F353885

General Info

Members Datasets Scaffolds Average Seq Length
241 167 482 65

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10001934|Ga0265338_100019344
Length 65
Sequence MEVVIDQERCIAAGQCVAAAPDVFDQRDEDGVVVLMKAFPGSADEEEGARQAAAVCPAQAIQVLG

Samples

Sample ID Description Type Environment
1 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
21 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
22 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
25 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
26 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
27 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
28 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
29 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
30 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
31 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
50 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
51 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
52 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
53 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
54 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
55 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
56 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
57 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
58 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
59 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
60 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
61 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
62 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
63 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
64 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
65 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
66 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
67 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
68 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
69 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
70 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
71 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
72 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
73 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
74 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
75 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
76 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
77 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
78 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
79 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
80 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
81 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
82 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
83 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
84 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
85 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
86 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
87 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
88 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
89 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
90 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
91 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
92 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
93 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
94 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
95 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
96 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
97 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
98 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
99 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
100 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
101 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
102 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
103 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
104 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
105 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
106 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
107 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
108 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
109 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
110 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
111 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
112 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
113 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
114 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
115 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
116 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
117 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
118 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
119 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
120 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
121 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
122 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
123 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
124 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
125 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
126 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
127 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
128 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
129 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
130 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
131 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
132 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
133 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
134 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
135 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
136 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
139 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
140 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
141 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
142 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
143 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
144 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
145 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
146 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
147 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
148 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
149 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
150 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
151 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
152 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
153 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
154 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
155 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
156 2508501039 Frankia saprophytica CN3 Isolate Nodule
157 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
158 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
159 2643221714 Streptomyces sp. Root264 Isolate Unclassified
160 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
161 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
162 2867475112 Streptomyces sp. TM32 Isolate Unclassified
163 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
164 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
165 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
166 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
167 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.61
Metatranscriptomes 0
Isolates 5.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.47
Nodule 1.66
Rhizoplane 1.24
Rhizosphere 65.56
Stem 0
Stem Tuber 0
Unclassified 0.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265338_10001934 3300028800 Bacteria 32315
2 JGI24735J21928_10107087 3300002067 Bacteria 803
3 rootH2_10065694 3300003320 Bacteria 2609
4 JGI25160J50197_1009851 3300003354 Bacteria 3505
5 JGI25160J50197_1012327 3300003354 Bacteria 2974
6 Ga0065714_10065566 3300005288 Bacteria 9371
7 Ga0070659_101260672 3300005366 Bacteria 655
8 Ga0070659_102121216 3300005366 Bacteria 505
9 Ga0070709_10460988 3300005434 Bacteria 959
10 Ga0070714_100049207 3300005435 Bacteria 3588
11 Ga0070714_100154293 3300005435 Bacteria 2072
12 Ga0070714_100197775 3300005435 Bacteria 1838
13 Ga0070714_100664224 3300005435 Bacteria 1004
14 Ga0070714_100715463 3300005435 Bacteria 967
15 Ga0070713_100170596 3300005436 Bacteria 1949
16 Ga0070713_100346795 3300005436 Bacteria 1377
17 Ga0070713_100379025 3300005436 Bacteria 1317
18 Ga0070713_100776593 3300005436 Bacteria 917
19 Ga0070713_101131554 3300005436 Bacteria 757
20 Ga0070710_10000040 3300005437 Bacteria 60294
21 Ga0070710_10000103 3300005437 Bacteria 39384
22 Ga0070710_10407347 3300005437 Bacteria 913
23 Ga0070678_100157928 3300005456 Bacteria 1834
24 Ga0070706_102118888 3300005467 Bacteria 508
25 Ga0068853_100012293 3300005539 Bacteria 6961
26 Ga0070672_100365722 3300005543 Bacteria 1232
27 Ga0068855_100916463 3300005563 Bacteria 925
28 Ga0068855_101943926 3300005563 Bacteria 595
29 Ga0068857_100139620 3300005577 Bacteria 2190
30 Ga0068852_100284154 3300005616 Bacteria 1596
31 Ga0068858_100517297 3300005842 Bacteria 1154
32 Ga0081455_10085489 3300005937 Bacteria 2572
33 Ga0070716_100180617 3300006173 Bacteria 1385
34 Ga0070712_100558120 3300006175 Bacteria 965
35 Ga0070712_101540203 3300006175 Unclassified 581
36 Ga0105244_10000100 3300009036 Bacteria 89219
37 Ga0105245_10287832 3300009098 Bacteria 1608
38 Ga0105243_11079884 3300009148 Bacteria 810
39 Ga0105243_11215609 3300009148 Bacteria 767
40 Ga0105242_11524098 3300009176 Bacteria 700
41 Ga0105238_10043960 3300009551 Bacteria 4518
42 Ga0105238_11601727 3300009551 Bacteria 681
43 Ga0105246_10008405 3300011119 Bacteria 6345
44 Ga0105246_10038672 3300011119 Bacteria 3209
45 Ga0157322_1041056 3300012490 Bacteria 531
46 Ga0157376_12373693 3300014969 Bacteria 570
47 Ga0207426_1001851 3300025302 Bacteria 15532
48 Ga0207426_1003156 3300025302 Bacteria 9345
49 Ga0207697_10081054 3300025315 Bacteria 1367
50 Ga0207655_1000238 3300025728 Bacteria 90306
51 Ga0207692_10000070 3300025898 Bacteria 29852
52 Ga0207692_10134391 3300025898 Bacteria 1400
53 Ga0207688_10311622 3300025901 Bacteria 964
54 Ga0207647_10224286 3300025904 Bacteria 1082
55 Ga0207693_10034913 3300025915 Bacteria 3966
56 Ga0207693_11460045 3300025915 Bacteria 506
57 Ga0207663_10918769 3300025916 Bacteria 700
58 Ga0207694_10513748 3300025924 Bacteria 1004
59 Ga0207687_10088083 3300025927 Bacteria 2258
60 Ga0207700_10259023 3300025928 Bacteria 1489
61 Ga0207700_10572028 3300025928 Bacteria 1004
62 Ga0207700_11135059 3300025928 Bacteria 698
63 Ga0207700_11164071 3300025928 Bacteria 689
64 Ga0207664_10073000 3300025929 Bacteria 2768
65 Ga0207664_10118642 3300025929 Bacteria 2210
66 Ga0207664_10379012 3300025929 Bacteria 1256
67 Ga0207664_10379142 3300025929 Bacteria 1255
68 Ga0207664_11110503 3300025929 Bacteria 707
69 Ga0207690_10393328 3300025932 Bacteria 1104
70 Ga0207709_10340146 3300025935 Bacteria 1129
71 Ga0207709_10576396 3300025935 Bacteria 888
72 Ga0207691_10443092 3300025940 Bacteria 1106
73 Ga0207667_10732994 3300025949 Bacteria 989
74 Ga0207639_10479608 3300026041 Bacteria 1133
75 Ga0207674_10239440 3300026116 Bacteria 1762
76 Ga0207683_10369611 3300026121 Bacteria 1317
77 Ga0265337_1000344 3300028556 Bacteria 24844
78 Ga0265326_10001175 3300028558 Bacteria 9348
79 Ga0265319_1001002 3300028563 Bacteria 17683
80 Ga0265334_10000352 3300028573 Bacteria 24678
81 Ga0265323_10009447 3300028653 Bacteria 3984
82 Ga0265322_10010993 3300028654 Bacteria 2625
83 Ga0265336_10030546 3300028666 Bacteria 1677
84 Ga0307517_10125718 3300028786 Bacteria 1872
85 Ga0307515_10033014 3300028794 Bacteria 8542
86 Ga0307515_10037351 3300028794 Bacteria 7813
87 Ga0307515_10038516 3300028794 Bacteria 7644
88 Ga0307515_10137823 3300028794 Bacteria 2638
89 Ga0307515_10386440 3300028794 Bacteria 1030
90 Ga0307515_10620919 3300028794 Bacteria 692
91 Ga0265338_10002405 3300028800 Bacteria 28155
92 Ga0265338_10005044 3300028800 Bacteria 17431
93 Ga0265324_10003401 3300029957 Bacteria 7601
94 Ga0307511_10000113 3300030521 Bacteria 72975
95 Ga0307511_10000762 3300030521 Bacteria 34343
96 Ga0307511_10000807 3300030521 Bacteria 33428
97 Ga0307511_10001319 3300030521 Bacteria 26352
98 Ga0307511_10009553 3300030521 Bacteria 9660
99 Ga0307511_10034509 3300030521 Bacteria 4437
100 Ga0307511_10067211 3300030521 Bacteria 2662
101 Ga0307512_10016119 3300030522 Bacteria 6902
102 Ga0307512_10138374 3300030522 Bacteria 1499
103 Ga0316176_1025029 3300030732 Bacteria 767
104 Ga0314311_1117117 3300030733 Bacteria 1523
105 Ga0314311_1172633 3300030733 Bacteria 1006
106 Ga0316182_1243581 3300030745 Bacteria 1062
107 Ga0265332_10000856 3300031238 Bacteria 18431
108 Ga0265320_10004318 3300031240 Bacteria 9339
109 Ga0265325_10020871 3300031241 Bacteria 3606
110 Ga0265340_10003361 3300031247 Bacteria 9050
111 Ga0265339_10102436 3300031249 Bacteria 1488
112 Ga0265316_10008416 3300031344 Bacteria 9579
113 Ga0307513_10001869 3300031456 Bacteria 29929
114 Ga0307513_10081733 3300031456 Bacteria 3328
115 Ga0307513_10095015 3300031456 Bacteria 3024
116 Ga0307513_10096044 3300031456 Bacteria 3003
117 Ga0307513_10202562 3300031456 Bacteria 1824
118 Ga0307513_10215114 3300031456 Bacteria 1749
119 Ga0307513_11004896 3300031456 Bacteria 544
120 Ga0307509_10006218 3300031507 Bacteria 16155
121 Ga0307509_10095679 3300031507 Bacteria 3024
122 Ga0265313_10004006 3300031595 Bacteria 11530
123 Ga0307508_10008136 3300031616 Bacteria 9719
124 Ga0307508_10016328 3300031616 Bacteria 6759
125 Ga0307508_10031476 3300031616 Bacteria 4795
126 Ga0307508_10055414 3300031616 Bacteria 3512
127 Ga0307514_10062215 3300031649 Bacteria 2839
128 Ga0307514_10100265 3300031649 Bacteria 2082
129 Ga0265314_10105544 3300031711 Bacteria 1801
130 Ga0265342_10001468 3300031712 Bacteria 21929
131 Ga0307516_10009961 3300031730 Bacteria 10524
132 Ga0307516_10150645 3300031730 Bacteria 2087
133 Ga0307518_10024807 3300031838 Bacteria 4319
134 Ga0307518_10052305 3300031838 Bacteria 2967
135 Ga0307518_10093737 3300031838 Bacteria 2157
136 Ga0307518_10337429 3300031838 Bacteria 887
137 Ga0307406_10962652 3300031901 Bacteria 730
138 Ga0307411_11556246 3300032005 Bacteria 609
139 Ga0307507_10000003 3300033179 Bacteria 371707
140 Ga0307507_10044477 3300033179 Bacteria 4387
141 Ga0307510_10004307 3300033180 Bacteria 16748
142 Ga0307510_10013857 3300033180 Bacteria 9554
143 Ga0307510_10059671 3300033180 Bacteria 3936
144 Ga0307510_10256464 3300033180 Bacteria 1232
145 Ga0307510_10342495 3300033180 Bacteria 947
146 Ga0373940_0014733 3300035088 Bacteria 1912
147 Ga0373941_0324718 3300035115 Bacteria 620
148 Ga0373942_0000036 3300035207 Bacteria 25374
149 Ga0373962_0245324 3300035242 Bacteria 620
150 Ga0373931_0816502 3300035691 Bacteria 623
151 Ga0439436_0014037 3300041404 Bacteria 2421
152 Ga0439438_067537 3300041405 Bacteria 888
153 Ga0439439_0007884 3300041406 Bacteria 2501
154 Ga0451791_1591758 3300041451 Bacteria 637
155 Ga0451797_0649888 3300041453 Bacteria 957
156 Ga0451845_0012346 3300041501 Bacteria 836
157 Ga0451851_0736906 3300041507 Bacteria 742
158 Ga0451853_0305694 3300041512 Bacteria 1292
159 Ga0451853_0372205 3300041512 Bacteria 886
160 Ga0451853_1348786 3300041512 Bacteria 3346
161 Ga0439442_056972 3300042002 Bacteria 826
162 Ga0439449_0006170 3300042007 Bacteria 4581
163 Ga0439449_0040035 3300042007 Bacteria 1742
164 Ga0439457_001543 3300042014 Bacteria 6906
165 Ga0439457_098616 3300042014 Bacteria 680
166 Ga0439462_0237094 3300042015 Bacteria 523
167 Ga0450906_029503 3300042145 Bacteria 970
168 Ga0450907_006270 3300042146 Bacteria 1989
169 Ga0466969_0008763 3300044656 Bacteria 5361
170 Ga0466969_0013884 3300044656 Bacteria 4239
171 Ga0466965_0052481 3300044683 Bacteria 2025
172 Ga0466966_0002071 3300044684 Bacteria 13006
173 Ga0466961_0004225 3300044693 Bacteria 8990
174 Ga0466971_0199758 3300044719 Bacteria 943
175 Ga0466970_0003956 3300044765 Bacteria 7264
176 Ga0466970_0009015 3300044765 Bacteria 5033
177 Ga0466959_0090009 3300045049 Bacteria 2204
178 Ga0466959_0750729 3300045049 Bacteria 653
179 Ga0495592_0073272 3300046454 Bacteria 2490
180 Ga0495603_0161585 3300046455 Bacteria 1299
181 Ga0495629_0767600 3300046459 Bacteria 637
182 Ga0495651_0152599 3300046462 Bacteria 1663
183 Ga0495580_0090625 3300046472 Bacteria 2129
184 Ga0495594_0716593 3300046499 Bacteria 565
185 Ga0495618_0028461 3300046514 Bacteria 3482
186 Ga0495628_0016174 3300046516 Bacteria 6224
187 Ga0495632_0061718 3300046519 Bacteria 1819
188 Ga0495652_0021781 3300046529 Bacteria 5698
189 Ga0495640_0633434 3300046533 Bacteria 644
190 Ga0495667_0117109 3300046559 Bacteria 1721
191 Ga0495625_0022430 3300046660 Bacteria 4841
192 Ga0495635_0018588 3300046663 Bacteria 4848
193 Ga0495657_0619561 3300046675 Bacteria 625
194 Ga0495657_0622691 3300046675 Bacteria 623
195 Ga0495613_0010241 3300046689 Bacteria 6965
196 Ga0495613_0042651 3300046689 Bacteria 3356
197 Ga0495589_0284124 3300046794 Bacteria 769
198 Ga0495604_0022135 3300047317 Bacteria 5073
199 Ga0495680_0010767 3300047322 Bacteria 8146
200 Ga0495687_021246 3300047443 Bacteria 3145
201 Ga0495675_0328739 3300047444 Bacteria 903
202 Ga0495593_0512904 3300047673 Bacteria 601
203 Ga0495602_0160180 3300048088 Bacteria 1758
204 Ga0495614_0135962 3300048089 Bacteria 1090
205 Ga0496112_0295456 3300048915 Bacteria 1566
206 Ga0496117_0291563 3300048920 Bacteria 868
207 Ga0496120_0447218 3300048923 Bacteria 563
208 Ga0501034_0013683 3300049571 Bacteria 8342
209 Ga0501046_0257876 3300049580 Bacteria 1282
210 Ga0501080_0377914 3300049742 Bacteria 1277
211 Ga0501044_0101285 3300049823 Bacteria 2898
212 nmdc:mga0yw44_331920_c1 3300050492 Bacteria 1022
213 Ga0495655_0088386 3300053083 Bacteria 899
214 Ga0495619_1084732 3300053085 Bacteria 533
215 Ga0500644_0023348 3300053088 Bacteria 1878
216 Ga0500646_0118462 3300053090 Bacteria 849
217 Ga0500651_0125066 3300053093 Bacteria 1558
218 Ga0500641_0028548 3300053096 Bacteria 2180
219 Ga0500650_0192453 3300053098 Bacteria 931
220 Ga0500654_121865 3300053099 Bacteria 1022
221 Ga0500560_039273 3300053107 Bacteria 1476
222 Ga0500569_219991 3300053109 Bacteria 645
223 Ga0500594_0004197 3300053118 Bacteria 3178
224 Ga0500621_179662 3300053126 Bacteria 768
225 Ga0500600_0278136 3300053149 Bacteria 731
226 Ga0500600_0334303 3300053149 Bacteria 631
227 Ga0500630_123170 3300053159 Bacteria 1145
228 Ga0466962_0095898 3300061719 Bacteria 1422
229 2508675181 2508501039 Bacteria 9978592
230 2508675186 2508501039 Bacteria 9978592
231 2585314730 2582581314 Bacteria 11452267
232 2616702501 2616644814 Bacteria 11555299
233 2644630935 2643221714 Bacteria 9015452
234 2738696039 2738541272 Bacteria 6848551
235 2862383251 2862382967 Bacteria 10317375
236 2867476574 2867475112 Bacteria 6909112
237 2990088213 2990088156 Bacteria 6657676
238 2995465249 2995463766 Bacteria 8577691
239 8008564399 8008558824 Bacteria 10610750
240 8047719937 8047710418 Bacteria 11023148
241 8056209162 8056207758 Bacteria 8639239
242 Ga0265338_10001934
243 JGI24735J21928_10107087
244 rootH2_10065694
245 JGI25160J50197_1009851
246 JGI25160J50197_1012327
247 Ga0065714_10065566
248 Ga0070659_101260672
249 Ga0070659_102121216
250 Ga0070709_10460988
251 Ga0070714_100049207
252 Ga0070714_100154293
253 Ga0070714_100197775
254 Ga0070714_100664224
255 Ga0070714_100715463
256 Ga0070713_100170596
257 Ga0070713_100346795
258 Ga0070713_100379025
259 Ga0070713_100776593
260 Ga0070713_101131554
261 Ga0070710_10000040
262 Ga0070710_10000103
263 Ga0070710_10407347
264 Ga0070678_100157928
265 Ga0070706_102118888
266 Ga0068853_100012293
267 Ga0070672_100365722
268 Ga0068855_100916463
269 Ga0068855_101943926
270 Ga0068857_100139620
271 Ga0068852_100284154
272 Ga0068858_100517297
273 Ga0081455_10085489
274 Ga0070716_100180617
275 Ga0070712_100558120
276 Ga0070712_101540203
277 Ga0105244_10000100
278 Ga0105245_10287832
279 Ga0105243_11079884
280 Ga0105243_11215609
281 Ga0105242_11524098
282 Ga0105238_10043960
283 Ga0105238_11601727
284 Ga0105246_10008405
285 Ga0105246_10038672
286 Ga0157322_1041056
287 Ga0157376_12373693
288 Ga0207426_1001851
289 Ga0207426_1003156
290 Ga0207697_10081054
291 Ga0207655_1000238
292 Ga0207692_10000070
293 Ga0207692_10134391
294 Ga0207688_10311622
295 Ga0207647_10224286
296 Ga0207693_10034913
297 Ga0207693_11460045
298 Ga0207663_10918769
299 Ga0207694_10513748
300 Ga0207687_10088083
301 Ga0207700_10259023
302 Ga0207700_10572028
303 Ga0207700_11135059
304 Ga0207700_11164071
305 Ga0207664_10073000
306 Ga0207664_10118642
307 Ga0207664_10379012
308 Ga0207664_10379142
309 Ga0207664_11110503
310 Ga0207690_10393328
311 Ga0207709_10340146
312 Ga0207709_10576396
313 Ga0207691_10443092
314 Ga0207667_10732994
315 Ga0207639_10479608
316 Ga0207674_10239440
317 Ga0207683_10369611
318 Ga0265337_1000344
319 Ga0265326_10001175
320 Ga0265319_1001002
321 Ga0265334_10000352
322 Ga0265323_10009447
323 Ga0265322_10010993
324 Ga0265336_10030546
325 Ga0307517_10125718
326 Ga0307515_10033014
327 Ga0307515_10037351
328 Ga0307515_10038516
329 Ga0307515_10137823
330 Ga0307515_10386440
331 Ga0307515_10620919
332 Ga0265338_10002405
333 Ga0265338_10005044
334 Ga0265324_10003401
335 Ga0307511_10000113
336 Ga0307511_10000762
337 Ga0307511_10000807
338 Ga0307511_10001319
339 Ga0307511_10009553
340 Ga0307511_10034509
341 Ga0307511_10067211
342 Ga0307512_10016119
343 Ga0307512_10138374
344 Ga0316176_1025029
345 Ga0314311_1117117
346 Ga0314311_1172633
347 Ga0316182_1243581
348 Ga0265332_10000856
349 Ga0265320_10004318
350 Ga0265325_10020871
351 Ga0265340_10003361
352 Ga0265339_10102436
353 Ga0265316_10008416
354 Ga0307513_10001869
355 Ga0307513_10081733
356 Ga0307513_10095015
357 Ga0307513_10096044
358 Ga0307513_10202562
359 Ga0307513_10215114
360 Ga0307513_11004896
361 Ga0307509_10006218
362 Ga0307509_10095679
363 Ga0265313_10004006
364 Ga0307508_10008136
365 Ga0307508_10016328
366 Ga0307508_10031476
367 Ga0307508_10055414
368 Ga0307514_10062215
369 Ga0307514_10100265
370 Ga0265314_10105544
371 Ga0265342_10001468
372 Ga0307516_10009961
373 Ga0307516_10150645
374 Ga0307518_10024807
375 Ga0307518_10052305
376 Ga0307518_10093737
377 Ga0307518_10337429
378 Ga0307406_10962652
379 Ga0307411_11556246
380 Ga0307507_10000003
381 Ga0307507_10044477
382 Ga0307510_10004307
383 Ga0307510_10013857
384 Ga0307510_10059671
385 Ga0307510_10256464
386 Ga0307510_10342495
387 Ga0373940_0014733
388 Ga0373941_0324718
389 Ga0373942_0000036
390 Ga0373962_0245324
391 Ga0373931_0816502
392 Ga0439436_0014037
393 Ga0439438_067537
394 Ga0439439_0007884
395 Ga0451791_1591758
396 Ga0451797_0649888
397 Ga0451845_0012346
398 Ga0451851_0736906
399 Ga0451853_0305694
400 Ga0451853_0372205
401 Ga0451853_1348786
402 Ga0439442_056972
403 Ga0439449_0006170
404 Ga0439449_0040035
405 Ga0439457_001543
406 Ga0439457_098616
407 Ga0439462_0237094
408 Ga0450906_029503
409 Ga0450907_006270
410 Ga0466969_0008763
411 Ga0466969_0013884
412 Ga0466965_0052481
413 Ga0466966_0002071
414 Ga0466961_0004225
415 Ga0466971_0199758
416 Ga0466970_0003956
417 Ga0466970_0009015
418 Ga0466959_0090009
419 Ga0466959_0750729
420 Ga0495592_0073272
421 Ga0495603_0161585
422 Ga0495629_0767600
423 Ga0495651_0152599
424 Ga0495580_0090625
425 Ga0495594_0716593
426 Ga0495618_0028461
427 Ga0495628_0016174
428 Ga0495632_0061718
429 Ga0495652_0021781
430 Ga0495640_0633434
431 Ga0495667_0117109
432 Ga0495625_0022430
433 Ga0495635_0018588
434 Ga0495657_0619561
435 Ga0495657_0622691
436 Ga0495613_0010241
437 Ga0495613_0042651
438 Ga0495589_0284124
439 Ga0495604_0022135
440 Ga0495680_0010767
441 Ga0495687_021246
442 Ga0495675_0328739
443 Ga0495593_0512904
444 Ga0495602_0160180
445 Ga0495614_0135962
446 Ga0496112_0295456
447 Ga0496117_0291563
448 Ga0496120_0447218
449 Ga0501034_0013683
450 Ga0501046_0257876
451 Ga0501080_0377914
452 Ga0501044_0101285
453 nmdc:mga0yw44_331920_c1
454 Ga0495655_0088386
455 Ga0495619_1084732
456 Ga0500644_0023348
457 Ga0500646_0118462
458 Ga0500651_0125066
459 Ga0500641_0028548
460 Ga0500650_0192453
461 Ga0500654_121865
462 Ga0500560_039273
463 Ga0500569_219991
464 Ga0500594_0004197
465 Ga0500621_179662
466 Ga0500600_0278136
467 Ga0500600_0334303
468 Ga0500630_123170
469 Ga0466962_0095898
470 2508675181
471 2508675186
472 2585314730
473 2616702501
474 2644630935
475 2738696039
476 2862383251
477 2867476574
478 2990088213
479 2995465249
480 8008564399
481 8047719937
482 8056209162

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13370

Fer4_13

4Fe-4S single cluster domain of Ferredoxin I

5

63

0.91

PF13459

Fer4_15

4Fe-4S single cluster domain

3

63

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vjw-assembly1.cif.gz_A structure of oxidoreductase (nadp+(a),ferredoxin(a)) 0.9468 1 63
4id8-assembly1.cif.gz_A the crystal structure of a [3fe-4s] ferredoxin associated with cyp194a4 from r. palustris haa2 0.9323 1 64
1vjw-assembly1.cif.gz_A structure of oxidoreductase (nadp+(a),ferredoxin(a)) 0.9318 1 63
8amp-assembly1.cif.gz_A crystal structure of m.tuberculosis ferredoxin fdx 0.9304 2 64
4id8-assembly1.cif.gz_A the crystal structure of a [3fe-4s] ferredoxin associated with cyp194a4 from r. palustris haa2 0.9186 1 64
ID Description Score Start End Superfamily
1vjwA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9468 1 63 3.30.70.20
af_P71820_2_65_3.30.70.20 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9421 2 64 3.30.70.20
4id8A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9323 1 64 3.30.70.20
1vjwA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9318 1 63 3.30.70.20
af_I6X7H4_1_61_3.30.70.20 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9256 1 62 3.30.70.20
ID Description Score Start End GO Terms
AF-A0A196MLF6-F1-model_v4 Ferredoxin 1.009 1 64 GO:0046872
GO:0051536
AF-A0A4Y3VMU6-F1-model_v4 Ferredoxin 1.009 1 64 GO:0005506
GO:0009055
GO:0051538
AF-A0A7M2SD65-F1-model_v4 Ferredoxin 1.009 1 64 GO:0005506
GO:0009055
GO:0051538
AF-A0A0S1UXH9-F1-model_v4 deleted 1.009 2 63
AF-A0A7W7FJN0-F1-model_v4 deleted 1.009 2 64

Map