F354398
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 242 | 168 | 242 | 197 |
Family's Representative Sequence
| Representative Sequence | 3300005365|Ga0070688_100000137|Ga0070688_1000001374 |
| Length | 210 |
| Sequence | VAAVAKERLKTSPKTPKARLFVALDLPEGTREGLVSWSQEALADPALRPVVAESLHITLAFLGYRPEEEIEAIAAAVRESAAPAPWVELRDPEQRPLRGRARLYALPAISPGAEALQAGLQERLVEAGFYEPEKRPFWPHVTVARVRPEARGSRRPAVVSEPPGAIPEELSEPRIAVRMALYRSELQPTGARYVPLAQVELPGGGGSEVI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 4 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 21 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 24 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 25 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 26 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 28 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 29 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 30 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 31 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 32 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 33 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 36 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 87 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 88 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 89 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 90 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 91 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 116 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 117 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 118 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 119 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 120 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 121 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 122 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 123 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 124 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 125 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 126 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 127 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 128 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 129 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 130 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 131 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 132 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 133 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 134 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 135 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 136 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 137 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 138 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 139 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 140 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 141 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 142 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 143 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 144 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 145 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 146 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 147 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 149 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 152 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 153 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 154 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 155 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 157 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 158 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 159 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 165 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 166 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 167 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 168 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.24 |
| Nodule | 0 |
| Rhizoplane | 7.02 |
| Rhizosphere | 83.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10108101 | 3300003320 | Bacteria | 2014 |
| 2 | Ga0070683_100003059 | 3300005329 | Bacteria | 13454 |
| 3 | Ga0070683_100003234 | 3300005329 | Bacteria | 13157 |
| 4 | Ga0070683_100047804 | 3300005329 | Bacteria | 3955 |
| 5 | Ga0070680_100227810 | 3300005336 | Bacteria | 1574 |
| 6 | Ga0070682_100000075 | 3300005337 | Bacteria | 90547 |
| 7 | Ga0070689_100074086 | 3300005340 | Bacteria | 2664 |
| 8 | Ga0070661_100489879 | 3300005344 | Bacteria | 983 |
| 9 | Ga0070668_100064914 | 3300005347 | Bacteria | 2831 |
| 10 | Ga0070675_100000106 | 3300005354 | Bacteria | 49336 |
| 11 | Ga0070688_100000027 | 3300005365 | Bacteria | 67477 |
| 12 | Ga0070688_100000137 | 3300005365 | Bacteria | 39585 |
| 13 | Ga0070688_100130307 | 3300005365 | Bacteria | 1696 |
| 14 | Ga0070667_100002442 | 3300005367 | Bacteria | 16243 |
| 15 | Ga0070667_100163342 | 3300005367 | Bacteria | 1963 |
| 16 | Ga0070713_100000010 | 3300005436 | Bacteria | 151790 |
| 17 | Ga0070710_10288297 | 3300005437 | Bacteria | 1068 |
| 18 | Ga0070701_10051203 | 3300005438 | Bacteria | 2142 |
| 19 | Ga0070711_100381511 | 3300005439 | Bacteria | 1140 |
| 20 | Ga0070663_100002752 | 3300005455 | Bacteria | 9970 |
| 21 | Ga0070678_100006248 | 3300005456 | Bacteria | 6972 |
| 22 | Ga0070685_10000118 | 3300005466 | Bacteria | 50597 |
| 23 | Ga0070685_10002554 | 3300005466 | Bacteria | 9326 |
| 24 | Ga0070679_100002077 | 3300005530 | Bacteria | 18024 |
| 25 | Ga0070684_100015622 | 3300005535 | Bacteria | 6190 |
| 26 | Ga0070684_100047409 | 3300005535 | Bacteria | 3724 |
| 27 | Ga0070684_100230306 | 3300005535 | Bacteria | 1692 |
| 28 | Ga0068853_100185623 | 3300005539 | Bacteria | 1888 |
| 29 | Ga0070672_100000001 | 3300005543 | Bacteria | 204624 |
| 30 | Ga0070665_100065857 | 3300005548 | Bacteria | 3634 |
| 31 | Ga0070665_100387813 | 3300005548 | Bacteria | 1404 |
| 32 | Ga0068857_100441139 | 3300005577 | Bacteria | 1216 |
| 33 | Ga0068854_100000597 | 3300005578 | Bacteria | 21452 |
| 34 | Ga0068856_100001059 | 3300005614 | Bacteria | 29152 |
| 35 | Ga0068856_100027559 | 3300005614 | Bacteria | 5542 |
| 36 | Ga0070702_100168539 | 3300005615 | Bacteria | 1422 |
| 37 | Ga0068852_100061398 | 3300005616 | Bacteria | 3267 |
| 38 | Ga0068851_10000302 | 3300005834 | Bacteria | 22566 |
| 39 | Ga0068851_10029808 | 3300005834 | Bacteria | 2703 |
| 40 | Ga0068860_100489293 | 3300005843 | Unclassified | 1227 |
| 41 | Ga0081455_10034650 | 3300005937 | Bacteria | 4521 |
| 42 | Ga0081540_1000041 | 3300005983 | Bacteria | 136874 |
| 43 | Ga0081539_10000878 | 3300005985 | Bacteria | 57633 |
| 44 | Ga0070715_10047040 | 3300006163 | Bacteria | 1837 |
| 45 | Ga0070712_100156219 | 3300006175 | Bacteria | 1757 |
| 46 | Ga0068865_100000069 | 3300006881 | Bacteria | 53927 |
| 47 | Ga0105245_10018765 | 3300009098 | Bacteria | 6051 |
| 48 | Ga0105245_10058384 | 3300009098 | Bacteria | 3473 |
| 49 | Ga0105247_10000305 | 3300009101 | Bacteria | 44071 |
| 50 | Ga0105243_10010691 | 3300009148 | Bacteria | 6957 |
| 51 | Ga0105241_10215062 | 3300009174 | Bacteria | 1612 |
| 52 | Ga0105248_10000020 | 3300009177 | Bacteria | 284637 |
| 53 | Ga0105248_10688495 | 3300009177 | Unclassified | 1153 |
| 54 | Ga0105237_10709452 | 3300009545 | Bacteria | 1012 |
| 55 | Ga0105238_10407758 | 3300009551 | Bacteria | 1353 |
| 56 | Ga0105239_10066082 | 3300010375 | Bacteria | 3973 |
| 57 | Ga0157371_10007489 | 3300013102 | Bacteria | 8833 |
| 58 | Ga0157370_10033370 | 3300013104 | Bacteria | 5019 |
| 59 | Ga0157370_10100710 | 3300013104 | Bacteria | 2707 |
| 60 | Ga0157369_10000074 | 3300013105 | Bacteria | 136668 |
| 61 | Ga0157378_10005076 | 3300013297 | Bacteria | 11564 |
| 62 | Ga0157378_10037100 | 3300013297 | Bacteria | 4316 |
| 63 | Ga0157378_10101360 | 3300013297 | Bacteria | 2629 |
| 64 | Ga0163162_10226863 | 3300013306 | Bacteria | 1998 |
| 65 | Ga0163162_10702319 | 3300013306 | Bacteria | 1133 |
| 66 | Ga0157372_10000204 | 3300013307 | Bacteria | 65798 |
| 67 | Ga0157380_10000411 | 3300014326 | Bacteria | 26029 |
| 68 | Ga0157379_10295390 | 3300014968 | Unclassified | 1476 |
| 69 | Ga0157376_10021098 | 3300014969 | Bacteria | 5055 |
| 70 | Ga0207656_10000183 | 3300025321 | Bacteria | 22582 |
| 71 | Ga0207656_10017807 | 3300025321 | Bacteria | 2788 |
| 72 | Ga0207710_10000157 | 3300025900 | Bacteria | 72764 |
| 73 | Ga0207680_10011208 | 3300025903 | Bacteria | 4520 |
| 74 | Ga0207680_10066438 | 3300025903 | Bacteria | 2218 |
| 75 | Ga0207680_10163900 | 3300025903 | Bacteria | 1493 |
| 76 | Ga0207685_10192671 | 3300025905 | Bacteria | 952 |
| 77 | Ga0207654_10264137 | 3300025911 | Bacteria | 1158 |
| 78 | Ga0207671_10280510 | 3300025914 | Bacteria | 1314 |
| 79 | Ga0207693_10148182 | 3300025915 | Bacteria | 1845 |
| 80 | Ga0207663_10334674 | 3300025916 | Bacteria | 1142 |
| 81 | Ga0207660_10618229 | 3300025917 | Bacteria | 883 |
| 82 | Ga0207652_10008375 | 3300025921 | Bacteria | 8318 |
| 83 | Ga0207659_10000013 | 3300025926 | Bacteria | 172742 |
| 84 | Ga0207687_10000036 | 3300025927 | Bacteria | 121934 |
| 85 | Ga0207687_10005321 | 3300025927 | Bacteria | 8522 |
| 86 | Ga0207700_10000007 | 3300025928 | Bacteria | 345720 |
| 87 | Ga0207700_10343154 | 3300025928 | Bacteria | 1299 |
| 88 | Ga0207664_10086218 | 3300025929 | Bacteria | 2565 |
| 89 | Ga0207644_10220576 | 3300025931 | Unclassified | 1503 |
| 90 | Ga0207690_10228031 | 3300025932 | Bacteria | 1429 |
| 91 | Ga0207709_10017922 | 3300025935 | Bacteria | 3960 |
| 92 | Ga0207670_10061400 | 3300025936 | Bacteria | 2565 |
| 93 | Ga0207704_10000049 | 3300025938 | Bacteria | 83173 |
| 94 | Ga0207691_10000747 | 3300025940 | Bacteria | 32117 |
| 95 | Ga0207711_10000006 | 3300025941 | Bacteria | 792692 |
| 96 | Ga0207661_10000921 | 3300025944 | Bacteria | 19315 |
| 97 | Ga0207661_10001320 | 3300025944 | Bacteria | 16601 |
| 98 | Ga0207661_10060708 | 3300025944 | Bacteria | 3052 |
| 99 | Ga0207712_10795039 | 3300025961 | Bacteria | 831 |
| 100 | Ga0207668_10036411 | 3300025972 | Bacteria | 3284 |
| 101 | Ga0207668_10367707 | 3300025972 | Bacteria | 1207 |
| 102 | Ga0207640_10000274 | 3300025981 | Bacteria | 34698 |
| 103 | Ga0207658_10003077 | 3300025986 | Bacteria | 11924 |
| 104 | Ga0207639_10204062 | 3300026041 | Bacteria | 1697 |
| 105 | Ga0207678_10003882 | 3300026067 | Bacteria | 13444 |
| 106 | Ga0207702_10000789 | 3300026078 | Bacteria | 33612 |
| 107 | Ga0207683_10012718 | 3300026121 | Bacteria | 7181 |
| 108 | Ga0207698_10068532 | 3300026142 | Bacteria | 2802 |
| 109 | Ga0268266_10000674 | 3300028379 | Bacteria | 46135 |
| 110 | Ga0268266_10003217 | 3300028379 | Bacteria | 16504 |
| 111 | Ga0268266_10045888 | 3300028379 | Bacteria | 3740 |
| 112 | Ga0268266_10341346 | 3300028379 | Bacteria | 1406 |
| 113 | Ga0268264_10158286 | 3300028381 | Bacteria | 2038 |
| 114 | Ga0307513_10588999 | 3300031456 | Unclassified | 822 |
| 115 | Ga0451807_2641803 | 3300041486 | Bacteria | 1339 |
| 116 | Ga0466963_0018534 | 3300044694 | Bacteria | 4354 |
| 117 | Ga0466963_0024864 | 3300044694 | Bacteria | 3814 |
| 118 | Ga0466957_0003672 | 3300044842 | Bacteria | 8471 |
| 119 | Ga0466957_0018509 | 3300044842 | Bacteria | 4092 |
| 120 | Ga0466967_0000001 | 3300045976 | Bacteria | 229823 |
| 121 | Ga0495629_0022164 | 3300046459 | Bacteria | 4530 |
| 122 | Ga0495629_0042947 | 3300046459 | Bacteria | 3175 |
| 123 | Ga0495638_0025744 | 3300046460 | Bacteria | 3820 |
| 124 | Ga0495606_0000040 | 3300046507 | Bacteria | 223500 |
| 125 | Ga0495608_0000007 | 3300046511 | Bacteria | 313495 |
| 126 | Ga0495608_0221570 | 3300046511 | Bacteria | 1187 |
| 127 | Ga0495628_0000815 | 3300046516 | Bacteria | 28812 |
| 128 | Ga0495630_0233982 | 3300046517 | Bacteria | 1404 |
| 129 | Ga0495652_0000037 | 3300046529 | Bacteria | 133232 |
| 130 | Ga0495640_0062799 | 3300046533 | Bacteria | 2518 |
| 131 | Ga0495587_0025706 | 3300046536 | Bacteria | 3596 |
| 132 | Ga0495587_0070100 | 3300046536 | Bacteria | 2041 |
| 133 | Ga0495597_0178389 | 3300046542 | Bacteria | 859 |
| 134 | Ga0495634_0000293 | 3300046642 | Bacteria | 47827 |
| 135 | Ga0495625_0400969 | 3300046660 | Unclassified | 857 |
| 136 | Ga0495588_0000387 | 3300046674 | Bacteria | 25193 |
| 137 | Ga0495657_0000001 | 3300046675 | Bacteria | 445641 |
| 138 | Ga0495613_0000041 | 3300046689 | Bacteria | 130784 |
| 139 | Ga0495600_0007461 | 3300046809 | Bacteria | 6693 |
| 140 | Ga0495604_0000050 | 3300047317 | Bacteria | 108094 |
| 141 | Ga0495604_0000718 | 3300047317 | Bacteria | 28069 |
| 142 | Ga0495674_0000030 | 3300047319 | Bacteria | 115975 |
| 143 | Ga0495672_0089182 | 3300047320 | Bacteria | 1698 |
| 144 | Ga0495676_0235646 | 3300047321 | Bacteria | 1255 |
| 145 | Ga0495675_0000055 | 3300047444 | Bacteria | 77878 |
| 146 | Ga0495684_0192998 | 3300047471 | Bacteria | 1505 |
| 147 | Ga0495593_0020972 | 3300047673 | Bacteria | 3653 |
| 148 | Ga0495602_0000007 | 3300048088 | Bacteria | 273212 |
| 149 | Ga0495602_0001626 | 3300048088 | Bacteria | 22343 |
| 150 | Ga0496102_0012083 | 3300048905 | Bacteria | 7461 |
| 151 | Ga0496102_0024328 | 3300048905 | Bacteria | 5384 |
| 152 | Ga0496104_0000015 | 3300048907 | Bacteria | 374530 |
| 153 | Ga0496104_0109677 | 3300048907 | Bacteria | 2645 |
| 154 | Ga0496105_0000004 | 3300048908 | Bacteria | 475798 |
| 155 | Ga0496105_0011568 | 3300048908 | Bacteria | 6978 |
| 156 | Ga0496108_0000741 | 3300048911 | Bacteria | 25376 |
| 157 | Ga0496109_0000088 | 3300048912 | Bacteria | 94877 |
| 158 | Ga0496109_0000261 | 3300048912 | Bacteria | 50812 |
| 159 | Ga0496110_0000038 | 3300048913 | Bacteria | 64272 |
| 160 | Ga0496111_0000192 | 3300048914 | Bacteria | 28263 |
| 161 | Ga0496111_0022799 | 3300048914 | Bacteria | 4387 |
| 162 | Ga0496113_0000013 | 3300048916 | Bacteria | 81224 |
| 163 | Ga0496114_0126581 | 3300048917 | Bacteria | 2203 |
| 164 | Ga0496114_0412463 | 3300048917 | Bacteria | 1196 |
| 165 | Ga0496115_0000659 | 3300048918 | Bacteria | 25718 |
| 166 | Ga0496117_0010297 | 3300048920 | Bacteria | 8550 |
| 167 | Ga0496117_0187536 | 3300048920 | Bacteria | 1182 |
| 168 | Ga0496118_0027567 | 3300048921 | Bacteria | 4803 |
| 169 | Ga0496118_0323699 | 3300048921 | Bacteria | 835 |
| 170 | Ga0496118_0384220 | 3300048921 | Bacteria | 735 |
| 171 | Ga0496119_0002793 | 3300048922 | Bacteria | 18720 |
| 172 | Ga0496119_0006931 | 3300048922 | Bacteria | 10337 |
| 173 | Ga0496119_0027523 | 3300048922 | Bacteria | 3905 |
| 174 | Ga0496120_0004688 | 3300048923 | Bacteria | 11285 |
| 175 | Ga0496120_0098305 | 3300048923 | Bacteria | 1552 |
| 176 | Ga0496121_0020522 | 3300048924 | Bacteria | 6532 |
| 177 | Ga0496121_0022107 | 3300048924 | Bacteria | 6189 |
| 178 | Ga0496121_0157027 | 3300048924 | Bacteria | 1668 |
| 179 | Ga0496121_0182415 | 3300048924 | Bacteria | 1513 |
| 180 | Ga0496124_0041287 | 3300048927 | Bacteria | 3982 |
| 181 | Ga0496125_0025091 | 3300048928 | Bacteria | 5468 |
| 182 | Ga0496125_0068251 | 3300048928 | Bacteria | 2798 |
| 183 | Ga0496126_0004726 | 3300048929 | Bacteria | 16073 |
| 184 | Ga0501031_0000322 | 3300049568 | Bacteria | 27494 |
| 185 | Ga0501032_0000826 | 3300049569 | Bacteria | 25207 |
| 186 | Ga0501033_0001043 | 3300049570 | Bacteria | 25258 |
| 187 | Ga0501034_0007054 | 3300049571 | Bacteria | 11985 |
| 188 | Ga0501036_0001543 | 3300049572 | Bacteria | 17799 |
| 189 | Ga0501037_0000695 | 3300049573 | Bacteria | 25643 |
| 190 | Ga0501038_0000822 | 3300049574 | Bacteria | 27621 |
| 191 | Ga0501038_0506787 | 3300049574 | Bacteria | 922 |
| 192 | Ga0501039_0029779 | 3300049575 | Bacteria | 4206 |
| 193 | Ga0501040_0015632 | 3300049576 | Bacteria | 5017 |
| 194 | Ga0501042_0066774 | 3300049578 | Bacteria | 2571 |
| 195 | Ga0501043_0001320 | 3300049579 | Bacteria | 21690 |
| 196 | Ga0501043_0182239 | 3300049579 | Bacteria | 1636 |
| 197 | Ga0501046_0001474 | 3300049580 | Bacteria | 22598 |
| 198 | Ga0501047_0000430 | 3300049581 | Bacteria | 46649 |
| 199 | Ga0501047_0067306 | 3300049581 | Bacteria | 3452 |
| 200 | Ga0501047_0077283 | 3300049581 | Bacteria | 3203 |
| 201 | Ga0501048_0001198 | 3300049582 | Bacteria | 19630 |
| 202 | Ga0501068_0036223 | 3300049584 | Bacteria | 2949 |
| 203 | Ga0501068_0150582 | 3300049584 | Bacteria | 1462 |
| 204 | Ga0501069_0006674 | 3300049585 | Bacteria | 6040 |
| 205 | Ga0501069_0052328 | 3300049585 | Bacteria | 2273 |
| 206 | Ga0501070_0001324 | 3300049586 | Bacteria | 22140 |
| 207 | Ga0501070_0169845 | 3300049586 | Bacteria | 1796 |
| 208 | Ga0501070_0205746 | 3300049586 | Bacteria | 1616 |
| 209 | Ga0501071_0115463 | 3300049587 | Bacteria | 1986 |
| 210 | Ga0501071_0357846 | 3300049587 | Bacteria | 1111 |
| 211 | Ga0501073_0003541 | 3300049589 | Bacteria | 11724 |
| 212 | Ga0501074_0040819 | 3300049590 | Bacteria | 3359 |
| 213 | Ga0501074_0140274 | 3300049590 | Bacteria | 1729 |
| 214 | Ga0501079_0027642 | 3300049741 | Bacteria | 4351 |
| 215 | Ga0501079_0043611 | 3300049741 | Bacteria | 3462 |
| 216 | Ga0501080_0022456 | 3300049742 | Bacteria | 5845 |
| 217 | Ga0501080_0566190 | 3300049742 | Bacteria | 1011 |
| 218 | Ga0501083_0005247 | 3300049744 | Bacteria | 9163 |
| 219 | Ga0501083_0011019 | 3300049744 | Bacteria | 6353 |
| 220 | Ga0501083_0030738 | 3300049744 | Bacteria | 3687 |
| 221 | Ga0501083_0170940 | 3300049744 | Unclassified | 1420 |
| 222 | Ga0501035_0005572 | 3300049822 | Bacteria | 11896 |
| 223 | Ga0501044_0001702 | 3300049823 | Bacteria | 25807 |
| 224 | Ga0501044_0079955 | 3300049823 | Bacteria | 3311 |
| 225 | Ga0501044_0174064 | 3300049823 | Bacteria | 2122 |
| 226 | Ga0501044_0316567 | 3300049823 | Unclassified | 1486 |
| 227 | Ga0501045_0019552 | 3300049824 | Bacteria | 4830 |
| 228 | Ga0495601_0000043 | 3300053077 | Bacteria | 77025 |
| 229 | Ga0495601_0231097 | 3300053077 | Bacteria | 1208 |
| 230 | Ga0495601_0387766 | 3300053077 | Bacteria | 906 |
| 231 | Ga0495612_0012196 | 3300053078 | Bacteria | 3465 |
| 232 | Ga0495612_0078841 | 3300053078 | Bacteria | 1382 |
| 233 | Ga0495655_0001597 | 3300053083 | Bacteria | 3491 |
| 234 | Ga0495595_0000002 | 3300053084 | Bacteria | 445641 |
| 235 | Ga0495595_0004470 | 3300053084 | Bacteria | 5630 |
| 236 | Ga0495619_0000047 | 3300053085 | Bacteria | 102152 |
| 237 | Ga0495619_0000095 | 3300053085 | Bacteria | 66204 |
| 238 | Ga0500566_0025954 | 3300053094 | Bacteria | 3430 |
| 239 | Ga0500595_016852 | 3300053119 | Bacteria | 2713 |
| 240 | Ga0500568_0051036 | 3300053139 | Bacteria | 1629 |
| 241 | Ga0501084_0060740 | 3300054114 | Bacteria | 3164 |
| 242 | Ga0501082_0001614 | 3300060353 | Bacteria | 19859 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048908 | Ga0496105_0011568 | Ga0496105_0011568_3496_4107 | 166 |
| 2 | 3300005336 | Ga0070680_100227810 | Ga0070680_1002278102 | 176 |
| 3 | 3300005985 | Ga0081539_10000878 | Ga0081539_1000087854 | 179 |
| 4 | 3300046533 | Ga0495640_0062799 | Ga0495640_0062799_14_568 | 179 |
| 5 | 3300013306 | Ga0163162_10702319 | Ga0163162_107023191 | 181 |
| 6 | 3300048917 | Ga0496114_0412463 | Ga0496114_0412463_604_1167 | 182 |
| 7 | 3300048918 | Ga0496115_0000659 | Ga0496115_0000659_3557_4120 | 182 |
| 8 | 3300014969 | Ga0157376_10021098 | Ga0157376_100210984 | 183 |
| 9 | 3300046536 | Ga0495587_0025706 | Ga0495587_0025706_2897_3463 | 183 |
| 10 | 3300048920 | Ga0496117_0187536 | Ga0496117_0187536_435_1001 | 183 |
| 11 | 3300048921 | Ga0496118_0323699 | Ga0496118_0323699_19_585 | 183 |
| 12 | 3300048922 | Ga0496119_0027523 | Ga0496119_0027523_2003_2569 | 183 |
| 13 | 3300048923 | Ga0496120_0004688 | Ga0496120_0004688_10569_11135 | 183 |
| 14 | 3300048924 | Ga0496121_0020522 | Ga0496121_0020522_4842_5408 | 183 |
| 15 | 3300048924 | Ga0496121_0157027 | Ga0496121_0157027_699_1265 | 183 |
| 16 | 3300048924 | Ga0496121_0182415 | Ga0496121_0182415_219_785 | 183 |
| 17 | 3300048928 | Ga0496125_0068251 | Ga0496125_0068251_425_991 | 183 |
| 18 | 3300053139 | Ga0500568_0051036 | Ga0500568_0051036_874_1440 | 183 |
| 19 | 3300046542 | Ga0495597_0178389 | Ga0495597_0178389_18_587 | 184 |
| 20 | 3300049823 | Ga0501044_0079955 | Ga0501044_0079955_2222_2791 | 184 |
| 21 | 3300049574 | Ga0501038_0506787 | Ga0501038_0506787_51_662 | 187 |
| 22 | 3300005577 | Ga0068857_100441139 | Ga0068857_1004411392 | 189 |
| 23 | 3300005983 | Ga0081540_1000041 | Ga0081540_100004126 | 189 |
| 24 | 3300005329 | Ga0070683_100003059 | Ga0070683_1000030596 | 190 |
| 25 | 3300005329 | Ga0070683_100047804 | Ga0070683_1000478044 | 190 |
| 26 | 3300005344 | Ga0070661_100489879 | Ga0070661_1004898791 | 190 |
| 27 | 3300005367 | Ga0070667_100002442 | Ga0070667_10000244214 | 190 |
| 28 | 3300005455 | Ga0070663_100002752 | Ga0070663_1000027523 | 190 |
| 29 | 3300005530 | Ga0070679_100002077 | Ga0070679_10000207717 | 190 |
| 30 | 3300005535 | Ga0070684_100015622 | Ga0070684_1000156222 | 190 |
| 31 | 3300005535 | Ga0070684_100230306 | Ga0070684_1002303062 | 190 |
| 32 | 3300005548 | Ga0070665_100387813 | Ga0070665_1003878132 | 190 |
| 33 | 3300005614 | Ga0068856_100027559 | Ga0068856_1000275594 | 190 |
| 34 | 3300005937 | Ga0081455_10034650 | Ga0081455_100346503 | 190 |
| 35 | 3300006175 | Ga0070712_100156219 | Ga0070712_1001562192 | 190 |
| 36 | 3300009545 | Ga0105237_10709452 | Ga0105237_107094521 | 190 |
| 37 | 3300009551 | Ga0105238_10407758 | Ga0105238_104077582 | 190 |
| 38 | 3300013306 | Ga0163162_10226863 | Ga0163162_102268632 | 190 |
| 39 | 3300025903 | Ga0207680_10066438 | Ga0207680_100664382 | 190 |
| 40 | 3300025903 | Ga0207680_10163900 | Ga0207680_101639002 | 190 |
| 41 | 3300025914 | Ga0207671_10280510 | Ga0207671_102805102 | 190 |
| 42 | 3300025915 | Ga0207693_10148182 | Ga0207693_101481822 | 190 |
| 43 | 3300025917 | Ga0207660_10618229 | Ga0207660_106182291 | 190 |
| 44 | 3300025921 | Ga0207652_10008375 | Ga0207652_100083755 | 190 |
| 45 | 3300025944 | Ga0207661_10001320 | Ga0207661_100013209 | 190 |
| 46 | 3300025944 | Ga0207661_10060708 | Ga0207661_100607082 | 190 |
| 47 | 3300025972 | Ga0207668_10367707 | Ga0207668_103677072 | 190 |
| 48 | 3300025986 | Ga0207658_10003077 | Ga0207658_100030773 | 190 |
| 49 | 3300026067 | Ga0207678_10003882 | Ga0207678_100038825 | 190 |
| 50 | 3300028379 | Ga0268266_10000674 | Ga0268266_100006746 | 190 |
| 51 | 3300044694 | Ga0466963_0024864 | Ga0466963_0024864_743_1339 | 190 |
| 52 | 3300046511 | Ga0495608_0221570 | Ga0495608_0221570_581_1168 | 190 |
| 53 | 3300046642 | Ga0495634_0000293 | Ga0495634_0000293_34286_34873 | 190 |
| 54 | 3300047319 | Ga0495674_0000030 | Ga0495674_0000030_52166_52762 | 190 |
| 55 | 3300047471 | Ga0495684_0192998 | Ga0495684_0192998_308_895 | 190 |
| 56 | 3300048905 | Ga0496102_0012083 | Ga0496102_0012083_451_1038 | 190 |
| 57 | 3300048907 | Ga0496104_0109677 | Ga0496104_0109677_60_647 | 190 |
| 58 | 3300048912 | Ga0496109_0000261 | Ga0496109_0000261_32292_32888 | 190 |
| 59 | 3300048920 | Ga0496117_0010297 | Ga0496117_0010297_5828_6415 | 190 |
| 60 | 3300048921 | Ga0496118_0027567 | Ga0496118_0027567_4160_4747 | 190 |
| 61 | 3300048921 | Ga0496118_0384220 | Ga0496118_0384220_138_725 | 190 |
| 62 | 3300048922 | Ga0496119_0002793 | Ga0496119_0002793_6527_7114 | 190 |
| 63 | 3300048922 | Ga0496119_0006931 | Ga0496119_0006931_3728_4315 | 190 |
| 64 | 3300048924 | Ga0496121_0022107 | Ga0496121_0022107_347_934 | 190 |
| 65 | 3300048927 | Ga0496124_0041287 | Ga0496124_0041287_1048_1635 | 190 |
| 66 | 3300048928 | Ga0496125_0025091 | Ga0496125_0025091_475_1062 | 190 |
| 67 | 3300049568 | Ga0501031_0000322 | Ga0501031_0000322_13429_14016 | 190 |
| 68 | 3300049569 | Ga0501032_0000826 | Ga0501032_0000826_8626_9213 | 190 |
| 69 | 3300049570 | Ga0501033_0001043 | Ga0501033_0001043_15975_16562 | 190 |
| 70 | 3300049571 | Ga0501034_0007054 | Ga0501034_0007054_1193_1780 | 190 |
| 71 | 3300049572 | Ga0501036_0001543 | Ga0501036_0001543_1011_1598 | 190 |
| 72 | 3300049573 | Ga0501037_0000695 | Ga0501037_0000695_15968_16555 | 190 |
| 73 | 3300049574 | Ga0501038_0000822 | Ga0501038_0000822_13425_14012 | 190 |
| 74 | 3300049575 | Ga0501039_0029779 | Ga0501039_0029779_3246_3833 | 190 |
| 75 | 3300049576 | Ga0501040_0015632 | Ga0501040_0015632_2025_2612 | 190 |
| 76 | 3300049578 | Ga0501042_0066774 | Ga0501042_0066774_545_1132 | 190 |
| 77 | 3300049579 | Ga0501043_0001320 | Ga0501043_0001320_7669_8256 | 190 |
| 78 | 3300049579 | Ga0501043_0182239 | Ga0501043_0182239_1034_1621 | 190 |
| 79 | 3300049580 | Ga0501046_0001474 | Ga0501046_0001474_13386_13973 | 190 |
| 80 | 3300049581 | Ga0501047_0000430 | Ga0501047_0000430_29835_30422 | 190 |
| 81 | 3300049581 | Ga0501047_0067306 | Ga0501047_0067306_1883_2470 | 190 |
| 82 | 3300049581 | Ga0501047_0077283 | Ga0501047_0077283_1263_1850 | 190 |
| 83 | 3300049582 | Ga0501048_0001198 | Ga0501048_0001198_13619_14206 | 190 |
| 84 | 3300049584 | Ga0501068_0036223 | Ga0501068_0036223_1256_1843 | 190 |
| 85 | 3300049585 | Ga0501069_0006674 | Ga0501069_0006674_1935_2522 | 190 |
| 86 | 3300049585 | Ga0501069_0052328 | Ga0501069_0052328_1633_2220 | 190 |
| 87 | 3300049586 | Ga0501070_0001324 | Ga0501070_0001324_8115_8702 | 190 |
| 88 | 3300049586 | Ga0501070_0169845 | Ga0501070_0169845_332_919 | 190 |
| 89 | 3300049586 | Ga0501070_0205746 | Ga0501070_0205746_318_905 | 190 |
| 90 | 3300049587 | Ga0501071_0115463 | Ga0501071_0115463_808_1395 | 190 |
| 91 | 3300049587 | Ga0501071_0357846 | Ga0501071_0357846_285_872 | 190 |
| 92 | 3300049589 | Ga0501073_0003541 | Ga0501073_0003541_7843_8430 | 190 |
| 93 | 3300049590 | Ga0501074_0040819 | Ga0501074_0040819_1228_1815 | 190 |
| 94 | 3300049590 | Ga0501074_0140274 | Ga0501074_0140274_703_1290 | 190 |
| 95 | 3300049741 | Ga0501079_0027642 | Ga0501079_0027642_253_840 | 190 |
| 96 | 3300049741 | Ga0501079_0043611 | Ga0501079_0043611_2415_3002 | 190 |
| 97 | 3300049742 | Ga0501080_0022456 | Ga0501080_0022456_1567_2154 | 190 |
| 98 | 3300049742 | Ga0501080_0566190 | Ga0501080_0566190_213_806 | 190 |
| 99 | 3300049744 | Ga0501083_0005247 | Ga0501083_0005247_6239_6826 | 190 |
| 100 | 3300049744 | Ga0501083_0011019 | Ga0501083_0011019_2320_2907 | 190 |
| 101 | 3300049744 | Ga0501083_0030738 | Ga0501083_0030738_1337_1924 | 190 |
| 102 | 3300049744 | Ga0501083_0170940 | Ga0501083_0170940_762_1349 | 190 |
| 103 | 3300049822 | Ga0501035_0005572 | Ga0501035_0005572_7564_8151 | 190 |
| 104 | 3300049823 | Ga0501044_0001702 | Ga0501044_0001702_16453_17040 | 190 |
| 105 | 3300049823 | Ga0501044_0174064 | Ga0501044_0174064_1151_1738 | 190 |
| 106 | 3300049823 | Ga0501044_0316567 | Ga0501044_0316567_822_1409 | 190 |
| 107 | 3300049824 | Ga0501045_0019552 | Ga0501045_0019552_3901_4488 | 190 |
| 108 | 3300053119 | Ga0500595_016852 | Ga0500595_016852_2094_2681 | 190 |
| 109 | 3300054114 | Ga0501084_0060740 | Ga0501084_0060740_2198_2785 | 190 |
| 110 | 3300060353 | Ga0501082_0001614 | Ga0501082_0001614_5902_6489 | 190 |
| 111 | 3300005329 | Ga0070683_100003234 | Ga0070683_1000032346 | 191 |
| 112 | 3300005337 | Ga0070682_100000075 | Ga0070682_10000007549 | 191 |
| 113 | 3300005347 | Ga0070668_100064914 | Ga0070668_1000649142 | 191 |
| 114 | 3300005354 | Ga0070675_100000106 | Ga0070675_10000010632 | 191 |
| 115 | 3300005365 | Ga0070688_100000027 | Ga0070688_1000000275 | 191 |
| 116 | 3300005456 | Ga0070678_100006248 | Ga0070678_1000062485 | 191 |
| 117 | 3300005466 | Ga0070685_10002554 | Ga0070685_100025545 | 191 |
| 118 | 3300005535 | Ga0070684_100047409 | Ga0070684_1000474092 | 191 |
| 119 | 3300005539 | Ga0068853_100185623 | Ga0068853_1001856231 | 191 |
| 120 | 3300005543 | Ga0070672_100000001 | Ga0070672_10000000154 | 191 |
| 121 | 3300005548 | Ga0070665_100065857 | Ga0070665_1000658572 | 191 |
| 122 | 3300005578 | Ga0068854_100000597 | Ga0068854_1000005977 | 191 |
| 123 | 3300005614 | Ga0068856_100001059 | Ga0068856_10000105911 | 191 |
| 124 | 3300005616 | Ga0068852_100061398 | Ga0068852_1000613982 | 191 |
| 125 | 3300005834 | Ga0068851_10000302 | Ga0068851_1000030210 | 191 |
| 126 | 3300005834 | Ga0068851_10029808 | Ga0068851_100298082 | 191 |
| 127 | 3300006163 | Ga0070715_10047040 | Ga0070715_100470402 | 191 |
| 128 | 3300006881 | Ga0068865_100000069 | Ga0068865_1000000692 | 191 |
| 129 | 3300009098 | Ga0105245_10018765 | Ga0105245_100187654 | 191 |
| 130 | 3300009148 | Ga0105243_10010691 | Ga0105243_100106914 | 191 |
| 131 | 3300009174 | Ga0105241_10215062 | Ga0105241_102150622 | 191 |
| 132 | 3300010375 | Ga0105239_10066082 | Ga0105239_100660824 | 191 |
| 133 | 3300013102 | Ga0157371_10007489 | Ga0157371_100074891 | 191 |
| 134 | 3300013104 | Ga0157370_10033370 | Ga0157370_100333702 | 191 |
| 135 | 3300013297 | Ga0157378_10005076 | Ga0157378_100050768 | 191 |
| 136 | 3300013297 | Ga0157378_10037100 | Ga0157378_100371004 | 191 |
| 137 | 3300013307 | Ga0157372_10000204 | Ga0157372_1000020453 | 191 |
| 138 | 3300025321 | Ga0207656_10000183 | Ga0207656_1000018312 | 191 |
| 139 | 3300025321 | Ga0207656_10017807 | Ga0207656_100178072 | 191 |
| 140 | 3300025903 | Ga0207680_10011208 | Ga0207680_100112084 | 191 |
| 141 | 3300025905 | Ga0207685_10192671 | Ga0207685_101926711 | 191 |
| 142 | 3300025911 | Ga0207654_10264137 | Ga0207654_102641372 | 191 |
| 143 | 3300025926 | Ga0207659_10000013 | Ga0207659_1000001347 | 191 |
| 144 | 3300025927 | Ga0207687_10005321 | Ga0207687_100053216 | 191 |
| 145 | 3300025929 | Ga0207664_10086218 | Ga0207664_100862182 | 191 |
| 146 | 3300025935 | Ga0207709_10017922 | Ga0207709_100179222 | 191 |
| 147 | 3300025938 | Ga0207704_10000049 | Ga0207704_1000004912 | 191 |
| 148 | 3300025940 | Ga0207691_10000747 | Ga0207691_1000074711 | 191 |
| 149 | 3300025944 | Ga0207661_10000921 | Ga0207661_100009217 | 191 |
| 150 | 3300025972 | Ga0207668_10036411 | Ga0207668_100364112 | 191 |
| 151 | 3300025981 | Ga0207640_10000274 | Ga0207640_1000027420 | 191 |
| 152 | 3300026041 | Ga0207639_10204062 | Ga0207639_102040621 | 191 |
| 153 | 3300026078 | Ga0207702_10000789 | Ga0207702_1000078916 | 191 |
| 154 | 3300026121 | Ga0207683_10012718 | Ga0207683_100127185 | 191 |
| 155 | 3300026142 | Ga0207698_10068532 | Ga0207698_100685322 | 191 |
| 156 | 3300028379 | Ga0268266_10003217 | Ga0268266_1000321711 | 191 |
| 157 | 3300028379 | Ga0268266_10045888 | Ga0268266_100458882 | 191 |
| 158 | 3300046459 | Ga0495629_0042947 | Ga0495629_0042947_681_1280 | 191 |
| 159 | 3300046507 | Ga0495606_0000040 | Ga0495606_0000040_6949_7548 | 191 |
| 160 | 3300046660 | Ga0495625_0400969 | Ga0495625_0400969_25_615 | 191 |
| 161 | 3300046674 | Ga0495588_0000387 | Ga0495588_0000387_22277_22867 | 191 |
| 162 | 3300047320 | Ga0495672_0089182 | Ga0495672_0089182_562_1161 | 191 |
| 163 | 3300047321 | Ga0495676_0235646 | Ga0495676_0235646_178_777 | 191 |
| 164 | 3300047673 | Ga0495593_0020972 | Ga0495593_0020972_1940_2539 | 191 |
| 165 | 3300048911 | Ga0496108_0000741 | Ga0496108_0000741_5695_6294 | 191 |
| 166 | 3300048912 | Ga0496109_0000088 | Ga0496109_0000088_75152_75751 | 191 |
| 167 | 3300048913 | Ga0496110_0000038 | Ga0496110_0000038_37983_38573 | 191 |
| 168 | 3300048914 | Ga0496111_0000192 | Ga0496111_0000192_25581_26171 | 191 |
| 169 | 3300048914 | Ga0496111_0022799 | Ga0496111_0022799_2090_2689 | 191 |
| 170 | 3300048916 | Ga0496113_0000013 | Ga0496113_0000013_71040_71639 | 191 |
| 171 | 3300048917 | Ga0496114_0126581 | Ga0496114_0126581_1352_1951 | 191 |
| 172 | 3300053077 | Ga0495601_0231097 | Ga0495601_0231097_174_764 | 191 |
| 173 | 3300053078 | Ga0495612_0012196 | Ga0495612_0012196_1577_2176 | 191 |
| 174 | 3300053078 | Ga0495612_0078841 | Ga0495612_0078841_463_1062 | 191 |
| 175 | 3300053085 | Ga0495619_0000047 | Ga0495619_0000047_72873_73463 | 191 |
| 176 | 3300005843 | Ga0068860_100489293 | Ga0068860_1004892932 | 193 |
| 177 | 3300009177 | Ga0105248_10688495 | Ga0105248_106884952 | 193 |
| 178 | 3300013104 | Ga0157370_10100710 | Ga0157370_101007102 | 193 |
| 179 | 3300014968 | Ga0157379_10295390 | Ga0157379_102953902 | 193 |
| 180 | 3300025931 | Ga0207644_10220576 | Ga0207644_102205762 | 193 |
| 181 | 3300025961 | Ga0207712_10795039 | Ga0207712_107950392 | 193 |
| 182 | 3300028381 | Ga0268264_10158286 | Ga0268264_101582862 | 193 |
| 183 | 3300048905 | Ga0496102_0024328 | Ga0496102_0024328_3129_3734 | 193 |
| 184 | 3300005437 | Ga0070710_10288297 | Ga0070710_102882972 | 194 |
| 185 | 3300009101 | Ga0105247_10000305 | Ga0105247_1000030529 | 194 |
| 186 | 3300013297 | Ga0157378_10101360 | Ga0157378_101013602 | 194 |
| 187 | 3300025900 | Ga0207710_10000157 | Ga0207710_1000015725 | 194 |
| 188 | 3300031456 | Ga0307513_10588999 | Ga0307513_105889992 | 194 |
| 189 | 3300048907 | Ga0496104_0000015 | Ga0496104_0000015_300985_301584 | 194 |
| 190 | 3300048908 | Ga0496105_0000004 | Ga0496105_0000004_174215_174814 | 194 |
| 191 | 3300048923 | Ga0496120_0098305 | Ga0496120_0098305_269_868 | 194 |
| 192 | 3300005340 | Ga0070689_100074086 | Ga0070689_1000740862 | 195 |
| 193 | 3300005365 | Ga0070688_100000137 | Ga0070688_1000001374 | 195 |
| 194 | 3300005365 | Ga0070688_100130307 | Ga0070688_1001303072 | 195 |
| 195 | 3300005367 | Ga0070667_100163342 | Ga0070667_1001633422 | 195 |
| 196 | 3300005436 | Ga0070713_100000010 | Ga0070713_10000001073 | 195 |
| 197 | 3300005438 | Ga0070701_10051203 | Ga0070701_100512032 | 195 |
| 198 | 3300005439 | Ga0070711_100381511 | Ga0070711_1003815111 | 195 |
| 199 | 3300005466 | Ga0070685_10000118 | Ga0070685_100001184 | 195 |
| 200 | 3300005615 | Ga0070702_100168539 | Ga0070702_1001685392 | 195 |
| 201 | 3300009177 | Ga0105248_10000020 | Ga0105248_1000002082 | 195 |
| 202 | 3300013105 | Ga0157369_10000074 | Ga0157369_1000007474 | 195 |
| 203 | 3300014326 | Ga0157380_10000411 | Ga0157380_1000041115 | 195 |
| 204 | 3300025916 | Ga0207663_10334674 | Ga0207663_103346741 | 195 |
| 205 | 3300025928 | Ga0207700_10000007 | Ga0207700_10000007274 | 195 |
| 206 | 3300025928 | Ga0207700_10343154 | Ga0207700_103431541 | 195 |
| 207 | 3300025932 | Ga0207690_10228031 | Ga0207690_102280312 | 195 |
| 208 | 3300025936 | Ga0207670_10061400 | Ga0207670_100614002 | 195 |
| 209 | 3300025941 | Ga0207711_10000006 | Ga0207711_10000006294 | 195 |
| 210 | 3300028379 | Ga0268266_10341346 | Ga0268266_103413462 | 195 |
| 211 | 3300041486 | Ga0451807_2641803 | Ga0451807_2641803_139_750 | 195 |
| 212 | 3300044694 | Ga0466963_0018534 | Ga0466963_0018534_1319_1951 | 195 |
| 213 | 3300044842 | Ga0466957_0003672 | Ga0466957_0003672_4075_4686 | 195 |
| 214 | 3300044842 | Ga0466957_0018509 | Ga0466957_0018509_663_1274 | 195 |
| 215 | 3300045976 | Ga0466967_0000001 | Ga0466967_0000001_72326_72937 | 195 |
| 216 | 3300046459 | Ga0495629_0022164 | Ga0495629_0022164_2096_2710 | 195 |
| 217 | 3300046460 | Ga0495638_0025744 | Ga0495638_0025744_2043_2645 | 195 |
| 218 | 3300046511 | Ga0495608_0000007 | Ga0495608_0000007_81954_82565 | 195 |
| 219 | 3300046517 | Ga0495630_0233982 | Ga0495630_0233982_337_951 | 195 |
| 220 | 3300046529 | Ga0495652_0000037 | Ga0495652_0000037_61220_61831 | 195 |
| 221 | 3300046675 | Ga0495657_0000001 | Ga0495657_0000001_214100_214711 | 195 |
| 222 | 3300046689 | Ga0495613_0000041 | Ga0495613_0000041_110038_110640 | 195 |
| 223 | 3300046809 | Ga0495600_0007461 | Ga0495600_0007461_3268_3870 | 195 |
| 224 | 3300047317 | Ga0495604_0000050 | Ga0495604_0000050_30643_31245 | 195 |
| 225 | 3300047317 | Ga0495604_0000718 | Ga0495604_0000718_3622_4224 | 195 |
| 226 | 3300047444 | Ga0495675_0000055 | Ga0495675_0000055_43608_44219 | 195 |
| 227 | 3300048088 | Ga0495602_0000007 | Ga0495602_0000007_193968_194570 | 195 |
| 228 | 3300049584 | Ga0501068_0150582 | Ga0501068_0150582_700_1311 | 195 |
| 229 | 3300053077 | Ga0495601_0000043 | Ga0495601_0000043_55220_55822 | 195 |
| 230 | 3300053077 | Ga0495601_0387766 | Ga0495601_0387766_162_773 | 195 |
| 231 | 3300053083 | Ga0495655_0001597 | Ga0495655_0001597_1853_2464 | 195 |
| 232 | 3300053084 | Ga0495595_0000002 | Ga0495595_0000002_230931_231542 | 195 |
| 233 | 3300053084 | Ga0495595_0004470 | Ga0495595_0004470_3892_4641 | 195 |
| 234 | 3300053085 | Ga0495619_0000095 | Ga0495619_0000095_48171_48782 | 195 |
| 235 | 3300053094 | Ga0500566_0025954 | Ga0500566_0025954_1834_2448 | 195 |
| 236 | 3300003320 | rootH2_10108101 | rootH2_101081013 | 196 |
| 237 | 3300009098 | Ga0105245_10058384 | Ga0105245_100583844 | 196 |
| 238 | 3300025927 | Ga0207687_10000036 | Ga0207687_1000003678 | 196 |
| 239 | 3300046516 | Ga0495628_0000815 | Ga0495628_0000815_13270_13875 | 196 |
| 240 | 3300046536 | Ga0495587_0070100 | Ga0495587_0070100_1087_1692 | 196 |
| 241 | 3300048088 | Ga0495602_0001626 | Ga0495602_0001626_14900_15505 | 196 |
| 242 | 3300048929 | Ga0496126_0004726 | Ga0496126_0004726_10580_11185 | 196 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5h7f-assembly1.cif.gz_A | crystal structure of mn-derivative drcpdase | 0.7723 | 10 | 190 |
| 6n9j-assembly1.cif.gz_A | x-ray structure of a secreted c11 cysteine protease from bacteroides thetaiotaomicron in complex with an irreversible peptide inhibitor | 0.747 | 166 | 190 |
| 5ldj-assembly3.cif.gz_C | crystal structure of e.coli ligt complexed with phosphate | 0.7367 | 9 | 190 |
| 5h7f-assembly1.cif.gz_A | crystal structure of mn-derivative drcpdase | 0.7351 | 10 | 190 |
| 5ldi-assembly4.cif.gz_D | crystal structure of e.coli ligt in apo form | 0.7343 | 9 | 190 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5h7fA00 | Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase | 0.7723 | 10 | 190 | 3.90.1140.10 |
| af_Q58963_1_173_3.90.1140.10 | Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase | 0.7469 | 13 | 188 | 3.90.1140.10 |
| af_Q58963_1_173_3.90.1140.10 | Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase | 0.7394 | 13 | 188 | 3.90.1140.10 |
| 5h7fA00 | Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase | 0.7351 | 10 | 190 | 3.90.1140.10 |
| 5ldmB00 | Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase | 0.7137 | 9 | 190 | 3.90.1140.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9AEI5-F1-model_v4 | RNA 2',3'-cyclic phosphodiesterase | 0.873 | 48 | 196 |
GO:0004113
GO:0008664 |
| AF-A0A1M3BJT0-F1-model_v4 | RNA 2',3'-cyclic phosphodiesterase (RNA 2',3'-CPDase) (EC 3.1.4.58) | 0.8706 | 1 | 190 |
GO:0004113
GO:0008664 GO:0016874 |
| AF-A0A537YP97-F1-model_v4 | RNA 2',3'-cyclic phosphodiesterase (RNA 2',3'-CPDase) (EC 3.1.4.58) | 0.8678 | 11 | 191 |
GO:0004113
GO:0008664 |
| AF-A0A1Q7X3U5-F1-model_v4 | RNA 2',3'-cyclic phosphodiesterase (RNA 2',3'-CPDase) (EC 3.1.4.58) | 0.8567 | 1 | 194 |
GO:0004113
GO:0008664 GO:0016874 |
| AF-A0A538A539-F1-model_v4 | RNA 2',3'-cyclic phosphodiesterase (RNA 2',3'-CPDase) (EC 3.1.4.58) | 0.8463 | 1 | 196 |
GO:0004113
GO:0008664 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar