F354398

General Info

Members Datasets Scaffolds Average Seq Length
242 168 242 197

Family's Representative Sequence

Representative Sequence 3300005365|Ga0070688_100000137|Ga0070688_1000001374
Length 210
Sequence VAAVAKERLKTSPKTPKARLFVALDLPEGTREGLVSWSQEALADPALRPVVAESLHITLAFLGYRPEEEIEAIAAAVRESAAPAPWVELRDPEQRPLRGRARLYALPAISPGAEALQAGLQERLVEAGFYEPEKRPFWPHVTVARVRPEARGSRRPAVVSEPPGAIPEELSEPRIAVRMALYRSELQPTGARYVPLAQVELPGGGGSEVI

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
87 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
88 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
89 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
90 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
91 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
92 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
93 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
94 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
95 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
96 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
97 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
98 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
99 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
100 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
101 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
102 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
103 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
104 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
105 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
106 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
107 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
108 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
109 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
110 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
111 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
112 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
113 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
114 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
115 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
116 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
117 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
118 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
119 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
120 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
121 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
122 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
123 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
124 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
125 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
126 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
127 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
128 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
129 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
130 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
131 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
132 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
133 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
148 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
149 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
150 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
151 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
152 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
153 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
154 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
155 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
159 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
160 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
161 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
162 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
163 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
164 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
165 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
166 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
167 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
168 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.24
Nodule 0
Rhizoplane 7.02
Rhizosphere 83.47
Stem 0
Stem Tuber 0
Unclassified 8.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10108101 3300003320 Bacteria 2014
2 Ga0070683_100003059 3300005329 Bacteria 13454
3 Ga0070683_100003234 3300005329 Bacteria 13157
4 Ga0070683_100047804 3300005329 Bacteria 3955
5 Ga0070680_100227810 3300005336 Bacteria 1574
6 Ga0070682_100000075 3300005337 Bacteria 90547
7 Ga0070689_100074086 3300005340 Bacteria 2664
8 Ga0070661_100489879 3300005344 Bacteria 983
9 Ga0070668_100064914 3300005347 Bacteria 2831
10 Ga0070675_100000106 3300005354 Bacteria 49336
11 Ga0070688_100000027 3300005365 Bacteria 67477
12 Ga0070688_100000137 3300005365 Bacteria 39585
13 Ga0070688_100130307 3300005365 Bacteria 1696
14 Ga0070667_100002442 3300005367 Bacteria 16243
15 Ga0070667_100163342 3300005367 Bacteria 1963
16 Ga0070713_100000010 3300005436 Bacteria 151790
17 Ga0070710_10288297 3300005437 Bacteria 1068
18 Ga0070701_10051203 3300005438 Bacteria 2142
19 Ga0070711_100381511 3300005439 Bacteria 1140
20 Ga0070663_100002752 3300005455 Bacteria 9970
21 Ga0070678_100006248 3300005456 Bacteria 6972
22 Ga0070685_10000118 3300005466 Bacteria 50597
23 Ga0070685_10002554 3300005466 Bacteria 9326
24 Ga0070679_100002077 3300005530 Bacteria 18024
25 Ga0070684_100015622 3300005535 Bacteria 6190
26 Ga0070684_100047409 3300005535 Bacteria 3724
27 Ga0070684_100230306 3300005535 Bacteria 1692
28 Ga0068853_100185623 3300005539 Bacteria 1888
29 Ga0070672_100000001 3300005543 Bacteria 204624
30 Ga0070665_100065857 3300005548 Bacteria 3634
31 Ga0070665_100387813 3300005548 Bacteria 1404
32 Ga0068857_100441139 3300005577 Bacteria 1216
33 Ga0068854_100000597 3300005578 Bacteria 21452
34 Ga0068856_100001059 3300005614 Bacteria 29152
35 Ga0068856_100027559 3300005614 Bacteria 5542
36 Ga0070702_100168539 3300005615 Bacteria 1422
37 Ga0068852_100061398 3300005616 Bacteria 3267
38 Ga0068851_10000302 3300005834 Bacteria 22566
39 Ga0068851_10029808 3300005834 Bacteria 2703
40 Ga0068860_100489293 3300005843 Unclassified 1227
41 Ga0081455_10034650 3300005937 Bacteria 4521
42 Ga0081540_1000041 3300005983 Bacteria 136874
43 Ga0081539_10000878 3300005985 Bacteria 57633
44 Ga0070715_10047040 3300006163 Bacteria 1837
45 Ga0070712_100156219 3300006175 Bacteria 1757
46 Ga0068865_100000069 3300006881 Bacteria 53927
47 Ga0105245_10018765 3300009098 Bacteria 6051
48 Ga0105245_10058384 3300009098 Bacteria 3473
49 Ga0105247_10000305 3300009101 Bacteria 44071
50 Ga0105243_10010691 3300009148 Bacteria 6957
51 Ga0105241_10215062 3300009174 Bacteria 1612
52 Ga0105248_10000020 3300009177 Bacteria 284637
53 Ga0105248_10688495 3300009177 Unclassified 1153
54 Ga0105237_10709452 3300009545 Bacteria 1012
55 Ga0105238_10407758 3300009551 Bacteria 1353
56 Ga0105239_10066082 3300010375 Bacteria 3973
57 Ga0157371_10007489 3300013102 Bacteria 8833
58 Ga0157370_10033370 3300013104 Bacteria 5019
59 Ga0157370_10100710 3300013104 Bacteria 2707
60 Ga0157369_10000074 3300013105 Bacteria 136668
61 Ga0157378_10005076 3300013297 Bacteria 11564
62 Ga0157378_10037100 3300013297 Bacteria 4316
63 Ga0157378_10101360 3300013297 Bacteria 2629
64 Ga0163162_10226863 3300013306 Bacteria 1998
65 Ga0163162_10702319 3300013306 Bacteria 1133
66 Ga0157372_10000204 3300013307 Bacteria 65798
67 Ga0157380_10000411 3300014326 Bacteria 26029
68 Ga0157379_10295390 3300014968 Unclassified 1476
69 Ga0157376_10021098 3300014969 Bacteria 5055
70 Ga0207656_10000183 3300025321 Bacteria 22582
71 Ga0207656_10017807 3300025321 Bacteria 2788
72 Ga0207710_10000157 3300025900 Bacteria 72764
73 Ga0207680_10011208 3300025903 Bacteria 4520
74 Ga0207680_10066438 3300025903 Bacteria 2218
75 Ga0207680_10163900 3300025903 Bacteria 1493
76 Ga0207685_10192671 3300025905 Bacteria 952
77 Ga0207654_10264137 3300025911 Bacteria 1158
78 Ga0207671_10280510 3300025914 Bacteria 1314
79 Ga0207693_10148182 3300025915 Bacteria 1845
80 Ga0207663_10334674 3300025916 Bacteria 1142
81 Ga0207660_10618229 3300025917 Bacteria 883
82 Ga0207652_10008375 3300025921 Bacteria 8318
83 Ga0207659_10000013 3300025926 Bacteria 172742
84 Ga0207687_10000036 3300025927 Bacteria 121934
85 Ga0207687_10005321 3300025927 Bacteria 8522
86 Ga0207700_10000007 3300025928 Bacteria 345720
87 Ga0207700_10343154 3300025928 Bacteria 1299
88 Ga0207664_10086218 3300025929 Bacteria 2565
89 Ga0207644_10220576 3300025931 Unclassified 1503
90 Ga0207690_10228031 3300025932 Bacteria 1429
91 Ga0207709_10017922 3300025935 Bacteria 3960
92 Ga0207670_10061400 3300025936 Bacteria 2565
93 Ga0207704_10000049 3300025938 Bacteria 83173
94 Ga0207691_10000747 3300025940 Bacteria 32117
95 Ga0207711_10000006 3300025941 Bacteria 792692
96 Ga0207661_10000921 3300025944 Bacteria 19315
97 Ga0207661_10001320 3300025944 Bacteria 16601
98 Ga0207661_10060708 3300025944 Bacteria 3052
99 Ga0207712_10795039 3300025961 Bacteria 831
100 Ga0207668_10036411 3300025972 Bacteria 3284
101 Ga0207668_10367707 3300025972 Bacteria 1207
102 Ga0207640_10000274 3300025981 Bacteria 34698
103 Ga0207658_10003077 3300025986 Bacteria 11924
104 Ga0207639_10204062 3300026041 Bacteria 1697
105 Ga0207678_10003882 3300026067 Bacteria 13444
106 Ga0207702_10000789 3300026078 Bacteria 33612
107 Ga0207683_10012718 3300026121 Bacteria 7181
108 Ga0207698_10068532 3300026142 Bacteria 2802
109 Ga0268266_10000674 3300028379 Bacteria 46135
110 Ga0268266_10003217 3300028379 Bacteria 16504
111 Ga0268266_10045888 3300028379 Bacteria 3740
112 Ga0268266_10341346 3300028379 Bacteria 1406
113 Ga0268264_10158286 3300028381 Bacteria 2038
114 Ga0307513_10588999 3300031456 Unclassified 822
115 Ga0451807_2641803 3300041486 Bacteria 1339
116 Ga0466963_0018534 3300044694 Bacteria 4354
117 Ga0466963_0024864 3300044694 Bacteria 3814
118 Ga0466957_0003672 3300044842 Bacteria 8471
119 Ga0466957_0018509 3300044842 Bacteria 4092
120 Ga0466967_0000001 3300045976 Bacteria 229823
121 Ga0495629_0022164 3300046459 Bacteria 4530
122 Ga0495629_0042947 3300046459 Bacteria 3175
123 Ga0495638_0025744 3300046460 Bacteria 3820
124 Ga0495606_0000040 3300046507 Bacteria 223500
125 Ga0495608_0000007 3300046511 Bacteria 313495
126 Ga0495608_0221570 3300046511 Bacteria 1187
127 Ga0495628_0000815 3300046516 Bacteria 28812
128 Ga0495630_0233982 3300046517 Bacteria 1404
129 Ga0495652_0000037 3300046529 Bacteria 133232
130 Ga0495640_0062799 3300046533 Bacteria 2518
131 Ga0495587_0025706 3300046536 Bacteria 3596
132 Ga0495587_0070100 3300046536 Bacteria 2041
133 Ga0495597_0178389 3300046542 Bacteria 859
134 Ga0495634_0000293 3300046642 Bacteria 47827
135 Ga0495625_0400969 3300046660 Unclassified 857
136 Ga0495588_0000387 3300046674 Bacteria 25193
137 Ga0495657_0000001 3300046675 Bacteria 445641
138 Ga0495613_0000041 3300046689 Bacteria 130784
139 Ga0495600_0007461 3300046809 Bacteria 6693
140 Ga0495604_0000050 3300047317 Bacteria 108094
141 Ga0495604_0000718 3300047317 Bacteria 28069
142 Ga0495674_0000030 3300047319 Bacteria 115975
143 Ga0495672_0089182 3300047320 Bacteria 1698
144 Ga0495676_0235646 3300047321 Bacteria 1255
145 Ga0495675_0000055 3300047444 Bacteria 77878
146 Ga0495684_0192998 3300047471 Bacteria 1505
147 Ga0495593_0020972 3300047673 Bacteria 3653
148 Ga0495602_0000007 3300048088 Bacteria 273212
149 Ga0495602_0001626 3300048088 Bacteria 22343
150 Ga0496102_0012083 3300048905 Bacteria 7461
151 Ga0496102_0024328 3300048905 Bacteria 5384
152 Ga0496104_0000015 3300048907 Bacteria 374530
153 Ga0496104_0109677 3300048907 Bacteria 2645
154 Ga0496105_0000004 3300048908 Bacteria 475798
155 Ga0496105_0011568 3300048908 Bacteria 6978
156 Ga0496108_0000741 3300048911 Bacteria 25376
157 Ga0496109_0000088 3300048912 Bacteria 94877
158 Ga0496109_0000261 3300048912 Bacteria 50812
159 Ga0496110_0000038 3300048913 Bacteria 64272
160 Ga0496111_0000192 3300048914 Bacteria 28263
161 Ga0496111_0022799 3300048914 Bacteria 4387
162 Ga0496113_0000013 3300048916 Bacteria 81224
163 Ga0496114_0126581 3300048917 Bacteria 2203
164 Ga0496114_0412463 3300048917 Bacteria 1196
165 Ga0496115_0000659 3300048918 Bacteria 25718
166 Ga0496117_0010297 3300048920 Bacteria 8550
167 Ga0496117_0187536 3300048920 Bacteria 1182
168 Ga0496118_0027567 3300048921 Bacteria 4803
169 Ga0496118_0323699 3300048921 Bacteria 835
170 Ga0496118_0384220 3300048921 Bacteria 735
171 Ga0496119_0002793 3300048922 Bacteria 18720
172 Ga0496119_0006931 3300048922 Bacteria 10337
173 Ga0496119_0027523 3300048922 Bacteria 3905
174 Ga0496120_0004688 3300048923 Bacteria 11285
175 Ga0496120_0098305 3300048923 Bacteria 1552
176 Ga0496121_0020522 3300048924 Bacteria 6532
177 Ga0496121_0022107 3300048924 Bacteria 6189
178 Ga0496121_0157027 3300048924 Bacteria 1668
179 Ga0496121_0182415 3300048924 Bacteria 1513
180 Ga0496124_0041287 3300048927 Bacteria 3982
181 Ga0496125_0025091 3300048928 Bacteria 5468
182 Ga0496125_0068251 3300048928 Bacteria 2798
183 Ga0496126_0004726 3300048929 Bacteria 16073
184 Ga0501031_0000322 3300049568 Bacteria 27494
185 Ga0501032_0000826 3300049569 Bacteria 25207
186 Ga0501033_0001043 3300049570 Bacteria 25258
187 Ga0501034_0007054 3300049571 Bacteria 11985
188 Ga0501036_0001543 3300049572 Bacteria 17799
189 Ga0501037_0000695 3300049573 Bacteria 25643
190 Ga0501038_0000822 3300049574 Bacteria 27621
191 Ga0501038_0506787 3300049574 Bacteria 922
192 Ga0501039_0029779 3300049575 Bacteria 4206
193 Ga0501040_0015632 3300049576 Bacteria 5017
194 Ga0501042_0066774 3300049578 Bacteria 2571
195 Ga0501043_0001320 3300049579 Bacteria 21690
196 Ga0501043_0182239 3300049579 Bacteria 1636
197 Ga0501046_0001474 3300049580 Bacteria 22598
198 Ga0501047_0000430 3300049581 Bacteria 46649
199 Ga0501047_0067306 3300049581 Bacteria 3452
200 Ga0501047_0077283 3300049581 Bacteria 3203
201 Ga0501048_0001198 3300049582 Bacteria 19630
202 Ga0501068_0036223 3300049584 Bacteria 2949
203 Ga0501068_0150582 3300049584 Bacteria 1462
204 Ga0501069_0006674 3300049585 Bacteria 6040
205 Ga0501069_0052328 3300049585 Bacteria 2273
206 Ga0501070_0001324 3300049586 Bacteria 22140
207 Ga0501070_0169845 3300049586 Bacteria 1796
208 Ga0501070_0205746 3300049586 Bacteria 1616
209 Ga0501071_0115463 3300049587 Bacteria 1986
210 Ga0501071_0357846 3300049587 Bacteria 1111
211 Ga0501073_0003541 3300049589 Bacteria 11724
212 Ga0501074_0040819 3300049590 Bacteria 3359
213 Ga0501074_0140274 3300049590 Bacteria 1729
214 Ga0501079_0027642 3300049741 Bacteria 4351
215 Ga0501079_0043611 3300049741 Bacteria 3462
216 Ga0501080_0022456 3300049742 Bacteria 5845
217 Ga0501080_0566190 3300049742 Bacteria 1011
218 Ga0501083_0005247 3300049744 Bacteria 9163
219 Ga0501083_0011019 3300049744 Bacteria 6353
220 Ga0501083_0030738 3300049744 Bacteria 3687
221 Ga0501083_0170940 3300049744 Unclassified 1420
222 Ga0501035_0005572 3300049822 Bacteria 11896
223 Ga0501044_0001702 3300049823 Bacteria 25807
224 Ga0501044_0079955 3300049823 Bacteria 3311
225 Ga0501044_0174064 3300049823 Bacteria 2122
226 Ga0501044_0316567 3300049823 Unclassified 1486
227 Ga0501045_0019552 3300049824 Bacteria 4830
228 Ga0495601_0000043 3300053077 Bacteria 77025
229 Ga0495601_0231097 3300053077 Bacteria 1208
230 Ga0495601_0387766 3300053077 Bacteria 906
231 Ga0495612_0012196 3300053078 Bacteria 3465
232 Ga0495612_0078841 3300053078 Bacteria 1382
233 Ga0495655_0001597 3300053083 Bacteria 3491
234 Ga0495595_0000002 3300053084 Bacteria 445641
235 Ga0495595_0004470 3300053084 Bacteria 5630
236 Ga0495619_0000047 3300053085 Bacteria 102152
237 Ga0495619_0000095 3300053085 Bacteria 66204
238 Ga0500566_0025954 3300053094 Bacteria 3430
239 Ga0500595_016852 3300053119 Bacteria 2713
240 Ga0500568_0051036 3300053139 Bacteria 1629
241 Ga0501084_0060740 3300054114 Bacteria 3164
242 Ga0501082_0001614 3300060353 Bacteria 19859

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048908 Ga0496105_0011568 Ga0496105_0011568_3496_4107 166
2 3300005336 Ga0070680_100227810 Ga0070680_1002278102 176
3 3300005985 Ga0081539_10000878 Ga0081539_1000087854 179
4 3300046533 Ga0495640_0062799 Ga0495640_0062799_14_568 179
5 3300013306 Ga0163162_10702319 Ga0163162_107023191 181
6 3300048917 Ga0496114_0412463 Ga0496114_0412463_604_1167 182
7 3300048918 Ga0496115_0000659 Ga0496115_0000659_3557_4120 182
8 3300014969 Ga0157376_10021098 Ga0157376_100210984 183
9 3300046536 Ga0495587_0025706 Ga0495587_0025706_2897_3463 183
10 3300048920 Ga0496117_0187536 Ga0496117_0187536_435_1001 183
11 3300048921 Ga0496118_0323699 Ga0496118_0323699_19_585 183
12 3300048922 Ga0496119_0027523 Ga0496119_0027523_2003_2569 183
13 3300048923 Ga0496120_0004688 Ga0496120_0004688_10569_11135 183
14 3300048924 Ga0496121_0020522 Ga0496121_0020522_4842_5408 183
15 3300048924 Ga0496121_0157027 Ga0496121_0157027_699_1265 183
16 3300048924 Ga0496121_0182415 Ga0496121_0182415_219_785 183
17 3300048928 Ga0496125_0068251 Ga0496125_0068251_425_991 183
18 3300053139 Ga0500568_0051036 Ga0500568_0051036_874_1440 183
19 3300046542 Ga0495597_0178389 Ga0495597_0178389_18_587 184
20 3300049823 Ga0501044_0079955 Ga0501044_0079955_2222_2791 184
21 3300049574 Ga0501038_0506787 Ga0501038_0506787_51_662 187
22 3300005577 Ga0068857_100441139 Ga0068857_1004411392 189
23 3300005983 Ga0081540_1000041 Ga0081540_100004126 189
24 3300005329 Ga0070683_100003059 Ga0070683_1000030596 190
25 3300005329 Ga0070683_100047804 Ga0070683_1000478044 190
26 3300005344 Ga0070661_100489879 Ga0070661_1004898791 190
27 3300005367 Ga0070667_100002442 Ga0070667_10000244214 190
28 3300005455 Ga0070663_100002752 Ga0070663_1000027523 190
29 3300005530 Ga0070679_100002077 Ga0070679_10000207717 190
30 3300005535 Ga0070684_100015622 Ga0070684_1000156222 190
31 3300005535 Ga0070684_100230306 Ga0070684_1002303062 190
32 3300005548 Ga0070665_100387813 Ga0070665_1003878132 190
33 3300005614 Ga0068856_100027559 Ga0068856_1000275594 190
34 3300005937 Ga0081455_10034650 Ga0081455_100346503 190
35 3300006175 Ga0070712_100156219 Ga0070712_1001562192 190
36 3300009545 Ga0105237_10709452 Ga0105237_107094521 190
37 3300009551 Ga0105238_10407758 Ga0105238_104077582 190
38 3300013306 Ga0163162_10226863 Ga0163162_102268632 190
39 3300025903 Ga0207680_10066438 Ga0207680_100664382 190
40 3300025903 Ga0207680_10163900 Ga0207680_101639002 190
41 3300025914 Ga0207671_10280510 Ga0207671_102805102 190
42 3300025915 Ga0207693_10148182 Ga0207693_101481822 190
43 3300025917 Ga0207660_10618229 Ga0207660_106182291 190
44 3300025921 Ga0207652_10008375 Ga0207652_100083755 190
45 3300025944 Ga0207661_10001320 Ga0207661_100013209 190
46 3300025944 Ga0207661_10060708 Ga0207661_100607082 190
47 3300025972 Ga0207668_10367707 Ga0207668_103677072 190
48 3300025986 Ga0207658_10003077 Ga0207658_100030773 190
49 3300026067 Ga0207678_10003882 Ga0207678_100038825 190
50 3300028379 Ga0268266_10000674 Ga0268266_100006746 190
51 3300044694 Ga0466963_0024864 Ga0466963_0024864_743_1339 190
52 3300046511 Ga0495608_0221570 Ga0495608_0221570_581_1168 190
53 3300046642 Ga0495634_0000293 Ga0495634_0000293_34286_34873 190
54 3300047319 Ga0495674_0000030 Ga0495674_0000030_52166_52762 190
55 3300047471 Ga0495684_0192998 Ga0495684_0192998_308_895 190
56 3300048905 Ga0496102_0012083 Ga0496102_0012083_451_1038 190
57 3300048907 Ga0496104_0109677 Ga0496104_0109677_60_647 190
58 3300048912 Ga0496109_0000261 Ga0496109_0000261_32292_32888 190
59 3300048920 Ga0496117_0010297 Ga0496117_0010297_5828_6415 190
60 3300048921 Ga0496118_0027567 Ga0496118_0027567_4160_4747 190
61 3300048921 Ga0496118_0384220 Ga0496118_0384220_138_725 190
62 3300048922 Ga0496119_0002793 Ga0496119_0002793_6527_7114 190
63 3300048922 Ga0496119_0006931 Ga0496119_0006931_3728_4315 190
64 3300048924 Ga0496121_0022107 Ga0496121_0022107_347_934 190
65 3300048927 Ga0496124_0041287 Ga0496124_0041287_1048_1635 190
66 3300048928 Ga0496125_0025091 Ga0496125_0025091_475_1062 190
67 3300049568 Ga0501031_0000322 Ga0501031_0000322_13429_14016 190
68 3300049569 Ga0501032_0000826 Ga0501032_0000826_8626_9213 190
69 3300049570 Ga0501033_0001043 Ga0501033_0001043_15975_16562 190
70 3300049571 Ga0501034_0007054 Ga0501034_0007054_1193_1780 190
71 3300049572 Ga0501036_0001543 Ga0501036_0001543_1011_1598 190
72 3300049573 Ga0501037_0000695 Ga0501037_0000695_15968_16555 190
73 3300049574 Ga0501038_0000822 Ga0501038_0000822_13425_14012 190
74 3300049575 Ga0501039_0029779 Ga0501039_0029779_3246_3833 190
75 3300049576 Ga0501040_0015632 Ga0501040_0015632_2025_2612 190
76 3300049578 Ga0501042_0066774 Ga0501042_0066774_545_1132 190
77 3300049579 Ga0501043_0001320 Ga0501043_0001320_7669_8256 190
78 3300049579 Ga0501043_0182239 Ga0501043_0182239_1034_1621 190
79 3300049580 Ga0501046_0001474 Ga0501046_0001474_13386_13973 190
80 3300049581 Ga0501047_0000430 Ga0501047_0000430_29835_30422 190
81 3300049581 Ga0501047_0067306 Ga0501047_0067306_1883_2470 190
82 3300049581 Ga0501047_0077283 Ga0501047_0077283_1263_1850 190
83 3300049582 Ga0501048_0001198 Ga0501048_0001198_13619_14206 190
84 3300049584 Ga0501068_0036223 Ga0501068_0036223_1256_1843 190
85 3300049585 Ga0501069_0006674 Ga0501069_0006674_1935_2522 190
86 3300049585 Ga0501069_0052328 Ga0501069_0052328_1633_2220 190
87 3300049586 Ga0501070_0001324 Ga0501070_0001324_8115_8702 190
88 3300049586 Ga0501070_0169845 Ga0501070_0169845_332_919 190
89 3300049586 Ga0501070_0205746 Ga0501070_0205746_318_905 190
90 3300049587 Ga0501071_0115463 Ga0501071_0115463_808_1395 190
91 3300049587 Ga0501071_0357846 Ga0501071_0357846_285_872 190
92 3300049589 Ga0501073_0003541 Ga0501073_0003541_7843_8430 190
93 3300049590 Ga0501074_0040819 Ga0501074_0040819_1228_1815 190
94 3300049590 Ga0501074_0140274 Ga0501074_0140274_703_1290 190
95 3300049741 Ga0501079_0027642 Ga0501079_0027642_253_840 190
96 3300049741 Ga0501079_0043611 Ga0501079_0043611_2415_3002 190
97 3300049742 Ga0501080_0022456 Ga0501080_0022456_1567_2154 190
98 3300049742 Ga0501080_0566190 Ga0501080_0566190_213_806 190
99 3300049744 Ga0501083_0005247 Ga0501083_0005247_6239_6826 190
100 3300049744 Ga0501083_0011019 Ga0501083_0011019_2320_2907 190
101 3300049744 Ga0501083_0030738 Ga0501083_0030738_1337_1924 190
102 3300049744 Ga0501083_0170940 Ga0501083_0170940_762_1349 190
103 3300049822 Ga0501035_0005572 Ga0501035_0005572_7564_8151 190
104 3300049823 Ga0501044_0001702 Ga0501044_0001702_16453_17040 190
105 3300049823 Ga0501044_0174064 Ga0501044_0174064_1151_1738 190
106 3300049823 Ga0501044_0316567 Ga0501044_0316567_822_1409 190
107 3300049824 Ga0501045_0019552 Ga0501045_0019552_3901_4488 190
108 3300053119 Ga0500595_016852 Ga0500595_016852_2094_2681 190
109 3300054114 Ga0501084_0060740 Ga0501084_0060740_2198_2785 190
110 3300060353 Ga0501082_0001614 Ga0501082_0001614_5902_6489 190
111 3300005329 Ga0070683_100003234 Ga0070683_1000032346 191
112 3300005337 Ga0070682_100000075 Ga0070682_10000007549 191
113 3300005347 Ga0070668_100064914 Ga0070668_1000649142 191
114 3300005354 Ga0070675_100000106 Ga0070675_10000010632 191
115 3300005365 Ga0070688_100000027 Ga0070688_1000000275 191
116 3300005456 Ga0070678_100006248 Ga0070678_1000062485 191
117 3300005466 Ga0070685_10002554 Ga0070685_100025545 191
118 3300005535 Ga0070684_100047409 Ga0070684_1000474092 191
119 3300005539 Ga0068853_100185623 Ga0068853_1001856231 191
120 3300005543 Ga0070672_100000001 Ga0070672_10000000154 191
121 3300005548 Ga0070665_100065857 Ga0070665_1000658572 191
122 3300005578 Ga0068854_100000597 Ga0068854_1000005977 191
123 3300005614 Ga0068856_100001059 Ga0068856_10000105911 191
124 3300005616 Ga0068852_100061398 Ga0068852_1000613982 191
125 3300005834 Ga0068851_10000302 Ga0068851_1000030210 191
126 3300005834 Ga0068851_10029808 Ga0068851_100298082 191
127 3300006163 Ga0070715_10047040 Ga0070715_100470402 191
128 3300006881 Ga0068865_100000069 Ga0068865_1000000692 191
129 3300009098 Ga0105245_10018765 Ga0105245_100187654 191
130 3300009148 Ga0105243_10010691 Ga0105243_100106914 191
131 3300009174 Ga0105241_10215062 Ga0105241_102150622 191
132 3300010375 Ga0105239_10066082 Ga0105239_100660824 191
133 3300013102 Ga0157371_10007489 Ga0157371_100074891 191
134 3300013104 Ga0157370_10033370 Ga0157370_100333702 191
135 3300013297 Ga0157378_10005076 Ga0157378_100050768 191
136 3300013297 Ga0157378_10037100 Ga0157378_100371004 191
137 3300013307 Ga0157372_10000204 Ga0157372_1000020453 191
138 3300025321 Ga0207656_10000183 Ga0207656_1000018312 191
139 3300025321 Ga0207656_10017807 Ga0207656_100178072 191
140 3300025903 Ga0207680_10011208 Ga0207680_100112084 191
141 3300025905 Ga0207685_10192671 Ga0207685_101926711 191
142 3300025911 Ga0207654_10264137 Ga0207654_102641372 191
143 3300025926 Ga0207659_10000013 Ga0207659_1000001347 191
144 3300025927 Ga0207687_10005321 Ga0207687_100053216 191
145 3300025929 Ga0207664_10086218 Ga0207664_100862182 191
146 3300025935 Ga0207709_10017922 Ga0207709_100179222 191
147 3300025938 Ga0207704_10000049 Ga0207704_1000004912 191
148 3300025940 Ga0207691_10000747 Ga0207691_1000074711 191
149 3300025944 Ga0207661_10000921 Ga0207661_100009217 191
150 3300025972 Ga0207668_10036411 Ga0207668_100364112 191
151 3300025981 Ga0207640_10000274 Ga0207640_1000027420 191
152 3300026041 Ga0207639_10204062 Ga0207639_102040621 191
153 3300026078 Ga0207702_10000789 Ga0207702_1000078916 191
154 3300026121 Ga0207683_10012718 Ga0207683_100127185 191
155 3300026142 Ga0207698_10068532 Ga0207698_100685322 191
156 3300028379 Ga0268266_10003217 Ga0268266_1000321711 191
157 3300028379 Ga0268266_10045888 Ga0268266_100458882 191
158 3300046459 Ga0495629_0042947 Ga0495629_0042947_681_1280 191
159 3300046507 Ga0495606_0000040 Ga0495606_0000040_6949_7548 191
160 3300046660 Ga0495625_0400969 Ga0495625_0400969_25_615 191
161 3300046674 Ga0495588_0000387 Ga0495588_0000387_22277_22867 191
162 3300047320 Ga0495672_0089182 Ga0495672_0089182_562_1161 191
163 3300047321 Ga0495676_0235646 Ga0495676_0235646_178_777 191
164 3300047673 Ga0495593_0020972 Ga0495593_0020972_1940_2539 191
165 3300048911 Ga0496108_0000741 Ga0496108_0000741_5695_6294 191
166 3300048912 Ga0496109_0000088 Ga0496109_0000088_75152_75751 191
167 3300048913 Ga0496110_0000038 Ga0496110_0000038_37983_38573 191
168 3300048914 Ga0496111_0000192 Ga0496111_0000192_25581_26171 191
169 3300048914 Ga0496111_0022799 Ga0496111_0022799_2090_2689 191
170 3300048916 Ga0496113_0000013 Ga0496113_0000013_71040_71639 191
171 3300048917 Ga0496114_0126581 Ga0496114_0126581_1352_1951 191
172 3300053077 Ga0495601_0231097 Ga0495601_0231097_174_764 191
173 3300053078 Ga0495612_0012196 Ga0495612_0012196_1577_2176 191
174 3300053078 Ga0495612_0078841 Ga0495612_0078841_463_1062 191
175 3300053085 Ga0495619_0000047 Ga0495619_0000047_72873_73463 191
176 3300005843 Ga0068860_100489293 Ga0068860_1004892932 193
177 3300009177 Ga0105248_10688495 Ga0105248_106884952 193
178 3300013104 Ga0157370_10100710 Ga0157370_101007102 193
179 3300014968 Ga0157379_10295390 Ga0157379_102953902 193
180 3300025931 Ga0207644_10220576 Ga0207644_102205762 193
181 3300025961 Ga0207712_10795039 Ga0207712_107950392 193
182 3300028381 Ga0268264_10158286 Ga0268264_101582862 193
183 3300048905 Ga0496102_0024328 Ga0496102_0024328_3129_3734 193
184 3300005437 Ga0070710_10288297 Ga0070710_102882972 194
185 3300009101 Ga0105247_10000305 Ga0105247_1000030529 194
186 3300013297 Ga0157378_10101360 Ga0157378_101013602 194
187 3300025900 Ga0207710_10000157 Ga0207710_1000015725 194
188 3300031456 Ga0307513_10588999 Ga0307513_105889992 194
189 3300048907 Ga0496104_0000015 Ga0496104_0000015_300985_301584 194
190 3300048908 Ga0496105_0000004 Ga0496105_0000004_174215_174814 194
191 3300048923 Ga0496120_0098305 Ga0496120_0098305_269_868 194
192 3300005340 Ga0070689_100074086 Ga0070689_1000740862 195
193 3300005365 Ga0070688_100000137 Ga0070688_1000001374 195
194 3300005365 Ga0070688_100130307 Ga0070688_1001303072 195
195 3300005367 Ga0070667_100163342 Ga0070667_1001633422 195
196 3300005436 Ga0070713_100000010 Ga0070713_10000001073 195
197 3300005438 Ga0070701_10051203 Ga0070701_100512032 195
198 3300005439 Ga0070711_100381511 Ga0070711_1003815111 195
199 3300005466 Ga0070685_10000118 Ga0070685_100001184 195
200 3300005615 Ga0070702_100168539 Ga0070702_1001685392 195
201 3300009177 Ga0105248_10000020 Ga0105248_1000002082 195
202 3300013105 Ga0157369_10000074 Ga0157369_1000007474 195
203 3300014326 Ga0157380_10000411 Ga0157380_1000041115 195
204 3300025916 Ga0207663_10334674 Ga0207663_103346741 195
205 3300025928 Ga0207700_10000007 Ga0207700_10000007274 195
206 3300025928 Ga0207700_10343154 Ga0207700_103431541 195
207 3300025932 Ga0207690_10228031 Ga0207690_102280312 195
208 3300025936 Ga0207670_10061400 Ga0207670_100614002 195
209 3300025941 Ga0207711_10000006 Ga0207711_10000006294 195
210 3300028379 Ga0268266_10341346 Ga0268266_103413462 195
211 3300041486 Ga0451807_2641803 Ga0451807_2641803_139_750 195
212 3300044694 Ga0466963_0018534 Ga0466963_0018534_1319_1951 195
213 3300044842 Ga0466957_0003672 Ga0466957_0003672_4075_4686 195
214 3300044842 Ga0466957_0018509 Ga0466957_0018509_663_1274 195
215 3300045976 Ga0466967_0000001 Ga0466967_0000001_72326_72937 195
216 3300046459 Ga0495629_0022164 Ga0495629_0022164_2096_2710 195
217 3300046460 Ga0495638_0025744 Ga0495638_0025744_2043_2645 195
218 3300046511 Ga0495608_0000007 Ga0495608_0000007_81954_82565 195
219 3300046517 Ga0495630_0233982 Ga0495630_0233982_337_951 195
220 3300046529 Ga0495652_0000037 Ga0495652_0000037_61220_61831 195
221 3300046675 Ga0495657_0000001 Ga0495657_0000001_214100_214711 195
222 3300046689 Ga0495613_0000041 Ga0495613_0000041_110038_110640 195
223 3300046809 Ga0495600_0007461 Ga0495600_0007461_3268_3870 195
224 3300047317 Ga0495604_0000050 Ga0495604_0000050_30643_31245 195
225 3300047317 Ga0495604_0000718 Ga0495604_0000718_3622_4224 195
226 3300047444 Ga0495675_0000055 Ga0495675_0000055_43608_44219 195
227 3300048088 Ga0495602_0000007 Ga0495602_0000007_193968_194570 195
228 3300049584 Ga0501068_0150582 Ga0501068_0150582_700_1311 195
229 3300053077 Ga0495601_0000043 Ga0495601_0000043_55220_55822 195
230 3300053077 Ga0495601_0387766 Ga0495601_0387766_162_773 195
231 3300053083 Ga0495655_0001597 Ga0495655_0001597_1853_2464 195
232 3300053084 Ga0495595_0000002 Ga0495595_0000002_230931_231542 195
233 3300053084 Ga0495595_0004470 Ga0495595_0004470_3892_4641 195
234 3300053085 Ga0495619_0000095 Ga0495619_0000095_48171_48782 195
235 3300053094 Ga0500566_0025954 Ga0500566_0025954_1834_2448 195
236 3300003320 rootH2_10108101 rootH2_101081013 196
237 3300009098 Ga0105245_10058384 Ga0105245_100583844 196
238 3300025927 Ga0207687_10000036 Ga0207687_1000003678 196
239 3300046516 Ga0495628_0000815 Ga0495628_0000815_13270_13875 196
240 3300046536 Ga0495587_0070100 Ga0495587_0070100_1087_1692 196
241 3300048088 Ga0495602_0001626 Ga0495602_0001626_14900_15505 196
242 3300048929 Ga0496126_0004726 Ga0496126_0004726_10580_11185 196

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02834

LigT_PEase

LigT like Phosphoesterase

24

90

0.88

PF13563

2_5_RNA_ligase2

2'-5' RNA ligase superfamily

30

172

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5h7f-assembly1.cif.gz_A crystal structure of mn-derivative drcpdase 0.7723 10 190
6n9j-assembly1.cif.gz_A x-ray structure of a secreted c11 cysteine protease from bacteroides thetaiotaomicron in complex with an irreversible peptide inhibitor 0.747 166 190
5ldj-assembly3.cif.gz_C crystal structure of e.coli ligt complexed with phosphate 0.7367 9 190
5h7f-assembly1.cif.gz_A crystal structure of mn-derivative drcpdase 0.7351 10 190
5ldi-assembly4.cif.gz_D crystal structure of e.coli ligt in apo form 0.7343 9 190
ID Description Score Start End Superfamily
5h7fA00 Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase 0.7723 10 190 3.90.1140.10
af_Q58963_1_173_3.90.1140.10 Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase 0.7469 13 188 3.90.1140.10
af_Q58963_1_173_3.90.1140.10 Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase 0.7394 13 188 3.90.1140.10
5h7fA00 Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase 0.7351 10 190 3.90.1140.10
5ldmB00 Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase 0.7137 9 190 3.90.1140.10
ID Description Score Start End GO Terms
AF-A0A7V9AEI5-F1-model_v4 RNA 2',3'-cyclic phosphodiesterase 0.873 48 196 GO:0004113
GO:0008664
AF-A0A1M3BJT0-F1-model_v4 RNA 2',3'-cyclic phosphodiesterase (RNA 2',3'-CPDase) (EC 3.1.4.58) 0.8706 1 190 GO:0004113
GO:0008664
GO:0016874
AF-A0A537YP97-F1-model_v4 RNA 2',3'-cyclic phosphodiesterase (RNA 2',3'-CPDase) (EC 3.1.4.58) 0.8678 11 191 GO:0004113
GO:0008664
AF-A0A1Q7X3U5-F1-model_v4 RNA 2',3'-cyclic phosphodiesterase (RNA 2',3'-CPDase) (EC 3.1.4.58) 0.8567 1 194 GO:0004113
GO:0008664
GO:0016874
AF-A0A538A539-F1-model_v4 RNA 2',3'-cyclic phosphodiesterase (RNA 2',3'-CPDase) (EC 3.1.4.58) 0.8463 1 196 GO:0004113
GO:0008664

Feature Viewer

pLDDT pTM Quality
82.55 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map