F354051

General Info

Members Datasets Scaffolds Average Seq Length
241 160 482 262

Family's Representative Sequence

Representative Sequence 3300046526|Ga0495666_0056839|Ga0495666_0056839_32_931
Length 299
Sequence LPGAPTGPSGRSSLADGITLPPESAEPAAGVSPRALTIAGSDSGGGAGIQADLKTFAALGVWGTSAITSITVQNTRGVTGVADVPAETVAAQIRAVADDIGLDAAKTGMLSSASIVEAVAGAIEAGGVPNLVVDPVFVSKHGHPLLREDAVDGLRRRIVPRAVLVTPNLPEAAGLVGFDVATADEMRKAAEEILALGAGAVLVKGGHLAGDRADDYFADGERAEWLEGERIDSVHTHGTGCVLSAAIAAHLARGAELLEAARAGKTFVTEAIRHGLEIGGGIGPVDPAWRARNEAGEPG

Samples

Sample ID Description Type Environment
1 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
53 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
54 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
75 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
76 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
77 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
78 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
79 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
80 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
81 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
82 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
83 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
84 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
85 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
86 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
87 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
88 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
89 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
90 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
93 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
94 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
95 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
96 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
97 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
98 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
99 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
100 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
101 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
102 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
103 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
104 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
105 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
106 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
107 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
108 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
109 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
110 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
111 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
112 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
113 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
114 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
115 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
116 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
117 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
118 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
119 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
120 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
131 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
132 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
133 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
134 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
135 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
136 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
137 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
138 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
139 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
140 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
143 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
144 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
145 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
146 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
147 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
148 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
149 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
150 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
151 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
152 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
153 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
154 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
155 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
156 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
157 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
158 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
159 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
160 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.34
Metatranscriptomes 0
Isolates 1.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.83
Nodule 0
Rhizoplane 3.32
Rhizosphere 92.53
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495666_0056839 3300046526 Bacteria 1873
2 rootH2_10058028 3300003320 Bacteria 6104
3 Ga0070683_100547745 3300005329 Bacteria 1106
4 Ga0070670_100572159 3300005331 Bacteria 1009
5 Ga0068868_100207698 3300005338 Bacteria 1635
6 Ga0068868_100621318 3300005338 Bacteria 959
7 Ga0070689_100373803 3300005340 Bacteria 1200
8 Ga0070687_100155001 3300005343 Bacteria 1349
9 Ga0070671_100004574 3300005355 Bacteria 10962
10 Ga0070674_100058243 3300005356 Bacteria 2685
11 Ga0070688_100232782 3300005365 Bacteria 1304
12 Ga0070667_100127743 3300005367 Bacteria 2217
13 Ga0070703_10000012 3300005406 Bacteria 92842
14 Ga0070705_100116689 3300005440 Bacteria 1716
15 Ga0070708_100007050 3300005445 Bacteria 8967
16 Ga0070708_100025347 3300005445 Bacteria 5069
17 Ga0070708_100064412 3300005445 Bacteria 3284
18 Ga0070681_10007301 3300005458 Bacteria 10786
19 Ga0070681_10187170 3300005458 Bacteria 1990
20 Ga0070706_100003702 3300005467 Bacteria 14955
21 Ga0070706_100005591 3300005467 Bacteria 11957
22 Ga0070706_100115798 3300005467 Bacteria 2496
23 Ga0070707_100035245 3300005468 Bacteria 4773
24 Ga0070707_100062476 3300005468 Bacteria 3573
25 Ga0070707_100130404 3300005468 Bacteria 2445
26 Ga0070698_100011745 3300005471 Bacteria 9289
27 Ga0070698_100126956 3300005471 Bacteria 2508
28 Ga0070698_100181241 3300005471 Bacteria 2045
29 Ga0070696_100181295 3300005546 Bacteria 1562
30 Ga0070665_100176572 3300005548 Bacteria 2137
31 Ga0068852_100013552 3300005616 Bacteria 6241
32 Ga0068852_100025392 3300005616 Bacteria 4801
33 Ga0068861_100017751 3300005719 Bacteria 5056
34 Ga0068870_10027400 3300005840 Bacteria 2849
35 Ga0068862_100016538 3300005844 Bacteria 6142
36 Ga0081455_10002032 3300005937 Bacteria 24194
37 Ga0081455_10006718 3300005937 Bacteria 12288
38 Ga0081455_10019279 3300005937 Bacteria 6458
39 Ga0081455_10094545 3300005937 Bacteria 2414
40 Ga0081455_10144810 3300005937 Bacteria 1840
41 Ga0081540_1000056 3300005983 Bacteria 122552
42 Ga0075365_10124624 3300006038 Bacteria 1780
43 Ga0097621_100030963 3300006237 Bacteria 4241
44 Ga0075428_100082507 3300006844 Bacteria 3508
45 Ga0075428_100135925 3300006844 Bacteria 2673
46 Ga0075428_100489845 3300006844 Bacteria 1316
47 Ga0075428_100603608 3300006844 Bacteria 1172
48 Ga0075431_100001491 3300006847 Bacteria 21644
49 Ga0075433_10000428 3300006852 Bacteria 27002
50 Ga0075433_10001614 3300006852 Bacteria 16730
51 Ga0075434_100000287 3300006871 Bacteria 35936
52 Ga0075434_100074623 3300006871 Bacteria 3385
53 Ga0075434_100285108 3300006871 Bacteria 1671
54 Ga0075429_100000082 3300006880 Bacteria 49180
55 Ga0068865_100029782 3300006881 Bacteria 3626
56 Ga0075436_100016911 3300006914 Bacteria 4991
57 Ga0075435_100005049 3300007076 Bacteria 9168
58 Ga0075435_100026708 3300007076 Bacteria 4509
59 Ga0075435_100060220 3300007076 Bacteria 3078
60 Ga0111539_10015253 3300009094 Bacteria 9570
61 Ga0111539_10364373 3300009094 Bacteria 1682
62 Ga0111539_10871044 3300009094 Bacteria 1048
63 Ga0105245_10001274 3300009098 Bacteria 22731
64 Ga0114129_10000229 3300009147 Bacteria 62652
65 Ga0114129_10002562 3300009147 Bacteria 25237
66 Ga0114129_10011327 3300009147 Bacteria 12704
67 Ga0114129_10020364 3300009147 Bacteria 9436
68 Ga0114129_10039651 3300009147 Bacteria 6641
69 Ga0114129_10102116 3300009147 Bacteria 3966
70 Ga0114129_10220662 3300009147 Bacteria 2558
71 Ga0114129_10288059 3300009147 Bacteria 2192
72 Ga0105243_10007716 3300009148 Bacteria 8272
73 Ga0105243_10264002 3300009148 Bacteria 1543
74 Ga0105242_10385020 3300009176 Bacteria 1305
75 Ga0105238_10087575 3300009551 Bacteria 3101
76 Ga0105249_10008629 3300009553 Bacteria 8881
77 Ga0105246_10135998 3300011119 Bacteria 1842
78 Ga0105246_10169779 3300011119 Bacteria 1669
79 Ga0157378_10028632 3300013297 Bacteria 4917
80 Ga0157378_10467580 3300013297 Bacteria 1254
81 Ga0163162_10243451 3300013306 Bacteria 1930
82 Ga0157372_10002962 3300013307 Bacteria 18302
83 Ga0157372_10003672 3300013307 Bacteria 16501
84 Ga0157375_10129481 3300013308 Bacteria 2642
85 Ga0157380_10091769 3300014326 Bacteria 2508
86 Ga0157379_10101864 3300014968 Bacteria 2577
87 Ga0157376_10020075 3300014969 Bacteria 5162
88 Ga0157376_10437405 3300014969 Bacteria 1273
89 Ga0213874_10005537 3300021377 Bacteria 2946
90 Ga0213876_10021429 3300021384 Bacteria 3417
91 Ga0207653_10000046 3300025885 Bacteria 93516
92 Ga0207642_10228218 3300025899 Bacteria 1044
93 Ga0207684_10010317 3300025910 Bacteria 8224
94 Ga0207684_10028869 3300025910 Bacteria 4725
95 Ga0207707_10111834 3300025912 Bacteria 2388
96 Ga0207707_10293492 3300025912 Bacteria 1406
97 Ga0207707_10410738 3300025912 Bacteria 1161
98 Ga0207662_10070925 3300025918 Bacteria 2108
99 Ga0207646_10024704 3300025922 Bacteria 5503
100 Ga0207694_10000014 3300025924 Bacteria 374435
101 Ga0207650_10511794 3300025925 Bacteria 1004
102 Ga0207687_10000746 3300025927 Bacteria 21976
103 Ga0207687_10016216 3300025927 Bacteria 4892
104 Ga0207644_10098834 3300025931 Bacteria 2188
105 Ga0207709_10259003 3300025935 Bacteria 1275
106 Ga0207669_10249054 3300025937 Bacteria 1322
107 Ga0207704_10051228 3300025938 Bacteria 2495
108 Ga0207677_10195908 3300026023 Bacteria 1602
109 Ga0207677_10502381 3300026023 Bacteria 1049
110 Ga0207703_10029060 3300026035 Bacteria 4361
111 Ga0207703_10160207 3300026035 Bacteria 1970
112 Ga0207678_10416785 3300026067 Bacteria 1164
113 Ga0207708_10043549 3300026075 Bacteria 3420
114 Ga0207702_10119376 3300026078 Bacteria 2358
115 Ga0207675_100027240 3300026118 Bacteria 5323
116 Ga0207675_100050968 3300026118 Bacteria 3863
117 Ga0207698_10014132 3300026142 Bacteria 5294
118 Ga0207428_10003813 3300027907 Bacteria 14457
119 Ga0207428_10263605 3300027907 Bacteria 1283
120 Ga0307413_10012367 3300031824 Bacteria 4246
121 Ga0307410_10307884 3300031852 Bacteria 1252
122 Ga0307407_10019785 3300031903 Bacteria 3435
123 Ga0307409_100028108 3300031995 Bacteria 4000
124 Ga0307411_10042523 3300032005 Bacteria 2900
125 Ga0307415_100196874 3300032126 Bacteria 1595
126 Ga0373928_0003606 3300035084 Bacteria 2951
127 Ga0373929_0003706 3300035085 Bacteria 2742
128 Ga0373932_0000282 3300035112 Bacteria 15315
129 Ga0373943_0018555 3300035170 Bacteria 3197
130 Ga0373931_0000005 3300035691 Bacteria 480485
131 Ga0373947_0008589 3300035725 Bacteria 5882
132 Ga0395899_0003770 3300037312 Bacteria 11965
133 Ga0395899_0022342 3300037312 Bacteria 4797
134 Ga0395900_0001758 3300037418 Bacteria 24863
135 Ga0395900_0031795 3300037418 Bacteria 5424
136 Ga0395900_0196640 3300037418 Bacteria 2042
137 Ga0395898_0001163 3300037466 Bacteria 40158
138 Ga0395898_0163055 3300037466 Bacteria 2132
139 Ga0395905_0000949 3300037471 Bacteria 37219
140 Ga0395905_0107761 3300037471 Bacteria 2616
141 Ga0395905_0287064 3300037471 Bacteria 1532
142 Ga0395905_0290279 3300037471 Bacteria 1522
143 Ga0395901_0035008 3300038443 Bacteria 5188
144 Ga0395901_0038304 3300038443 Bacteria 4958
145 Ga0395901_0064115 3300038443 Bacteria 3824
146 Ga0395901_0123687 3300038443 Bacteria 2718
147 Ga0436365_0039995 3300039437 Bacteria 48561
148 Ga0436363_0940727 3300039450 Bacteria 8512
149 Ga0436362_0081640 3300039453 Bacteria 20380
150 Ga0451577_0000158 3300042876 Bacteria 151857
151 Ga0453684_0000089 3300044712 Bacteria 395064
152 Ga0466958_0084657 3300045836 Bacteria 1956
153 Ga0495603_0003689 3300046455 Bacteria 9118
154 Ga0495603_0013712 3300046455 Bacteria 4904
155 Ga0495603_0266828 3300046455 Bacteria 985
156 Ga0495629_0000523 3300046459 Bacteria 32051
157 Ga0495580_0280309 3300046472 Bacteria 1137
158 Ga0495582_0000055 3300046473 Bacteria 57283
159 Ga0495639_0096312 3300046475 Bacteria 1393
160 Ga0495584_0073579 3300046491 Bacteria 1717
161 Ga0495594_0025407 3300046499 Bacteria 3184
162 Ga0495665_0089675 3300046531 Bacteria 1615
163 Ga0495647_0002702 3300046681 Bacteria 5634
164 Ga0495658_0000758 3300046683 Bacteria 17449
165 Ga0495613_0148861 3300046689 Bacteria 1670
166 Ga0495581_0004453 3300047315 Bacteria 8098
167 Ga0495604_0242622 3300047317 Bacteria 1231
168 Ga0495676_0120052 3300047321 Bacteria 1914
169 Ga0495680_0121572 3300047322 Bacteria 1927
170 Ga0496103_0050439 3300048906 Bacteria 2575
171 Ga0496103_0229424 3300048906 Bacteria 1194
172 Ga0496105_0156226 3300048908 Bacteria 1873
173 Ga0496106_0027346 3300048909 Bacteria 4248
174 Ga0496107_0047915 3300048910 Bacteria 3077
175 Ga0496109_0058036 3300048912 Bacteria 3535
176 Ga0496114_0132149 3300048917 Bacteria 2156
177 Ga0496115_0113591 3300048918 Bacteria 2226
178 Ga0501034_0067231 3300049571 Bacteria 3597
179 Ga0501036_0449806 3300049572 Bacteria 1073
180 Ga0501038_0111678 3300049574 Bacteria 2264
181 Ga0501039_0265746 3300049575 Bacteria 1348
182 Ga0501039_0599096 3300049575 Bacteria 864
183 Ga0501040_0040233 3300049576 Bacteria 3181
184 Ga0501040_0058276 3300049576 Bacteria 2652
185 Ga0501041_0246559 3300049577 Bacteria 1123
186 Ga0501041_0323676 3300049577 Bacteria 973
187 Ga0501042_0083073 3300049578 Bacteria 2296
188 Ga0501042_0149840 3300049578 Bacteria 1682
189 Ga0501046_0259948 3300049580 Bacteria 1276
190 Ga0501047_0131136 3300049581 Bacteria 2387
191 Ga0501048_0238138 3300049582 Bacteria 1291
192 Ga0501068_0037699 3300049584 Bacteria 2894
193 Ga0501070_0053896 3300049586 Bacteria 3335
194 Ga0501070_0171891 3300049586 Bacteria 1785
195 Ga0501071_0039668 3300049587 Bacteria 3369
196 Ga0501072_0229336 3300049588 Bacteria 1480
197 Ga0501072_0498812 3300049588 Bacteria 963
198 Ga0501073_0254242 3300049589 Bacteria 1213
199 Ga0501075_0045578 3300049591 Bacteria 3291
200 Ga0501076_0028786 3300049592 Bacteria 4317
201 Ga0501077_0034598 3300049593 Bacteria 3216
202 Ga0501079_0080883 3300049741 Bacteria 2512
203 Ga0501080_0005181 3300049742 Bacteria 11615
204 Ga0501035_0152083 3300049822 Bacteria 2008
205 Ga0501035_0329273 3300049822 Bacteria 1282
206 Ga0501044_0033589 3300049823 Bacteria 5389
207 Ga0501045_0081377 3300049824 Bacteria 2388
208 nmdc:mga0yw44_60429_c1 3300050492 Bacteria 2322
209 nmdc:mga05p37_157915_c1 3300050507 Bacteria 2771
210 nmdc:mga05p37_293396_c1 3300050507 Bacteria 1935
211 nmdc:mga05p37_47272_c1 3300050507 Bacteria 5292
212 nmdc:mga05p37_487482_c1 3300050507 Bacteria 1418
213 nmdc:mga05p37_73002_c1 3300050507 Bacteria 4222
214 nmdc:mga05p37_8265_c1 3300050507 Bacteria 12304
215 nmdc:mga05p37_99029_c1 3300050507 Bacteria 3591
216 nmdc:mga09592_130817_c1 3300050508 Bacteria 2159
217 nmdc:mga09592_895_c1 3300050508 Bacteria 23385
218 nmdc:mga0qj67_2517_c1 3300050509 Bacteria 13091
219 nmdc:mga06r32_14263_c1 3300050510 Bacteria 7208
220 nmdc:mga08y16_167786_c1 3300050511 Bacteria 2281
221 nmdc:mga08y16_566167_c1 3300050511 Bacteria 1149
222 nmdc:mga0n895_163185_c1 3300050512 Bacteria 2260
223 nmdc:mga0n895_282253_c1 3300050512 Bacteria 1684
224 nmdc:mga0n895_73156_c1 3300050512 Bacteria 3402
225 nmdc:mga0n895_9727_c1 3300050512 Bacteria 8432
226 nmdc:mga0rr50_4974_c1 3300050513 Bacteria 7871
227 nmdc:mga0rr50_7855_c1 3300050513 Bacteria 6615
228 nmdc:mga08x19_73839_c1 3300050514 Bacteria 2227
229 nmdc:mga0a205_3431_c1 3300050515 Bacteria 14131
230 nmdc:mga0a205_918_c1 3300050515 Bacteria 24256
231 Ga0501084_0068147 3300054114 Bacteria 2979
232 Ga0501084_0093257 3300054114 Bacteria 2528
233 Ga0501084_0125335 3300054114 Bacteria 2161
234 Ga0501084_0301292 3300054114 Bacteria 1354
235 Ga0590074_009618 3300059423 Bacteria 1611
236 Ga0501082_0098593 3300060353 Bacteria 2527
237 Ga0530510_0030540 3300061734 Bacteria 3870
238 2799185266 2799112218 Bacteria 4315149
239 2894822076 2894817345 Bacteria 4892941
240 641334773 641228493 Bacteria 3999591
241 643390733 643348555 Bacteria 3914947
242 Ga0495666_0056839
243 rootH2_10058028
244 Ga0070683_100547745
245 Ga0070670_100572159
246 Ga0068868_100207698
247 Ga0068868_100621318
248 Ga0070689_100373803
249 Ga0070687_100155001
250 Ga0070671_100004574
251 Ga0070674_100058243
252 Ga0070688_100232782
253 Ga0070667_100127743
254 Ga0070703_10000012
255 Ga0070705_100116689
256 Ga0070708_100007050
257 Ga0070708_100025347
258 Ga0070708_100064412
259 Ga0070681_10007301
260 Ga0070681_10187170
261 Ga0070706_100003702
262 Ga0070706_100005591
263 Ga0070706_100115798
264 Ga0070707_100035245
265 Ga0070707_100062476
266 Ga0070707_100130404
267 Ga0070698_100011745
268 Ga0070698_100126956
269 Ga0070698_100181241
270 Ga0070696_100181295
271 Ga0070665_100176572
272 Ga0068852_100013552
273 Ga0068852_100025392
274 Ga0068861_100017751
275 Ga0068870_10027400
276 Ga0068862_100016538
277 Ga0081455_10002032
278 Ga0081455_10006718
279 Ga0081455_10019279
280 Ga0081455_10094545
281 Ga0081455_10144810
282 Ga0081540_1000056
283 Ga0075365_10124624
284 Ga0097621_100030963
285 Ga0075428_100082507
286 Ga0075428_100135925
287 Ga0075428_100489845
288 Ga0075428_100603608
289 Ga0075431_100001491
290 Ga0075433_10000428
291 Ga0075433_10001614
292 Ga0075434_100000287
293 Ga0075434_100074623
294 Ga0075434_100285108
295 Ga0075429_100000082
296 Ga0068865_100029782
297 Ga0075436_100016911
298 Ga0075435_100005049
299 Ga0075435_100026708
300 Ga0075435_100060220
301 Ga0111539_10015253
302 Ga0111539_10364373
303 Ga0111539_10871044
304 Ga0105245_10001274
305 Ga0114129_10000229
306 Ga0114129_10002562
307 Ga0114129_10011327
308 Ga0114129_10020364
309 Ga0114129_10039651
310 Ga0114129_10102116
311 Ga0114129_10220662
312 Ga0114129_10288059
313 Ga0105243_10007716
314 Ga0105243_10264002
315 Ga0105242_10385020
316 Ga0105238_10087575
317 Ga0105249_10008629
318 Ga0105246_10135998
319 Ga0105246_10169779
320 Ga0157378_10028632
321 Ga0157378_10467580
322 Ga0163162_10243451
323 Ga0157372_10002962
324 Ga0157372_10003672
325 Ga0157375_10129481
326 Ga0157380_10091769
327 Ga0157379_10101864
328 Ga0157376_10020075
329 Ga0157376_10437405
330 Ga0213874_10005537
331 Ga0213876_10021429
332 Ga0207653_10000046
333 Ga0207642_10228218
334 Ga0207684_10010317
335 Ga0207684_10028869
336 Ga0207707_10111834
337 Ga0207707_10293492
338 Ga0207707_10410738
339 Ga0207662_10070925
340 Ga0207646_10024704
341 Ga0207694_10000014
342 Ga0207650_10511794
343 Ga0207687_10000746
344 Ga0207687_10016216
345 Ga0207644_10098834
346 Ga0207709_10259003
347 Ga0207669_10249054
348 Ga0207704_10051228
349 Ga0207677_10195908
350 Ga0207677_10502381
351 Ga0207703_10029060
352 Ga0207703_10160207
353 Ga0207678_10416785
354 Ga0207708_10043549
355 Ga0207702_10119376
356 Ga0207675_100027240
357 Ga0207675_100050968
358 Ga0207698_10014132
359 Ga0207428_10003813
360 Ga0207428_10263605
361 Ga0307413_10012367
362 Ga0307410_10307884
363 Ga0307407_10019785
364 Ga0307409_100028108
365 Ga0307411_10042523
366 Ga0307415_100196874
367 Ga0373928_0003606
368 Ga0373929_0003706
369 Ga0373932_0000282
370 Ga0373943_0018555
371 Ga0373931_0000005
372 Ga0373947_0008589
373 Ga0395899_0003770
374 Ga0395899_0022342
375 Ga0395900_0001758
376 Ga0395900_0031795
377 Ga0395900_0196640
378 Ga0395898_0001163
379 Ga0395898_0163055
380 Ga0395905_0000949
381 Ga0395905_0107761
382 Ga0395905_0287064
383 Ga0395905_0290279
384 Ga0395901_0035008
385 Ga0395901_0038304
386 Ga0395901_0064115
387 Ga0395901_0123687
388 Ga0436365_0039995
389 Ga0436363_0940727
390 Ga0436362_0081640
391 Ga0451577_0000158
392 Ga0453684_0000089
393 Ga0466958_0084657
394 Ga0495603_0003689
395 Ga0495603_0013712
396 Ga0495603_0266828
397 Ga0495629_0000523
398 Ga0495580_0280309
399 Ga0495582_0000055
400 Ga0495639_0096312
401 Ga0495584_0073579
402 Ga0495594_0025407
403 Ga0495665_0089675
404 Ga0495647_0002702
405 Ga0495658_0000758
406 Ga0495613_0148861
407 Ga0495581_0004453
408 Ga0495604_0242622
409 Ga0495676_0120052
410 Ga0495680_0121572
411 Ga0496103_0050439
412 Ga0496103_0229424
413 Ga0496105_0156226
414 Ga0496106_0027346
415 Ga0496107_0047915
416 Ga0496109_0058036
417 Ga0496114_0132149
418 Ga0496115_0113591
419 Ga0501034_0067231
420 Ga0501036_0449806
421 Ga0501038_0111678
422 Ga0501039_0265746
423 Ga0501039_0599096
424 Ga0501040_0040233
425 Ga0501040_0058276
426 Ga0501041_0246559
427 Ga0501041_0323676
428 Ga0501042_0083073
429 Ga0501042_0149840
430 Ga0501046_0259948
431 Ga0501047_0131136
432 Ga0501048_0238138
433 Ga0501068_0037699
434 Ga0501070_0053896
435 Ga0501070_0171891
436 Ga0501071_0039668
437 Ga0501072_0229336
438 Ga0501072_0498812
439 Ga0501073_0254242
440 Ga0501075_0045578
441 Ga0501076_0028786
442 Ga0501077_0034598
443 Ga0501079_0080883
444 Ga0501080_0005181
445 Ga0501035_0152083
446 Ga0501035_0329273
447 Ga0501044_0033589
448 Ga0501045_0081377
449 nmdc:mga0yw44_60429_c1
450 nmdc:mga05p37_157915_c1
451 nmdc:mga05p37_293396_c1
452 nmdc:mga05p37_47272_c1
453 nmdc:mga05p37_487482_c1
454 nmdc:mga05p37_73002_c1
455 nmdc:mga05p37_8265_c1
456 nmdc:mga05p37_99029_c1
457 nmdc:mga09592_130817_c1
458 nmdc:mga09592_895_c1
459 nmdc:mga0qj67_2517_c1
460 nmdc:mga06r32_14263_c1
461 nmdc:mga08y16_167786_c1
462 nmdc:mga08y16_566167_c1
463 nmdc:mga0n895_163185_c1
464 nmdc:mga0n895_282253_c1
465 nmdc:mga0n895_73156_c1
466 nmdc:mga0n895_9727_c1
467 nmdc:mga0rr50_4974_c1
468 nmdc:mga0rr50_7855_c1
469 nmdc:mga08x19_73839_c1
470 nmdc:mga0a205_3431_c1
471 nmdc:mga0a205_918_c1
472 Ga0501084_0068147
473 Ga0501084_0093257
474 Ga0501084_0125335
475 Ga0501084_0301292
476 Ga0590074_009618
477 Ga0501082_0098593
478 Ga0530510_0030540
479 2799185266
480 2894822076
481 641334773
482 643390733

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08543

Phos_pyr_kin

Phosphomethylpyrimidine kinase

42

286

0.99

PF00294

PfkB

pfkB family carbohydrate kinase

105

276

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
5b6a-assembly1.cif.gz_A-2 structure of pyridoxal kinasefrom pseudomonas aeruginosa 0.8847 30 218
5zwb-assembly1.cif.gz_A crystal structure of pyridoxal kinase (pdxk) from salmonella typhimurium in complex with adp, pl-linked to lys233 via a schiff base 0.8556 34 218
2i5b-assembly2.cif.gz_D the crystal structure of an adp complex of bacillus subtilis pyridoxal kinase provides evidence for the parralel emergence of enzyme activity during evolution 0.8465 1 234
5zwa-assembly1.cif.gz_A crystal structure of pyridoxal kinase (pdxk) from salmonella typhimurium in complex with adp, pl-linked to lys233 via schiff base in protomer a and the product (plp) in protomer b 0.8465 34 216
5zwa-assembly1.cif.gz_B crystal structure of pyridoxal kinase (pdxk) from salmonella typhimurium in complex with adp, pl-linked to lys233 via schiff base in protomer a and the product (plp) in protomer b 0.845 34 218
ID Description Score Start End Superfamily
af_P9WG77_1_265_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8893 1 233 3.40.1190.20
af_Q2FWG1_2_274_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8794 1 234 3.40.1190.20
af_P9WG77_1_265_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8749 1 233 3.40.1190.20
af_O94266_18_315_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8731 1 233 3.40.1190.20
af_Q2FWG1_2_274_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8687 1 234 3.40.1190.20
ID Description Score Start End GO Terms
AF-A0A537RAK5-F1-model_v4 hydroxymethylpyrimidine kinase (EC 2.7.1.49) 0.9762 79 232 GO:0005829
GO:0008902
GO:0008972
GO:0009228
GO:0009229
AF-A0A2E0GH16-F1-model_v4 hydroxymethylpyrimidine kinase (EC 2.7.1.49) 0.9752 47 233 GO:0005829
GO:0008902
GO:0008972
GO:0009228
GO:0009229
AF-A0A535Z666-F1-model_v4 hydroxymethylpyrimidine kinase (EC 2.7.1.49) 0.9711 30 234 GO:0005829
GO:0008902
GO:0008972
GO:0009228
AF-A0A4Q3SMC3-F1-model_v4 Bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase 0.9702 140 232 GO:0005829
GO:0008902
GO:0008972
GO:0009228
GO:0009229
AF-A0A4Q3BYI7-F1-model_v4 deleted 0.9693 79 225

Map