F353942

General Info

Members Datasets Scaffolds Average Seq Length
241 174 482 121

Family's Representative Sequence

Representative Sequence 3300035695|Ga0373927_0159654|Ga0373927_0159654_950_1384
Length 144
Sequence VIIRFLSLESTVVAGGELVYHACDTMPTLIPQPTLIEAAGTKPKTIEEYVGRVNSSTTGVSVAHMRSPEGWQEPGQTPEFEEYTLVLRGTLRVEHKGGAIELRSGQAVIAHPGEWVRYSTPHRGGAEYIAICRPAFSPDLVHRD

Samples

Sample ID Description Type Environment
1 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
76 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
78 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
79 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
80 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
106 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
107 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
108 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
109 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
110 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
111 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
112 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
113 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
114 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
115 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
116 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
117 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
118 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
121 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
125 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
126 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
129 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
130 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
131 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
132 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
133 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
134 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
135 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
136 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
137 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
138 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
139 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
140 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
141 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
142 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
143 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
144 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
145 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
146 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
147 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
148 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
151 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
152 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
153 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
157 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
158 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
159 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
160 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
161 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
162 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
163 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
164 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
165 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
166 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
167 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
168 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
169 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
170 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
171 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
172 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
173 2687453737 Frankia sp. BMG5.36 Isolate Nodule
174 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.51
Metatranscriptomes 1.24
Isolates 1.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.15
Nodule 1.24
Rhizoplane 2.9
Rhizosphere 90.87
Stem 0
Stem Tuber 0
Unclassified 26.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373927_0159654 3300035695 Bacteria 1477
2 Ga0065704_10309827 3300005289 Unclassified 870
3 Ga0070676_11134047 3300005328 Bacteria 592
4 Ga0070683_100350963 3300005329 Bacteria 1405
5 Ga0070670_100201777 3300005331 Unclassified 1728
6 Ga0070670_102050355 3300005331 Unclassified 527
7 Ga0068869_100035512 3300005334 Bacteria 3533
8 Ga0070666_10607043 3300005335 Unclassified 799
9 Ga0070666_10810361 3300005335 Bacteria 690
10 Ga0070680_100449886 3300005336 Bacteria 1100
11 Ga0068868_100020205 3300005338 Bacteria 5000
12 Ga0068868_100291062 3300005338 Unclassified 1385
13 Ga0068868_100297611 3300005338 Bacteria 1370
14 Ga0070689_100349256 3300005340 Unclassified 1240
15 Ga0070675_101573294 3300005354 Unclassified 606
16 Ga0070673_100475562 3300005364 Bacteria 1127
17 Ga0070673_100624888 3300005364 Bacteria 984
18 Ga0070667_100149436 3300005367 Bacteria 2051
19 Ga0070667_101580319 3300005367 Unclassified 616
20 Ga0070709_10022328 3300005434 Bacteria 3700
21 Ga0070709_10649915 3300005434 Unclassified 816
22 Ga0070709_11563723 3300005434 Unclassified 536
23 Ga0070710_10044617 3300005437 Bacteria 2460
24 Ga0070711_100754821 3300005439 Unclassified 822
25 Ga0070708_100007263 3300005445 Bacteria 8857
26 Ga0070708_100038338 3300005445 Unclassified 4187
27 Ga0070708_100176254 3300005445 Bacteria 1998
28 Ga0070706_100544292 3300005467 Bacteria 1080
29 Ga0070707_100161215 3300005468 Bacteria 2185
30 Ga0070698_100967340 3300005471 Unclassified 798
31 Ga0070699_100029206 3300005518 Unclassified 4755
32 Ga0070679_100677146 3300005530 Bacteria 974
33 Ga0070684_100475190 3300005535 Unclassified 1157
34 Ga0070697_100000049 3300005536 Bacteria 90362
35 Ga0070697_100000113 3300005536 Bacteria 63284
36 Ga0070672_101396923 3300005543 Bacteria 626
37 Ga0070686_100340278 3300005544 Bacteria 1124
38 Ga0070695_100022298 3300005545 Bacteria 3884
39 Ga0070695_100156096 3300005545 Bacteria 1597
40 Ga0070665_101347557 3300005548 Unclassified 723
41 Ga0068855_100383437 3300005563 Bacteria 1543
42 Ga0068857_101243986 3300005577 Unclassified 721
43 Ga0068852_100496312 3300005616 Bacteria 1215
44 Ga0068852_101117606 3300005616 Bacteria 808
45 Ga0068859_100114568 3300005617 Bacteria 2760
46 Ga0068861_100065358 3300005719 Bacteria 2802
47 Ga0068863_100107353 3300005841 Bacteria 2657
48 Ga0068858_100033173 3300005842 Unclassified 4794
49 Ga0068858_101017004 3300005842 Unclassified 812
50 Ga0068860_100043295 3300005843 Bacteria 4296
51 Ga0068860_100077666 3300005843 Bacteria 3158
52 Ga0068860_100834688 3300005843 Bacteria 936
53 Ga0068862_100012413 3300005844 Bacteria 7046
54 Ga0081455_10081402 3300005937 Unclassified 2651
55 Ga0081539_10021712 3300005985 Bacteria 4275
56 Ga0070717_10239554 3300006028 Unclassified 1599
57 Ga0070717_10551771 3300006028 Unclassified 1043
58 Ga0075365_10591443 3300006038 Bacteria 785
59 Ga0075368_10018246 3300006042 Bacteria 2635
60 Ga0075364_10397285 3300006051 Bacteria 940
61 Ga0070716_100450272 3300006173 Bacteria 938
62 Ga0070716_101350893 3300006173 Unclassified 578
63 Ga0075367_10327774 3300006178 Bacteria 965
64 Ga0097621_100000554 3300006237 Bacteria 26269
65 Ga0068871_100022585 3300006358 Bacteria 4853
66 Ga0075428_100089864 3300006844 Bacteria 3350
67 Ga0075430_100381544 3300006846 Bacteria 1163
68 Ga0075430_100693531 3300006846 Unclassified 839
69 Ga0068865_100860236 3300006881 Bacteria 786
70 Ga0075436_100967741 3300006914 Bacteria 638
71 Ga0097620_100114574 3300006931 Bacteria 2760
72 Ga0075435_101385261 3300007076 Bacteria 616
73 Ga0099795_10242169 3300007788 Bacteria 775
74 Ga0105240_10693268 3300009093 Bacteria 1112
75 Ga0111539_11181403 3300009094 Unclassified 889
76 Ga0105245_10004799 3300009098 Bacteria 11930
77 Ga0105245_10156779 3300009098 Unclassified 2157
78 Ga0105245_10731421 3300009098 Bacteria 1024
79 Ga0105248_10059948 3300009177 Bacteria 4274
80 Ga0105237_10770138 3300009545 Bacteria 969
81 Ga0105237_11056334 3300009545 Unclassified 819
82 Ga0105238_10213737 3300009551 Bacteria 1905
83 Ga0105238_11000183 3300009551 Bacteria 857
84 Ga0105249_11904875 3300009553 Bacteria 667
85 Ga0099796_10178805 3300010159 Unclassified 850
86 Ga0105239_10409127 3300010375 Bacteria 1536
87 Ga0105246_10962237 3300011119 Bacteria 770
88 Ga0105246_11588922 3300011119 Bacteria 617
89 Ga0157373_10499552 3300013100 Unclassified 879
90 Ga0157371_11076367 3300013102 Bacteria 616
91 Ga0157374_10159207 3300013296 Bacteria 2199
92 Ga0157378_10000437 3300013297 Bacteria 40470
93 Ga0163162_10000471 3300013306 Bacteria 37412
94 Ga0163162_10114787 3300013306 Bacteria 2792
95 Ga0157372_10705641 3300013307 Bacteria 1174
96 Ga0157372_11395052 3300013307 Bacteria 808
97 Ga0157375_11333896 3300013308 Bacteria 844
98 Ga0163163_10113416 3300014325 Bacteria 2741
99 Ga0163163_10871101 3300014325 Bacteria 964
100 Ga0182008_10012774 3300014497 Unclassified 4427
101 Ga0157379_10297775 3300014968 Unclassified 1470
102 Ga0182006_1022873 3300015261 Unclassified 2593
103 Ga0206353_10346453 3300020082 Bacteria 1213
104 Ga0224572_1020096 3300024225 Unclassified 1282
105 Ga0228598_1000336 3300024227 Bacteria 9229
106 Ga0228598_1050044 3300024227 Bacteria 828
107 Ga0207426_1091249 3300025302 Bacteria 806
108 Ga0207692_10095570 3300025898 Unclassified 1621
109 Ga0207680_10136480 3300025903 Unclassified 1622
110 Ga0207699_10019424 3300025906 Bacteria 3624
111 Ga0207684_10247963 3300025910 Bacteria 1536
112 Ga0207649_10236205 3300025920 Bacteria 1310
113 Ga0207646_10276269 3300025922 Unclassified 1518
114 Ga0207646_10515894 3300025922 Bacteria 1076
115 Ga0207681_10894393 3300025923 Bacteria 743
116 Ga0207694_10167847 3300025924 Bacteria 1776
117 Ga0207687_10202846 3300025927 Bacteria 1551
118 Ga0207687_10369573 3300025927 Unclassified 1172
119 Ga0207686_10119338 3300025934 Unclassified 1792
120 Ga0207665_10098477 3300025939 Bacteria 2037
121 Ga0207665_10321199 3300025939 Unclassified 1162
122 Ga0207691_10616794 3300025940 Unclassified 918
123 Ga0207689_10117872 3300025942 Bacteria 2183
124 Ga0207661_10566765 3300025944 Bacteria 1041
125 Ga0207661_10888442 3300025944 Bacteria 821
126 Ga0207651_10447032 3300025960 Bacteria 1108
127 Ga0207677_10604747 3300026023 Unclassified 962
128 Ga0207677_10618230 3300026023 Unclassified 952
129 Ga0207677_10690742 3300026023 Bacteria 904
130 Ga0207703_10194184 3300026035 Bacteria 1800
131 Ga0207703_11137010 3300026035 Bacteria 750
132 Ga0207678_10856400 3300026067 Bacteria 803
133 Ga0207641_10659256 3300026088 Unclassified 1028
134 Ga0207674_10984749 3300026116 Unclassified 812
135 Ga0207674_12124674 3300026116 Bacteria 525
136 Ga0207698_10790397 3300026142 Bacteria 950
137 Ga0209813_10088442 3300027866 Bacteria 1036
138 Ga0268266_12099890 3300028379 Unclassified 538
139 Ga0268265_10000276 3300028380 Bacteria 58368
140 Ga0268265_10076895 3300028380 Unclassified 2620
141 Ga0268264_10162886 3300028381 Unclassified 2011
142 Ga0268264_10438597 3300028381 Bacteria 1263
143 Ga0268264_10800435 3300028381 Bacteria 942
144 Ga0265326_10042674 3300028558 Bacteria 1287
145 Ga0307511_10021592 3300030521 Bacteria 6054
146 Ga0265330_10014305 3300031235 Bacteria 3683
147 Ga0265339_10254131 3300031249 Bacteria 850
148 Ga0265339_10317496 3300031249 Unclassified 740
149 Ga0307408_100018355 3300031548 Bacteria 4694
150 Ga0307408_102169511 3300031548 Bacteria 536
151 Ga0316579_10216010 3300031691 Bacteria 927
152 Ga0265314_10207951 3300031711 Bacteria 1151
153 Ga0316576_10009287 3300031727 Bacteria 6339
154 Ga0316576_11068265 3300031727 Bacteria 573
155 Ga0316578_10089461 3300031728 Bacteria 1837
156 Ga0307405_10366214 3300031731 Unclassified 1117
157 Ga0316577_10191362 3300031733 Bacteria 1156
158 Ga0307413_11690762 3300031824 Bacteria 564
159 Ga0307410_10024882 3300031852 Bacteria 3747
160 Ga0307410_10238946 3300031852 Bacteria 1407
161 Ga0307410_10524584 3300031852 Bacteria 978
162 Ga0307409_100136663 3300031995 Bacteria 2105
163 Ga0307416_100003110 3300032002 Bacteria 9719
164 Ga0307416_100074316 3300032002 Bacteria 2839
165 Ga0307416_100075488 3300032002 Bacteria 2821
166 Ga0307415_100085746 3300032126 Unclassified 2264
167 Ga0307415_100249323 3300032126 Bacteria 1442
168 Ga0316588_1112569 3300033528 Unclassified 685
169 Ga0316596_1089732 3300033541 Bacteria 828
170 Ga0373927_0057891 3300035695 Bacteria 2506
171 Ga0373937_1381495 3300036401 Unclassified 652
172 Ga0316582_0158522 3300036647 Bacteria 1532
173 Ga0316582_0878500 3300036647 Bacteria 613
174 Ga0316584_0011164 3300036712 Bacteria 6306
175 Ga0316584_0424798 3300036712 Bacteria 943
176 Ga0436364_1499778 3300037853 Bacteria 2783
177 Ga0395901_1463712 3300038443 Bacteria 640
178 Ga0466972_0207350 3300044658 Bacteria 918
179 Ga0466966_0488141 3300044684 Bacteria 741
180 Ga0466961_0108297 3300044693 Bacteria 1749
181 Ga0466964_0240885 3300044706 Bacteria 887
182 Ga0466964_0785827 3300044706 Unclassified 537
183 Ga0453684_0003215 3300044712 Bacteria 37450
184 Ga0453684_0137943 3300044712 Bacteria 2917
185 Ga0453684_0769552 3300044712 Bacteria 1041
186 Ga0466971_0010405 3300044719 Bacteria 4065
187 Ga0466968_0253900 3300044735 Bacteria 836
188 Ga0466957_0293872 3300044842 Bacteria 1090
189 Ga0466960_0122903 3300044901 Bacteria 1362
190 Ga0466960_0426802 3300044901 Bacteria 767
191 Ga0451576_0570137 3300045051 Bacteria 1189
192 Ga0451576_1293626 3300045051 Bacteria 760
193 Ga0466958_0094114 3300045836 Bacteria 1856
194 Ga0466958_0137292 3300045836 Bacteria 1538
195 Ga0466967_0180905 3300045976 Bacteria 1989
196 Ga0466967_0203605 3300045976 Bacteria 1875
197 Ga0466967_2350809 3300045976 Bacteria 528
198 Ga0495590_0036844 3300046457 Bacteria 1706
199 Ga0495580_0039733 3300046472 Bacteria 3366
200 Ga0495580_0126797 3300046472 Unclassified 1771
201 Ga0495580_0166194 3300046472 Unclassified 1526
202 Ga0495580_0363070 3300046472 Bacteria 980
203 Ga0495630_0446384 3300046517 Bacteria 991
204 Ga0495648_0098690 3300046524 Bacteria 1617
205 Ga0495667_0579020 3300046559 Unclassified 700
206 Ga0495634_0386862 3300046642 Bacteria 833
207 Ga0495589_0498472 3300046794 Bacteria 556
208 Ga0495602_0894962 3300048088 Unclassified 591
209 Ga0496101_0618471 3300048904 Bacteria 856
210 Ga0496102_0088576 3300048905 Bacteria 2862
211 Ga0496102_0256105 3300048905 Unclassified 1650
212 Ga0496103_0362125 3300048906 Unclassified 932
213 Ga0496106_0071992 3300048909 Bacteria 2643
214 Ga0496106_1184961 3300048909 Bacteria 596
215 Ga0496107_0393716 3300048910 Bacteria 1030
216 Ga0501034_0001997 3300049571 Bacteria 25805
217 Ga0501042_0108670 3300049578 Unclassified 1997
218 Ga0501042_0826497 3300049578 Unclassified 674
219 Ga0501048_0098919 3300049582 Bacteria 2058
220 Ga0501048_0531615 3300049582 Unclassified 843
221 Ga0501076_0689836 3300049592 Bacteria 843
222 Ga0501077_0068564 3300049593 Bacteria 2248
223 Ga0501202_127425 3300049652 Bacteria 646
224 Ga0501211_014522 3300049658 Bacteria 789
225 Ga0501227_004334 3300049665 Bacteria 3051
226 Ga0501233_108620 3300049668 Unclassified 740
227 Ga0501212_054398 3300049851 Bacteria 683
228 nmdc:mga00v17_193086_c1 3300050491 Bacteria 1315
229 nmdc:mga06z11_13036_c1 3300050494 Bacteria 3635
230 nmdc:mga04h51_88714_c1 3300050495 Bacteria 1109
231 nmdc:mga04h51_99477_c1 3300050495 Bacteria 1058
232 nmdc:mga0qj67_1505055_c1 3300050509 Unclassified 518
233 nmdc:mga0qj67_845141_c1 3300050509 Bacteria 723
234 nmdc:mga0n895_1553010_c1 3300050512 Bacteria 627
235 nmdc:mga0rr50_1752926_c1 3300050513 Bacteria 523
236 Ga0495601_0155221 3300053077 Bacteria 1495
237 Ga0495595_0305211 3300053084 Unclassified 801
238 Ga0466962_0066650 3300061719 Bacteria 1719
239 2676201163 2675902999 Bacteria 9438463
240 2689959140 2687453737 Bacteria 11203906
241 2774845739 2773857921 Bacteria 9435764
242 Ga0373927_0159654
243 Ga0065704_10309827
244 Ga0070676_11134047
245 Ga0070683_100350963
246 Ga0070670_100201777
247 Ga0070670_102050355
248 Ga0068869_100035512
249 Ga0070666_10607043
250 Ga0070666_10810361
251 Ga0070680_100449886
252 Ga0068868_100020205
253 Ga0068868_100291062
254 Ga0068868_100297611
255 Ga0070689_100349256
256 Ga0070675_101573294
257 Ga0070673_100475562
258 Ga0070673_100624888
259 Ga0070667_100149436
260 Ga0070667_101580319
261 Ga0070709_10022328
262 Ga0070709_10649915
263 Ga0070709_11563723
264 Ga0070710_10044617
265 Ga0070711_100754821
266 Ga0070708_100007263
267 Ga0070708_100038338
268 Ga0070708_100176254
269 Ga0070706_100544292
270 Ga0070707_100161215
271 Ga0070698_100967340
272 Ga0070699_100029206
273 Ga0070679_100677146
274 Ga0070684_100475190
275 Ga0070697_100000049
276 Ga0070697_100000113
277 Ga0070672_101396923
278 Ga0070686_100340278
279 Ga0070695_100022298
280 Ga0070695_100156096
281 Ga0070665_101347557
282 Ga0068855_100383437
283 Ga0068857_101243986
284 Ga0068852_100496312
285 Ga0068852_101117606
286 Ga0068859_100114568
287 Ga0068861_100065358
288 Ga0068863_100107353
289 Ga0068858_100033173
290 Ga0068858_101017004
291 Ga0068860_100043295
292 Ga0068860_100077666
293 Ga0068860_100834688
294 Ga0068862_100012413
295 Ga0081455_10081402
296 Ga0081539_10021712
297 Ga0070717_10239554
298 Ga0070717_10551771
299 Ga0075365_10591443
300 Ga0075368_10018246
301 Ga0075364_10397285
302 Ga0070716_100450272
303 Ga0070716_101350893
304 Ga0075367_10327774
305 Ga0097621_100000554
306 Ga0068871_100022585
307 Ga0075428_100089864
308 Ga0075430_100381544
309 Ga0075430_100693531
310 Ga0068865_100860236
311 Ga0075436_100967741
312 Ga0097620_100114574
313 Ga0075435_101385261
314 Ga0099795_10242169
315 Ga0105240_10693268
316 Ga0111539_11181403
317 Ga0105245_10004799
318 Ga0105245_10156779
319 Ga0105245_10731421
320 Ga0105248_10059948
321 Ga0105237_10770138
322 Ga0105237_11056334
323 Ga0105238_10213737
324 Ga0105238_11000183
325 Ga0105249_11904875
326 Ga0099796_10178805
327 Ga0105239_10409127
328 Ga0105246_10962237
329 Ga0105246_11588922
330 Ga0157373_10499552
331 Ga0157371_11076367
332 Ga0157374_10159207
333 Ga0157378_10000437
334 Ga0163162_10000471
335 Ga0163162_10114787
336 Ga0157372_10705641
337 Ga0157372_11395052
338 Ga0157375_11333896
339 Ga0163163_10113416
340 Ga0163163_10871101
341 Ga0182008_10012774
342 Ga0157379_10297775
343 Ga0182006_1022873
344 Ga0206353_10346453
345 Ga0224572_1020096
346 Ga0228598_1000336
347 Ga0228598_1050044
348 Ga0207426_1091249
349 Ga0207692_10095570
350 Ga0207680_10136480
351 Ga0207699_10019424
352 Ga0207684_10247963
353 Ga0207649_10236205
354 Ga0207646_10276269
355 Ga0207646_10515894
356 Ga0207681_10894393
357 Ga0207694_10167847
358 Ga0207687_10202846
359 Ga0207687_10369573
360 Ga0207686_10119338
361 Ga0207665_10098477
362 Ga0207665_10321199
363 Ga0207691_10616794
364 Ga0207689_10117872
365 Ga0207661_10566765
366 Ga0207661_10888442
367 Ga0207651_10447032
368 Ga0207677_10604747
369 Ga0207677_10618230
370 Ga0207677_10690742
371 Ga0207703_10194184
372 Ga0207703_11137010
373 Ga0207678_10856400
374 Ga0207641_10659256
375 Ga0207674_10984749
376 Ga0207674_12124674
377 Ga0207698_10790397
378 Ga0209813_10088442
379 Ga0268266_12099890
380 Ga0268265_10000276
381 Ga0268265_10076895
382 Ga0268264_10162886
383 Ga0268264_10438597
384 Ga0268264_10800435
385 Ga0265326_10042674
386 Ga0307511_10021592
387 Ga0265330_10014305
388 Ga0265339_10254131
389 Ga0265339_10317496
390 Ga0307408_100018355
391 Ga0307408_102169511
392 Ga0316579_10216010
393 Ga0265314_10207951
394 Ga0316576_10009287
395 Ga0316576_11068265
396 Ga0316578_10089461
397 Ga0307405_10366214
398 Ga0316577_10191362
399 Ga0307413_11690762
400 Ga0307410_10024882
401 Ga0307410_10238946
402 Ga0307410_10524584
403 Ga0307409_100136663
404 Ga0307416_100003110
405 Ga0307416_100074316
406 Ga0307416_100075488
407 Ga0307415_100085746
408 Ga0307415_100249323
409 Ga0316588_1112569
410 Ga0316596_1089732
411 Ga0373927_0057891
412 Ga0373937_1381495
413 Ga0316582_0158522
414 Ga0316582_0878500
415 Ga0316584_0011164
416 Ga0316584_0424798
417 Ga0436364_1499778
418 Ga0395901_1463712
419 Ga0466972_0207350
420 Ga0466966_0488141
421 Ga0466961_0108297
422 Ga0466964_0240885
423 Ga0466964_0785827
424 Ga0453684_0003215
425 Ga0453684_0137943
426 Ga0453684_0769552
427 Ga0466971_0010405
428 Ga0466968_0253900
429 Ga0466957_0293872
430 Ga0466960_0122903
431 Ga0466960_0426802
432 Ga0451576_0570137
433 Ga0451576_1293626
434 Ga0466958_0094114
435 Ga0466958_0137292
436 Ga0466967_0180905
437 Ga0466967_0203605
438 Ga0466967_2350809
439 Ga0495590_0036844
440 Ga0495580_0039733
441 Ga0495580_0126797
442 Ga0495580_0166194
443 Ga0495580_0363070
444 Ga0495630_0446384
445 Ga0495648_0098690
446 Ga0495667_0579020
447 Ga0495634_0386862
448 Ga0495589_0498472
449 Ga0495602_0894962
450 Ga0496101_0618471
451 Ga0496102_0088576
452 Ga0496102_0256105
453 Ga0496103_0362125
454 Ga0496106_0071992
455 Ga0496106_1184961
456 Ga0496107_0393716
457 Ga0501034_0001997
458 Ga0501042_0108670
459 Ga0501042_0826497
460 Ga0501048_0098919
461 Ga0501048_0531615
462 Ga0501076_0689836
463 Ga0501077_0068564
464 Ga0501202_127425
465 Ga0501211_014522
466 Ga0501227_004334
467 Ga0501233_108620
468 Ga0501212_054398
469 nmdc:mga00v17_193086_c1
470 nmdc:mga06z11_13036_c1
471 nmdc:mga04h51_88714_c1
472 nmdc:mga04h51_99477_c1
473 nmdc:mga0qj67_1505055_c1
474 nmdc:mga0qj67_845141_c1
475 nmdc:mga0n895_1553010_c1
476 nmdc:mga0rr50_1752926_c1
477 Ga0495601_0155221
478 Ga0495595_0305211
479 Ga0466962_0066650
480 2676201163
481 2689959140
482 2774845739

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5fdb-assembly1.cif.gz_A iron free rat cysteine dioxygenase r60qc164r variant 0.9081 33 111
8ch4-assembly1.cif.gz_C crystal structure of the ring cleaving dioxygenase 5-nitrosalicylate 1,2-dioxygenase from bradyrhizobium sp. 0.9039 34 108
6o2d-assembly1.cif.gz_B schizosaccharomyces pombe cnp3 cupin domain 0.8923 19 109
4la3-assembly2.cif.gz_B crystal structure of dimethylsulphoniopropionate (dmsp) lyase dddq y131a in complex with dmsp 0.8873 18 108
6bpt-assembly1.cif.gz_A crystal structure of ferrous form of the uncrosslinked f2-tyr157 human cysteine dioxygenase 0.885 33 111
ID Description Score Start End Superfamily
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9219 33 120 2.60.120.10
4e2gD00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9059 33 115 2.60.120.10
af_O06194_5_109_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8962 19 110 2.60.120.10
af_Q9USR9_537_626_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8932 19 108 2.60.120.10
af_Q03188_852_942_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8847 21 108 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A2U3L9B5-F1-model_v4 Cupin 2, conserved barrel domain protein 1.004 1 120
AF-A0A073CMC5-F1-model_v4 Cupin type-2 domain-containing protein 1.003 1 119
AF-A0A6P0P3D4-F1-model_v4 Cupin domain-containing protein 1.003 1 120
AF-A0A812XGP2-F1-model_v4 deleted 1.002 1 118
AF-Q2IDL1-F1-model_v4 Cupin domain protein 1.002 1 120

Map