F353911

General Info

Members Datasets Scaffolds Average Seq Length
241 159 482 127

Family's Representative Sequence

Representative Sequence 3300031903|Ga0307407_10122521|Ga0307407_101225212
Length 148
Sequence LPTSCGGPREDSDLIDPRTLSLDRSPRAIRQRVEALEHLLESAFSIPGTNKRIGLDVLLDVVPVIGDIAGAALGSYMIWEARNLGMSKWQMTRMGGNVGTDFLXXXXPWVGAIPDYFFKSNTRNLRIIKRHLDKHHPETAVIDVKPVR

Samples

Sample ID Description Type Environment
1 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
48 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
83 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
84 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
85 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
86 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
87 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
91 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
92 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
93 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
94 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
95 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
101 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
102 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
103 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
104 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
105 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
106 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
107 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
108 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
109 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
110 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
111 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
112 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
113 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
114 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
115 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
116 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
117 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
118 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
119 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
120 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
121 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
122 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
123 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
124 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
125 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
126 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
127 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
128 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
129 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
130 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
131 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
132 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
133 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
134 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
135 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
136 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
137 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
138 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
139 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
140 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
141 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
142 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
143 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
144 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
147 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
148 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
149 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
150 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
151 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
152 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
153 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
154 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
155 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
156 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
157 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
158 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
159 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.17
Metatranscriptomes 0
Isolates 0.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.39
Nodule 0
Rhizoplane 3.32
Rhizosphere 85.06
Stem 0
Stem Tuber 0
Unclassified 1.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307407_10122521 3300031903 Bacteria 1651
2 JGI24737J22298_10100150 3300001990 Bacteria 858
3 JGI24738J21930_10038135 3300002075 Bacteria 977
4 JGI24751J29686_10075463 3300002459 Bacteria 697
5 Ga0055530_10016059 3300003791 Bacteria 2410
6 Ga0070658_10017940 3300005327 Bacteria 5661
7 Ga0070658_10537689 3300005327 Bacteria 1011
8 Ga0070676_10034488 3300005328 Bacteria 2906
9 Ga0070670_100747530 3300005331 Bacteria 881
10 Ga0070670_101050625 3300005331 Bacteria 742
11 Ga0070666_10018501 3300005335 Bacteria 4481
12 Ga0070666_10133578 3300005335 Bacteria 1725
13 Ga0070680_100392027 3300005336 Bacteria 1183
14 Ga0070660_100003366 3300005339 Bacteria 10999
15 Ga0070691_10245518 3300005341 Bacteria 958
16 Ga0070661_100082969 3300005344 Bacteria 2367
17 Ga0070668_100239921 3300005347 Bacteria 1501
18 Ga0070668_100485207 3300005347 Bacteria 1068
19 Ga0070671_100121464 3300005355 Bacteria 2199
20 Ga0070673_100352448 3300005364 Bacteria 1306
21 Ga0070673_100753185 3300005364 Bacteria 897
22 Ga0070659_100239030 3300005366 Bacteria 1502
23 Ga0070659_100500220 3300005366 Bacteria 1036
24 Ga0070667_100000126 3300005367 Bacteria 96729
25 Ga0070667_100006431 3300005367 Bacteria 9763
26 Ga0070667_100126475 3300005367 Bacteria 2227
27 Ga0070714_100079660 3300005435 Bacteria 2848
28 Ga0070714_100371594 3300005435 Bacteria 1346
29 Ga0070714_100624830 3300005435 Bacteria 1036
30 Ga0070663_100040329 3300005455 Bacteria 3268
31 Ga0070663_100126930 3300005455 Bacteria 1933
32 Ga0070663_100312068 3300005455 Bacteria 1262
33 Ga0070662_100014196 3300005457 Bacteria 5315
34 Ga0070662_100298432 3300005457 Bacteria 1308
35 Ga0070681_10237441 3300005458 Bacteria 1736
36 Ga0070685_10039987 3300005466 Bacteria 2667
37 Ga0070679_100868369 3300005530 Bacteria 845
38 Ga0068853_101218173 3300005539 Unclassified 727
39 Ga0070686_101540178 3300005544 Bacteria 561
40 Ga0070693_100538496 3300005547 Unclassified 834
41 Ga0070665_100001399 3300005548 Bacteria 28354
42 Ga0070665_100006491 3300005548 Bacteria 11899
43 Ga0068855_100207376 3300005563 Bacteria 2204
44 Ga0068855_100589054 3300005563 Bacteria 1200
45 Ga0070664_100117344 3300005564 Bacteria 2327
46 Ga0068854_100135710 3300005578 Bacteria 1883
47 Ga0068854_100202949 3300005578 Bacteria 1559
48 Ga0068854_100883509 3300005578 Bacteria 784
49 Ga0068856_100045938 3300005614 Bacteria 4301
50 Ga0068856_101408367 3300005614 Bacteria 711
51 Ga0068856_101535386 3300005614 Bacteria 679
52 Ga0068852_100052185 3300005616 Bacteria 3514
53 Ga0068852_100102474 3300005616 Bacteria 2586
54 Ga0068851_10028335 3300005834 Bacteria 2767
55 Ga0068851_10116532 3300005834 Bacteria 1432
56 Ga0068860_100046120 3300005843 Bacteria 4156
57 Ga0068862_100021127 3300005844 Bacteria 5442
58 Ga0075364_10092652 3300006051 Bacteria 2006
59 Ga0075364_10804335 3300006051 Bacteria 641
60 Ga0075369_10342874 3300006186 Bacteria 700
61 Ga0068871_100809123 3300006358 Bacteria 864
62 Ga0105240_10296438 3300009093 Bacteria 1851
63 Ga0105240_11242736 3300009093 Bacteria 787
64 Ga0105248_11660547 3300009177 Bacteria 724
65 Ga0157373_10067400 3300013100 Bacteria 2531
66 Ga0157373_10086288 3300013100 Bacteria 2212
67 Ga0157371_10029687 3300013102 Bacteria 3951
68 Ga0157371_10560905 3300013102 Bacteria 847
69 Ga0157370_10272471 3300013104 Bacteria 1564
70 Ga0157370_10698629 3300013104 Bacteria 926
71 Ga0157370_11297037 3300013104 Bacteria 656
72 Ga0157369_10291323 3300013105 Bacteria 1699
73 Ga0157372_10136173 3300013307 Bacteria 2828
74 Ga0157372_10330094 3300013307 Bacteria 1776
75 Ga0157372_11004540 3300013307 Bacteria 966
76 Ga0182008_10169808 3300014497 Unclassified 1101
77 Ga0209050_1001670 3300025298 Bacteria 22344
78 Ga0207656_10299183 3300025321 Bacteria 796
79 Ga0207647_10021772 3300025904 Bacteria 4272
80 Ga0207647_10528670 3300025904 Bacteria 656
81 Ga0207645_10003619 3300025907 Bacteria 11686
82 Ga0207705_10141086 3300025909 Bacteria 1799
83 Ga0207705_10457204 3300025909 Bacteria 990
84 Ga0207707_10165209 3300025912 Bacteria 1934
85 Ga0207695_10240050 3300025913 Bacteria 1714
86 Ga0207695_10602126 3300025913 Bacteria 980
87 Ga0207657_10015341 3300025919 Bacteria 7425
88 Ga0207657_10020949 3300025919 Bacteria 6169
89 Ga0207649_10808918 3300025920 Bacteria 732
90 Ga0207650_10474107 3300025925 Bacteria 1044
91 Ga0207664_10070432 3300025929 Bacteria 2814
92 Ga0207664_10530227 3300025929 Bacteria 1056
93 Ga0207690_10081023 3300025932 Bacteria 2267
94 Ga0207706_10009677 3300025933 Bacteria 8847
95 Ga0207706_10090168 3300025933 Bacteria 2696
96 Ga0207706_10133491 3300025933 Bacteria 2183
97 Ga0207689_11070680 3300025942 Bacteria 680
98 Ga0207679_10107487 3300025945 Bacteria 2195
99 Ga0207679_10660001 3300025945 Bacteria 946
100 Ga0207667_10066654 3300025949 Bacteria 3752
101 Ga0207667_10084486 3300025949 Bacteria 3286
102 Ga0207651_10813829 3300025960 Bacteria 829
103 Ga0207651_11373365 3300025960 Bacteria 636
104 Ga0207712_10122261 3300025961 Bacteria 1971
105 Ga0207668_10179127 3300025972 Bacteria 1670
106 Ga0207640_10104545 3300025981 Bacteria 1993
107 Ga0207640_10695373 3300025981 Bacteria 871
108 Ga0207640_11224632 3300025981 Bacteria 668
109 Ga0207658_10002577 3300025986 Bacteria 13166
110 Ga0207658_10400458 3300025986 Bacteria 1206
111 Ga0207658_10460272 3300025986 Bacteria 1127
112 Ga0207677_10096816 3300026023 Bacteria 2160
113 Ga0207703_11104184 3300026035 Bacteria 762
114 Ga0207639_10925636 3300026041 Bacteria 815
115 Ga0207678_10003201 3300026067 Bacteria 14809
116 Ga0207678_10066884 3300026067 Bacteria 3085
117 Ga0207678_10353044 3300026067 Bacteria 1268
118 Ga0207702_11482580 3300026078 Bacteria 672
119 Ga0207641_10008977 3300026088 Bacteria 8258
120 Ga0207641_11238599 3300026088 Bacteria 746
121 Ga0207676_10061797 3300026095 Bacteria 2968
122 Ga0207674_10280162 3300026116 Bacteria 1615
123 Ga0209371_1028932 3300027312 Bacteria 1230
124 Ga0209974_10017810 3300027876 Bacteria 2355
125 Ga0268266_10000452 3300028379 Bacteria 60195
126 Ga0268266_10052488 3300028379 Bacteria 3501
127 Ga0268265_10104175 3300028380 Bacteria 2299
128 Ga0268264_10033116 3300028381 Bacteria 4243
129 Ga0268256_1031766 3300030500 Bacteria 1264
130 Ga0307405_10011250 3300031731 Bacteria 4678
131 Ga0316577_10203800 3300031733 Bacteria 1118
132 Ga0307413_10078004 3300031824 Bacteria 2112
133 Ga0307413_10687547 3300031824 Bacteria 848
134 Ga0307410_10736717 3300031852 Bacteria 833
135 Ga0307407_10622927 3300031903 Bacteria 805
136 Ga0307412_10061239 3300031911 Bacteria 2529
137 Ga0307412_10092414 3300031911 Bacteria 2120
138 Ga0307409_100622673 3300031995 Bacteria 1069
139 Ga0307416_101883540 3300032002 Bacteria 701
140 Ga0307414_10425879 3300032004 Bacteria 1158
141 Ga0307411_10173071 3300032005 Bacteria 1630
142 Ga0373951_0261133 3300035091 Bacteria 523
143 Ga0373942_0146128 3300035207 Bacteria 756
144 Ga0316584_0377950 3300036712 Bacteria 1013
145 Ga0395899_0023834 3300037312 Bacteria 4630
146 Ga0395899_0204867 3300037312 Bacteria 1373
147 Ga0395899_0315460 3300037312 Bacteria 1054
148 Ga0395900_0125224 3300037418 Bacteria 2635
149 Ga0395900_0225753 3300037418 Bacteria 1885
150 Ga0395900_0512472 3300037418 Bacteria 1148
151 Ga0395900_1065787 3300037418 Bacteria 726
152 Ga0395900_1160383 3300037418 Bacteria 688
153 Ga0395900_1769707 3300037418 Bacteria 528
154 Ga0395898_0356341 3300037466 Bacteria 1395
155 Ga0395898_0699301 3300037466 Bacteria 955
156 Ga0395898_0808665 3300037466 Bacteria 877
157 Ga0395898_0923320 3300037466 Bacteria 810
158 Ga0395898_1423354 3300037466 Bacteria 620
159 Ga0395905_0110988 3300037471 Bacteria 2575
160 Ga0395905_0180402 3300037471 Bacteria 1982
161 Ga0395905_0271542 3300037471 Bacteria 1581
162 Ga0395905_0542859 3300037471 Bacteria 1063
163 Ga0395905_0910106 3300037471 Bacteria 782
164 Ga0395901_0125113 3300038443 Bacteria 2701
165 Ga0395901_0353824 3300038443 Bacteria 1515
166 Ga0395901_0498126 3300038443 Bacteria 1240
167 Ga0451793_0935589 3300041452 Bacteria 954
168 Ga0451798_0491205 3300041458 Bacteria 826
169 Ga0451800_0167293 3300041459 Bacteria 1181
170 Ga0451806_496174 3300041462 Bacteria 4328
171 Ga0451807_0049711 3300041486 Bacteria 1889
172 Ga0451853_3229803 3300041512 Bacteria 1442
173 Ga0451577_1185321 3300042876 Bacteria 681
174 Ga0466966_0240541 3300044684 Bacteria 1091
175 Ga0466961_0161911 3300044693 Bacteria 1394
176 Ga0466971_0131185 3300044719 Bacteria 1163
177 Ga0466970_0138913 3300044765 Bacteria 1338
178 Ga0466970_0172721 3300044765 Bacteria 1198
179 Ga0466957_0093945 3300044842 Bacteria 1883
180 Ga0466959_0088056 3300045049 Bacteria 2232
181 Ga0451576_0015664 3300045051 Bacteria 8393
182 Ga0466967_0097081 3300045976 Bacteria 2689
183 Ga0495585_0561421 3300046492 Bacteria 539
184 Ga0495596_0000226 3300046500 Bacteria 38225
185 Ga0495596_0006467 3300046500 Bacteria 5386
186 Ga0495607_0036954 3300046501 Bacteria 2937
187 Ga0495607_0053647 3300046501 Bacteria 2328
188 Ga0495606_0021176 3300046507 Bacteria 4766
189 Ga0495610_0001472 3300046512 Bacteria 20775
190 Ga0495610_0270763 3300046512 Bacteria 665
191 Ga0495632_0154256 3300046519 Bacteria 1060
192 Ga0495643_0007291 3300046522 Bacteria 7146
193 Ga0495643_0018983 3300046522 Bacteria 3982
194 Ga0495643_0029142 3300046522 Bacteria 3090
195 Ga0495663_0080139 3300046525 Bacteria 1051
196 Ga0495609_0008026 3300046538 Bacteria 5205
197 Ga0495633_0213984 3300046558 Bacteria 883
198 Ga0495625_0008817 3300046660 Bacteria 8537
199 Ga0495669_0000952 3300046684 Bacteria 12081
200 Ga0495669_0105333 3300046684 Bacteria 1313
201 Ga0495669_0147812 3300046684 Bacteria 1111
202 Ga0495671_0020164 3300046692 Bacteria 3515
203 Ga0495671_0389091 3300046692 Bacteria 668
204 Ga0495677_0058749 3300047445 Bacteria 1423
205 Ga0495686_0468208 3300047472 Bacteria 667
206 Ga0495615_0000117 3300048090 Bacteria 20233
207 Ga0495626_0000346 3300048091 Bacteria 48769
208 Ga0496101_0329952 3300048904 Bacteria 1197
209 Ga0496106_0330489 3300048909 Bacteria 1224
210 Ga0496107_0696427 3300048910 Bacteria 747
211 Ga0496116_0000045 3300048919 Bacteria 324307
212 Ga0496117_0097250 3300048920 Bacteria 1876
213 Ga0496118_0053319 3300048921 Bacteria 3076
214 Ga0496121_0005907 3300048924 Bacteria 15492
215 Ga0496122_0006402 3300048925 Bacteria 13530
216 Ga0496122_0006623 3300048925 Bacteria 13212
217 Ga0496123_0000731 3300048926 Bacteria 53394
218 Ga0496123_0002684 3300048926 Bacteria 21413
219 Ga0496124_0011834 3300048927 Bacteria 8688
220 Ga0496124_0013223 3300048927 Bacteria 8072
221 Ga0496124_0441045 3300048927 Bacteria 891
222 Ga0496125_0021209 3300048928 Bacteria 6068
223 Ga0496126_0000568 3300048929 Bacteria 70707
224 Ga0501034_0174045 3300049571 Bacteria 2119
225 Ga0501047_0094836 3300049581 Bacteria 2863
226 Ga0501067_0228919 3300049583 Bacteria 1035
227 Ga0501216_066030 3300049660 Bacteria 739
228 Ga0501080_0309156 3300049742 Bacteria 1433
229 Ga0501083_0703417 3300049744 Bacteria 657
230 Ga0501267_007132 3300049764 Bacteria 1084
231 nmdc:mga00v17_376300_c1 3300050491 Bacteria 923
232 nmdc:mga00v17_43365_c1 3300050491 Bacteria 2709
233 nmdc:mga00v17_785123_c1 3300050491 Bacteria 607
234 nmdc:mga0sz30_102712_c2 3300050516 Bacteria 618
235 Ga0500641_0061543 3300053096 Bacteria 1564
236 Ga0500564_155352 3300053138 Bacteria 972
237 Ga0500588_0145805 3300053146 Bacteria 853
238 Ga0500661_041056 3300055283 Bacteria 820
239 Ga0466962_0137064 3300061719 Bacteria 1184
240 2819551305 2818991438 Bacteria 5793701
241 8054305407 8054302542 Bacteria 5698134
242 Ga0307407_10122521
243 JGI24737J22298_10100150
244 JGI24738J21930_10038135
245 JGI24751J29686_10075463
246 Ga0055530_10016059
247 Ga0070658_10017940
248 Ga0070658_10537689
249 Ga0070676_10034488
250 Ga0070670_100747530
251 Ga0070670_101050625
252 Ga0070666_10018501
253 Ga0070666_10133578
254 Ga0070680_100392027
255 Ga0070660_100003366
256 Ga0070691_10245518
257 Ga0070661_100082969
258 Ga0070668_100239921
259 Ga0070668_100485207
260 Ga0070671_100121464
261 Ga0070673_100352448
262 Ga0070673_100753185
263 Ga0070659_100239030
264 Ga0070659_100500220
265 Ga0070667_100000126
266 Ga0070667_100006431
267 Ga0070667_100126475
268 Ga0070714_100079660
269 Ga0070714_100371594
270 Ga0070714_100624830
271 Ga0070663_100040329
272 Ga0070663_100126930
273 Ga0070663_100312068
274 Ga0070662_100014196
275 Ga0070662_100298432
276 Ga0070681_10237441
277 Ga0070685_10039987
278 Ga0070679_100868369
279 Ga0068853_101218173
280 Ga0070686_101540178
281 Ga0070693_100538496
282 Ga0070665_100001399
283 Ga0070665_100006491
284 Ga0068855_100207376
285 Ga0068855_100589054
286 Ga0070664_100117344
287 Ga0068854_100135710
288 Ga0068854_100202949
289 Ga0068854_100883509
290 Ga0068856_100045938
291 Ga0068856_101408367
292 Ga0068856_101535386
293 Ga0068852_100052185
294 Ga0068852_100102474
295 Ga0068851_10028335
296 Ga0068851_10116532
297 Ga0068860_100046120
298 Ga0068862_100021127
299 Ga0075364_10092652
300 Ga0075364_10804335
301 Ga0075369_10342874
302 Ga0068871_100809123
303 Ga0105240_10296438
304 Ga0105240_11242736
305 Ga0105248_11660547
306 Ga0157373_10067400
307 Ga0157373_10086288
308 Ga0157371_10029687
309 Ga0157371_10560905
310 Ga0157370_10272471
311 Ga0157370_10698629
312 Ga0157370_11297037
313 Ga0157369_10291323
314 Ga0157372_10136173
315 Ga0157372_10330094
316 Ga0157372_11004540
317 Ga0182008_10169808
318 Ga0209050_1001670
319 Ga0207656_10299183
320 Ga0207647_10021772
321 Ga0207647_10528670
322 Ga0207645_10003619
323 Ga0207705_10141086
324 Ga0207705_10457204
325 Ga0207707_10165209
326 Ga0207695_10240050
327 Ga0207695_10602126
328 Ga0207657_10015341
329 Ga0207657_10020949
330 Ga0207649_10808918
331 Ga0207650_10474107
332 Ga0207664_10070432
333 Ga0207664_10530227
334 Ga0207690_10081023
335 Ga0207706_10009677
336 Ga0207706_10090168
337 Ga0207706_10133491
338 Ga0207689_11070680
339 Ga0207679_10107487
340 Ga0207679_10660001
341 Ga0207667_10066654
342 Ga0207667_10084486
343 Ga0207651_10813829
344 Ga0207651_11373365
345 Ga0207712_10122261
346 Ga0207668_10179127
347 Ga0207640_10104545
348 Ga0207640_10695373
349 Ga0207640_11224632
350 Ga0207658_10002577
351 Ga0207658_10400458
352 Ga0207658_10460272
353 Ga0207677_10096816
354 Ga0207703_11104184
355 Ga0207639_10925636
356 Ga0207678_10003201
357 Ga0207678_10066884
358 Ga0207678_10353044
359 Ga0207702_11482580
360 Ga0207641_10008977
361 Ga0207641_11238599
362 Ga0207676_10061797
363 Ga0207674_10280162
364 Ga0209371_1028932
365 Ga0209974_10017810
366 Ga0268266_10000452
367 Ga0268266_10052488
368 Ga0268265_10104175
369 Ga0268264_10033116
370 Ga0268256_1031766
371 Ga0307405_10011250
372 Ga0316577_10203800
373 Ga0307413_10078004
374 Ga0307413_10687547
375 Ga0307410_10736717
376 Ga0307407_10622927
377 Ga0307412_10061239
378 Ga0307412_10092414
379 Ga0307409_100622673
380 Ga0307416_101883540
381 Ga0307414_10425879
382 Ga0307411_10173071
383 Ga0373951_0261133
384 Ga0373942_0146128
385 Ga0316584_0377950
386 Ga0395899_0023834
387 Ga0395899_0204867
388 Ga0395899_0315460
389 Ga0395900_0125224
390 Ga0395900_0225753
391 Ga0395900_0512472
392 Ga0395900_1065787
393 Ga0395900_1160383
394 Ga0395900_1769707
395 Ga0395898_0356341
396 Ga0395898_0699301
397 Ga0395898_0808665
398 Ga0395898_0923320
399 Ga0395898_1423354
400 Ga0395905_0110988
401 Ga0395905_0180402
402 Ga0395905_0271542
403 Ga0395905_0542859
404 Ga0395905_0910106
405 Ga0395901_0125113
406 Ga0395901_0353824
407 Ga0395901_0498126
408 Ga0451793_0935589
409 Ga0451798_0491205
410 Ga0451800_0167293
411 Ga0451806_496174
412 Ga0451807_0049711
413 Ga0451853_3229803
414 Ga0451577_1185321
415 Ga0466966_0240541
416 Ga0466961_0161911
417 Ga0466971_0131185
418 Ga0466970_0138913
419 Ga0466970_0172721
420 Ga0466957_0093945
421 Ga0466959_0088056
422 Ga0451576_0015664
423 Ga0466967_0097081
424 Ga0495585_0561421
425 Ga0495596_0000226
426 Ga0495596_0006467
427 Ga0495607_0036954
428 Ga0495607_0053647
429 Ga0495606_0021176
430 Ga0495610_0001472
431 Ga0495610_0270763
432 Ga0495632_0154256
433 Ga0495643_0007291
434 Ga0495643_0018983
435 Ga0495643_0029142
436 Ga0495663_0080139
437 Ga0495609_0008026
438 Ga0495633_0213984
439 Ga0495625_0008817
440 Ga0495669_0000952
441 Ga0495669_0105333
442 Ga0495669_0147812
443 Ga0495671_0020164
444 Ga0495671_0389091
445 Ga0495677_0058749
446 Ga0495686_0468208
447 Ga0495615_0000117
448 Ga0495626_0000346
449 Ga0496101_0329952
450 Ga0496106_0330489
451 Ga0496107_0696427
452 Ga0496116_0000045
453 Ga0496117_0097250
454 Ga0496118_0053319
455 Ga0496121_0005907
456 Ga0496122_0006402
457 Ga0496122_0006623
458 Ga0496123_0000731
459 Ga0496123_0002684
460 Ga0496124_0011834
461 Ga0496124_0013223
462 Ga0496124_0441045
463 Ga0496125_0021209
464 Ga0496126_0000568
465 Ga0501034_0174045
466 Ga0501047_0094836
467 Ga0501067_0228919
468 Ga0501216_066030
469 Ga0501080_0309156
470 Ga0501083_0703417
471 Ga0501267_007132
472 nmdc:mga00v17_376300_c1
473 nmdc:mga00v17_43365_c1
474 nmdc:mga00v17_785123_c1
475 nmdc:mga0sz30_102712_c2
476 Ga0500641_0061543
477 Ga0500564_155352
478 Ga0500588_0145805
479 Ga0500661_041056
480 Ga0466962_0137064
481 2819551305
482 8054305407

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13430

DUF4112

Domain of unknown function (DUF4112)

29

132

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fs1-assembly1.cif.gz_A solution structure of psd-1 0.611 55 111
2fs1-assembly1.cif.gz_A solution structure of psd-1 0.5708 55 111
7x7p-assembly1.cif.gz_B cryoem structure of dsdna-ruvb-ruva domain3 complex 0.522 65 108
7x7p-assembly1.cif.gz_B cryoem structure of dsdna-ruvb-ruva domain3 complex 0.4799 65 108
4jbe-assembly1.cif.gz_A 1.95 angstrom crystal structure of gamma-glutamyl phosphate reductase from saccharomonospora viridis. 0.3541 19 105
ID Description Score Start End Superfamily
af_P08032_472_579_1.20.58.60 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.4149 19 115 1.20.58.60
af_A0A2R8Q420_207_301_1.20.58.160 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.4121 19 114 1.20.58.160
af_Q9UJY5_210_314_1.20.58.160 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.3922 19 121 1.20.58.160
af_Q9UPN3_6336_6445_1.20.58.60 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.384 22 115 1.20.58.60
af_A0A2R8Q420_207_301_1.20.58.160 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.3755 19 114 1.20.58.160
ID Description Score Start End GO Terms
AF-A0A1I2JPY4-F1-model_v4 DUF4112 domain-containing protein 0.7937 19 110 GO:0016020
AF-A0A7Y3JP44-F1-model_v4 DUF4112 domain-containing protein 0.7933 19 120 GO:0016020
AF-A0A0Q4C9M9-F1-model_v4 DUF4112 domain-containing protein 0.7846 15 119 GO:0016020
AF-A0A2U0SE30-F1-model_v4 DUF4112 domain-containing protein 0.7697 15 119 GO:0016020
AF-A0A838L458-F1-model_v4 DUF4112 domain-containing protein 0.7684 14 124 GO:0016020

Map