_0035113 3300042876 Bacteria 4517
219 Ga0495663_0000350 3300046525 Bacteria 17196
220 Ga0495598_0024047 3300046537 Bacteria 1647
221 Ga0495621_0004079 3300046539 Bacteria 4068
222 Ga0496108_0131132 3300048911 Bacteria 2155
223 Ga0501296_003351 3300049519 Archaea 1707
224 Ga0501198_000830 3300049649 Bacteria 3857
225 Ga0501202_000421 3300049652 Bacteria 5950
226 Ga0501207_000063 3300049654 Bacteria 8180
227 Ga0501224_000404 3300049664 Bacteria 5147
228 Ga0501227_000859 3300049665 Bacteria 6628
229 Ga0501243_000934 3300049675 Bacteria 4091
230 Ga0501225_0001584 3300049705 Bacteria 7126
231 Ga0501234_000897 3300049707 Bacteria 4698
232 Ga0501226_002903 3300049853 Archaea 2064
233 nmdc:mga08y16_309935_c1 3300050511 Bacteria 1626
234 nmdc:mga08y16_972_c1 3300050511 Bacteria 27899
235 nmdc:mga0n895_41681_c1 3300050512 Bacteria 4463
236 nmdc:mga0rr50_246_c1 3300050513 Bacteria 29415
237 nmdc:mga0rr50_32858_c1 3300050513 Bacteria 3702
238 nmdc:mga08x19_13_c1 3300050514 Bacteria 366166
239 nmdc:mga0a205_162116_c1 3300050515 Unclassified 2132
240 nmdc:mga0a205_185005_c1 3300050515 Unclassified 1976
241 nmdc:mga0a205_32891_c1 3300050515 Bacteria 4973
242 nmdc:mga0a205_6104_c1 3300050515 Bacteria 10867
243 Ga0207684_10017127
244 CNAas_1000380
245 JGI24748J21848_1000003
246 JGI24034J26672_10000005
247 JGI24751J29686_10000249
248 JGI25406J46586_10004165
249 rootL2_10089699
250 Ga0065714_10064449
251 Ga0065714_10072925
252 Ga0065704_10007280
253 Ga0065712_10006050
254 Ga0065712_10067741
255 Ga0065712_10100504
256 Ga0065715_10014040
257 Ga0065715_10022171
258 Ga0065715_10089000
259 Ga0065715_10111812
260 Ga0065707_10004354
261 Ga0065707_10006215
262 Ga0065707_10114194
263 Ga0070670_100000118
264 Ga0070670_100009319
265 Ga0070670_100017304
266 Ga0070677_10036973
267 Ga0070682_100000068
268 Ga0070682_100010290
269 Ga0068868_100181131
270 Ga0070689_100049178
271 Ga0070692_10009141
272 Ga0070669_100026653
273 Ga0070675_100147514
274 Ga0070673_100018176
275 Ga0070703_10000100
276 Ga0070709_10155635
277 Ga0070701_10047870
278 Ga0070701_10114826
279 Ga0070705_100087582
280 Ga0070700_100000115
281 Ga0070694_100015587
282 Ga0070694_100017691
283 Ga0070694_100022400
284 Ga0070694_100026316
285 Ga0070663_100220226
286 Ga0070662_100217963
287 Ga0070681_10004545
288 Ga0070706_100000032
289 Ga0070706_100001897
290 Ga0070707_100001239
291 Ga0070707_100296227
292 Ga0070698_100000017
293 Ga0070698_100028116
294 Ga0070698_100104549
295 Ga0070699_100003796
296 Ga0070697_100019575
297 Ga0070697_100026502
298 Ga0070695_100020245
299 Ga0070696_100151019
300 Ga0070693_100007144
301 Ga0070704_100016763
302 Ga0070704_100023740
303 Ga0070704_100122998
304 Ga0070702_100003194
305 Ga0070702_100031356
306 Ga0068859_100002426
307 Ga0068859_100005869
308 Ga0068859_100078477
309 Ga0068859_100087335
310 Ga0068859_100130899
311 Ga0068859_100336401
312 Ga0068864_100184427
313 Ga0068864_100223458
314 Ga0068866_10023597
315 Ga0068861_100046818
316 Ga0068861_100052190
317 Ga0068851_10001543
318 Ga0068863_100321272
319 Ga0068858_100000026
320 Ga0068858_100009315
321 Ga0068860_100006586
322 Ga0068860_100072803
323 Ga0068860_100165121
324 Ga0068862_100077174
325 Ga0081539_10001451
326 Ga0081539_10023609
327 Ga0070715_10000022
328 Ga0068871_100005112
329 Ga0075428_100338167
330 Ga0075433_10024859
331 Ga0075434_100051324
332 Ga0075434_100065684
333 Ga0075429_100050212
334 Ga0075436_100000011
335 Ga0097620_100002426
336 Ga0097620_100005870
337 Ga0097620_100078476
338 Ga0097620_100087341
339 Ga0097620_100130900
340 Ga0097620_100336411
341 Ga0075435_100000796
342 Ga0111539_10014333
343 Ga0111539_10020389
344 Ga0111539_10228622
345 Ga0105247_10000022
346 Ga0105247_10001628
347 Ga0105247_10110933
348 Ga0114129_10170629
349 Ga0114129_10177091
350 Ga0105243_10000084
351 Ga0105243_10001349
352 Ga0105243_10005751
353 Ga0105243_10031074
354 Ga0105243_10262684
355 Ga0105241_10104172
356 Ga0105242_10000026
357 Ga0105242_10001968
358 Ga0105248_10026777
359 Ga0105248_10067307
360 Ga0105248_10069515
361 Ga0105248_10159993
362 Ga0105248_10335105
363 Ga0105237_10007870
364 Ga0105237_10088788
365 Ga0105238_10038181
366 Ga0105249_10055629
367 Ga0105249_10269603
368 Ga0105239_10072788
369 Ga0157373_10008416
370 Ga0157378_10000011
371 Ga0157378_10030635
372 Ga0157378_10065354
373 Ga0157378_10098290
374 Ga0157378_10108790
375 Ga0163162_10103053
376 Ga0163162_10142407
377 Ga0157372_10006976
378 Ga0157372_10214496
379 Ga0157375_10055534
380 Ga0157375_10131220
381 Ga0163163_10064270
382 Ga0163163_10069087
383 Ga0163163_10074248
384 Ga0163163_10216864
385 Ga0157379_10069746
386 Ga0207672_1000027
387 Ga0207656_10001882
388 Ga0207653_10000034
389 Ga0207653_10000638
390 Ga0207682_10040171
391 Ga0207710_10000001
392 Ga0207647_10038154
393 Ga0207685_10000015
394 Ga0207643_10021809
395 Ga0207684_10000065
396 Ga0207707_10015997
397 Ga0207671_10016912
398 Ga0207671_10175410
399 Ga0207646_10000515
400 Ga0207646_10005716
401 Ga0207681_10036689
402 Ga0207694_10005990
403 Ga0207650_10000046
404 Ga0207650_10003790
405 Ga0207650_10030281
406 Ga0207659_10020048
407 Ga0207659_10077194
408 Ga0207644_10002547
409 Ga0207686_10000015
410 Ga0207686_10000581
411 Ga0207686_10004557
412 Ga0207686_10070633
413 Ga0207709_10000043
414 Ga0207709_10002880
415 Ga0207709_10003312
416 Ga0207670_10000381
417 Ga0207711_10030720
418 Ga0207651_10016522
419 Ga0207651_10161776
420 Ga0207712_10022654
421 Ga0207640_10039920
422 Ga0207703_10000110
423 Ga0207703_10019711
424 Ga0207708_10000083
425 Ga0207708_10028896
426 Ga0207708_10077974
427 Ga0207708_10117476
428 Ga0207641_10043086
429 Ga0207641_10174619
430 Ga0207641_10195172
431 Ga0207648_10113182
432 Ga0207676_10006852
433 Ga0207675_100001228
434 Ga0207675_100104881
435 Ga0207675_100242399
436 Ga0207675_100289423
437 Ga0207428_10005872
438 Ga0207428_10045279
439 Ga0268264_10025220
440 Ga0268264_10113421
441 Ga0268264_10169564
442 Ga0307408_100004319
443 Ga0307405_10013880
444 Ga0307410_10038369
445 Ga0307406_10002063
446 Ga0307412_10011768
447 Ga0307409_100290473
448 Ga0307416_100001168
449 Ga0307414_10001587
450 Ga0307411_10029415
451 Ga0307415_100003112
452 Ga0307415_100050220
453 Ga0373951_0007250
454 Ga0395901_0085978
455 Ga0400490_07421
456 Ga0242420_006802
457 Ga0242420_014922
458 Ga0439460_0031986
459 Ga0450918_003545
460 Ga0451577_0035113
461 Ga0495663_0000350
462 Ga0495598_0024047
463 Ga0495621_0004079
464 Ga0496108_0131132
465 Ga0501296_003351
466 Ga0501198_000830
467 Ga0501202_000421
468 Ga0501207_000063
469 Ga0501224_000404
470 Ga0501227_000859
471 Ga0501243_000934
472 Ga0501225_0001584
473 Ga0501234_000897
474 Ga0501226_002903
475 nmdc:mga08y16_309935_c1
476 nmdc:mga08y16_972_c1
477 nmdc:mga0n895_41681_c1
478 nmdc:mga0rr50_246_c1
479 nmdc:mga0rr50_32858_c1
480 nmdc:mga08x19_13_c1
481 nmdc:mga0a205_162116_c1
482 nmdc:mga0a205_185005_c1
483 nmdc:mga0a205_32891_c1
484 nmdc:mga0a205_6104_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02879

PGM_PMM_II

Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain II

176

275

0.97

PF02878

PGM_PMM_I

Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I

27

159

0.94

PF02880

PGM_PMM_III

Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain III

279

387

0.94

PF00408

PGM_PMM_IV

Phosphoglucomutase/phosphomannomutase, C-terminal domain

395

468

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
6nns-assembly1.cif.gz_A xanthomonas citri phospho-pgm in complex with glucose-6-phosphate 0.9301 1 417
6nns-assembly1.cif.gz_A xanthomonas citri phospho-pgm in complex with glucose-6-phosphate 0.9174 1 417
2f7l-assembly1.cif.gz_A crystal structure of sulfolobus tokodaii phosphomannomutase/phosphoglucomutase 0.9067 4 419
1wqa-assembly1.cif.gz_A crystal structure of pyrococcus horikoshii phosphomannomutase/phosphoglucomutase complexed with mg2+ 0.8962 3 422
2f7l-assembly1.cif.gz_A crystal structure of sulfolobus tokodaii phosphomannomutase/phosphoglucomutase 0.8924 4 419
ID Description Score Start End Superfamily
af_O86374_10_144_3.40.120.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 0.9463 5 133 3.40.120.10
af_O86374_374_456_3.30.310.50 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Alpha-D-phosphohexomutase, C-terminal domain 0.9407 339 417 3.30.310.50
af_P24175_2_147_3.40.120.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 0.9376 1 147 3.40.120.10
af_Q57842_365_443_3.30.310.50 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Alpha-D-phosphohexomutase, C-terminal domain 0.9373 339 417 3.30.310.50
5bmpA04 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Alpha-D-phosphohexomutase, C-terminal domain 0.933 339 417 3.30.310.50
ID Description Score Start End GO Terms
AF-A0A354UBB0-F1-model_v4 Phosphomannomutase 0.9755 5 133 GO:0005975
GO:0016868
AF-A0A7V3FWH8-F1-model_v4 Phosphomannomutase 0.9653 1 233 GO:0000287
GO:0005975
GO:0016868
AF-A0A317I5H5-F1-model_v4 Phosphomannomutase 0.9652 1 418 GO:0000287
GO:0005975
GO:0016868
AF-A0A2E3I1S6-F1-model_v4 Phosphomannomutase/phosphoglucomutase 0.9592 5 417 GO:0000287
GO:0005975
GO:0016868
AF-A0A636JHN1-F1-model_v4 Phosphomannomutase (EC 5.4.2.8) 0.9578 2 133 GO:0000287
GO:0004615
GO:0005975

Map