F353560

General Info

Members Datasets Scaffolds Average Seq Length
241 174 241 331

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10051671|Ga0070681_100516713
Length 341
Sequence MRRIPPSQFMGVRSGITVSILDDYFDTLHTLPCFAKLAPFDVTIWNDHVDDVDVLAERLQDSEVVVLIRERTKIQAPLLARLPKLRLISQRSVYPHIDIAACTSRGVIVSSNQQSDACHAAAELTWALVLAAVRQIPAQVEALRRGTWQLGVGSTLRGKTLGIYGYGRIGKVVAGYGDAFGMDVCVWSGERARAQAAADGYRVAATKDSFFEECDVISLHLRLVDATRGIVTAADLARMKPTSLLVNTSRAGLVAPGALLDALRAGRPGLAAVDVYDQEPLSPTDPLLTMPNVVCTPHIGYVTRDEYEKQFSDVFDQILAYAAGTPLNVVNPDVLARPNGV

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
101 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
102 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
103 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
106 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
107 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
108 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
109 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
110 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
111 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
112 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
113 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
114 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
115 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
116 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
117 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
118 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
119 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
120 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
121 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
122 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
123 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
124 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
125 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
126 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
127 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
131 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
132 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
133 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
134 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
135 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
136 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
137 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
138 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
139 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
140 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
141 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
142 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
143 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
144 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
145 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
146 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
147 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
148 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
149 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
150 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
151 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
152 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
159 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
160 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
161 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
162 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
163 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
164 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
165 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
166 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
167 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
168 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
169 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
170 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
171 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
172 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
173 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
174 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.24
Nodule 0
Rhizoplane 3.73
Rhizosphere 95.02
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10001858 3300005295 Bacteria 5857
2 Ga0070690_100008060 3300005330 Bacteria 6049
3 Ga0070670_100050723 3300005331 Bacteria 3565
4 Ga0070670_100106917 3300005331 Bacteria 2411
5 Ga0070670_100255240 3300005331 Bacteria 1528
6 Ga0070677_10000420 3300005333 Bacteria 14639
7 Ga0068869_100075997 3300005334 Unclassified 2496
8 Ga0068868_100042621 3300005338 Bacteria 3543
9 Ga0068868_100137726 3300005338 Bacteria 2002
10 Ga0070689_100029180 3300005340 Bacteria 4173
11 Ga0070671_100096042 3300005355 Bacteria 2485
12 Ga0070688_100186220 3300005365 Bacteria 1443
13 Ga0070667_100010789 3300005367 Bacteria 7549
14 Ga0070667_100226924 3300005367 Bacteria 1664
15 Ga0070701_10035150 3300005438 Bacteria 2516
16 Ga0070705_100061991 3300005440 Bacteria 2225
17 Ga0070700_100070890 3300005441 Bacteria 2224
18 Ga0070700_100143542 3300005441 Bacteria 1625
19 Ga0070694_100023665 3300005444 Bacteria 3954
20 Ga0070694_100028635 3300005444 Bacteria 3626
21 Ga0070681_10051671 3300005458 Bacteria 4100
22 Ga0068867_100008585 3300005459 Bacteria 7212
23 Ga0068867_100248590 3300005459 Bacteria 1445
24 Ga0070707_100028266 3300005468 Bacteria 5335
25 Ga0070697_100316293 3300005536 Bacteria 1344
26 Ga0070672_100023381 3300005543 Bacteria 4555
27 Ga0070686_100031482 3300005544 Unclassified 3244
28 Ga0070695_100007891 3300005545 Bacteria 6301
29 Ga0070693_100088498 3300005547 Bacteria 1862
30 Ga0070693_100142309 3300005547 Bacteria 1511
31 Ga0070665_100009349 3300005548 Bacteria 9919
32 Ga0070704_100038093 3300005549 Bacteria 3291
33 Ga0070704_100177734 3300005549 Bacteria 1699
34 Ga0068855_100078218 3300005563 Bacteria 3837
35 Ga0070664_100044542 3300005564 Bacteria 3747
36 Ga0068857_100281529 3300005577 Bacteria 1530
37 Ga0068856_100148654 3300005614 Bacteria 2351
38 Ga0070702_100011618 3300005615 Bacteria 4385
39 Ga0068852_100310303 3300005616 Bacteria 1529
40 Ga0068859_100095266 3300005617 Bacteria 3029
41 Ga0068859_100258615 3300005617 Bacteria 1832
42 Ga0068859_100509702 3300005617 Bacteria 1298
43 Ga0068864_100404384 3300005618 Bacteria 1298
44 Ga0068851_10126536 3300005834 Bacteria 1378
45 Ga0068870_10000546 3300005840 Bacteria 14240
46 Ga0068858_100010573 3300005842 Bacteria 8741
47 Ga0068858_100011597 3300005842 Bacteria 8311
48 Ga0068860_100100748 3300005843 Bacteria 2756
49 Ga0075366_10074586 3300006195 Bacteria 2023
50 Ga0097621_100034837 3300006237 Bacteria 4018
51 Ga0068871_100015063 3300006358 Bacteria 5779
52 Ga0075428_100005775 3300006844 Bacteria 13739
53 Ga0075428_100075575 3300006844 Bacteria 3678
54 Ga0075428_100148703 3300006844 Bacteria 2545
55 Ga0075430_100060314 3300006846 Unclassified 3188
56 Ga0075431_100039575 3300006847 Unclassified 4857
57 Ga0075433_10000251 3300006852 Bacteria 31061
58 Ga0075434_100110478 3300006871 Unclassified 2760
59 Ga0075434_100313147 3300006871 Bacteria 1590
60 Ga0075434_100544844 3300006871 Bacteria 1180
61 Ga0075429_100064722 3300006880 Bacteria 3184
62 Ga0075429_100287224 3300006880 Bacteria 1440
63 Ga0068865_100002762 3300006881 Bacteria 10437
64 Ga0068865_100026865 3300006881 Bacteria 3798
65 Ga0068865_100128821 3300006881 Bacteria 1893
66 Ga0075436_100021785 3300006914 Bacteria 4398
67 Ga0075436_100037687 3300006914 Bacteria 3338
68 Ga0097620_100095256 3300006931 Bacteria 3029
69 Ga0097620_100258602 3300006931 Bacteria 1832
70 Ga0097620_100418760 3300006931 Bacteria 1436
71 Ga0097620_100509679 3300006931 Bacteria 1298
72 Ga0075435_100001806 3300007076 Bacteria 13924
73 Ga0075435_100025708 3300007076 Bacteria 4585
74 Ga0075435_100308588 3300007076 Bacteria 1354
75 Ga0105240_10168722 3300009093 Bacteria 2594
76 Ga0111539_10011239 3300009094 Bacteria 11247
77 Ga0111539_10021064 3300009094 Bacteria 8029
78 Ga0111539_10058465 3300009094 Bacteria 4574
79 Ga0105245_10029805 3300009098 Bacteria 4824
80 Ga0105245_10059098 3300009098 Bacteria 3452
81 Ga0105247_10114305 3300009101 Bacteria 1741
82 Ga0114129_10012920 3300009147 Bacteria 11882
83 Ga0114129_10088392 3300009147 Bacteria 4295
84 Ga0114129_10335613 3300009147 Bacteria 2006
85 Ga0105242_10001435 3300009176 Bacteria 18756
86 Ga0105242_10007267 3300009176 Bacteria 8544
87 Ga0105248_10008180 3300009177 Bacteria 11488
88 Ga0105248_10018188 3300009177 Bacteria 7762
89 Ga0105248_10048491 3300009177 Unclassified 4765
90 Ga0105248_10298428 3300009177 Bacteria 1814
91 Ga0105248_10418826 3300009177 Bacteria 1508
92 Ga0105249_10002679 3300009553 Bacteria 15400
93 Ga0105249_10122063 3300009553 Bacteria 2477
94 Ga0105246_10040903 3300011119 Bacteria 3131
95 Ga0105246_10167005 3300011119 Bacteria 1682
96 Ga0163162_10116413 3300013306 Bacteria 2773
97 Ga0163162_10282965 3300013306 Bacteria 1790
98 Ga0157372_10178831 3300013307 Bacteria 2455
99 Ga0157375_10112145 3300013308 Unclassified 2827
100 Ga0157379_10024219 3300014968 Bacteria 5388
101 Ga0157376_10001026 3300014969 Bacteria 18248
102 Ga0157376_10025459 3300014969 Bacteria 4661
103 Ga0157376_10044298 3300014969 Bacteria 3657
104 Ga0163161_10034480 3300017792 Bacteria 3622
105 Ga0207697_10001459 3300025315 Bacteria 12904
106 Ga0207682_10000402 3300025893 Bacteria 19956
107 Ga0207710_10075277 3300025900 Bacteria 1556
108 Ga0207688_10000481 3300025901 Bacteria 19121
109 Ga0207645_10074569 3300025907 Bacteria 2172
110 Ga0207645_10214352 3300025907 Bacteria 1269
111 Ga0207643_10000340 3300025908 Bacteria 31897
112 Ga0207707_10068249 3300025912 Bacteria 3098
113 Ga0207652_10201034 3300025921 Bacteria 1793
114 Ga0207650_10053649 3300025925 Bacteria 2988
115 Ga0207650_10078432 3300025925 Bacteria 2499
116 Ga0207650_10174077 3300025925 Bacteria 1712
117 Ga0207687_10089072 3300025927 Bacteria 2246
118 Ga0207706_10129402 3300025933 Unclassified 2220
119 Ga0207686_10009979 3300025934 Bacteria 5164
120 Ga0207686_10013852 3300025934 Bacteria 4473
121 Ga0207704_10117820 3300025938 Bacteria 1810
122 Ga0207665_10164777 3300025939 Bacteria 1597
123 Ga0207691_10024891 3300025940 Bacteria 5625
124 Ga0207691_10131171 3300025940 Bacteria 2214
125 Ga0207689_10004051 3300025942 Bacteria 13314
126 Ga0207679_10038551 3300025945 Bacteria 3405
127 Ga0207667_10092976 3300025949 Bacteria 3115
128 Ga0207667_10135971 3300025949 Bacteria 2531
129 Ga0207712_10154160 3300025961 Bacteria 1778
130 Ga0207677_10007039 3300026023 Bacteria 6187
131 Ga0207677_10012308 3300026023 Bacteria 4912
132 Ga0207677_10116187 3300026023 Bacteria 2003
133 Ga0207677_10145316 3300026023 Bacteria 1822
134 Ga0207708_10010238 3300026075 Bacteria 6963
135 Ga0207702_10484222 3300026078 Bacteria 1204
136 Ga0207648_10267806 3300026089 Bacteria 1526
137 Ga0207676_10099351 3300026095 Bacteria 2409
138 Ga0207676_10266466 3300026095 Bacteria 1549
139 Ga0207674_10161833 3300026116 Bacteria 2192
140 Ga0207675_100236888 3300026118 Bacteria 1762
141 Ga0207683_10044667 3300026121 Unclassified 3874
142 Ga0209969_1001753 3300027360 Bacteria 2992
143 Ga0209967_1000944 3300027364 Bacteria 3717
144 Ga0210000_1003436 3300027462 Bacteria 2283
145 Ga0209999_1000966 3300027543 Bacteria 4847
146 Ga0209971_1009943 3300027682 Bacteria 2251
147 Ga0209974_10007495 3300027876 Bacteria 3757
148 Ga0207428_10028823 3300027907 Plasmid 4609
149 Ga0207428_10069664 3300027907 Bacteria 2766
150 Ga0268264_10102295 3300028381 Bacteria 2493
151 Ga0268264_10122546 3300028381 Bacteria 2293
152 Ga0268264_10318298 3300028381 Bacteria 1470
153 Ga0265319_1009727 3300028563 Bacteria 4066
154 Ga0265338_10013245 3300028800 Bacteria 9332
155 Ga0265320_10052267 3300031240 Bacteria 1979
156 Ga0265316_10118675 3300031344 Bacteria 1999
157 Ga0307416_100175121 3300032002 Bacteria 2003
158 Ga0373930_0010707 3300034816 Bacteria 1645
159 Ga0373958_0002780 3300034819 Bacteria 2482
160 Ga0373959_0001040 3300034820 Bacteria 4561
161 Ga0373938_0008268 3300034957 Bacteria 1854
162 Ga0373928_0001486 3300035084 Bacteria 4562
163 Ga0373940_0001205 3300035088 Bacteria 4560
164 Ga0373949_0004604 3300035090 Bacteria 3142
165 Ga0373951_0001473 3300035091 Bacteria 6146
166 Ga0373952_0009032 3300035092 Bacteria 1900
167 Ga0373936_0168113 3300035113 Bacteria 958
168 Ga0373939_0000529 3300035114 Bacteria 9592
169 Ga0373941_0017079 3300035115 Bacteria 1982
170 Ga0373945_0045241 3300035116 Bacteria 1603
171 Ga0373945_0074066 3300035116 Unclassified 1294
172 Ga0373960_0005820 3300035121 Bacteria 2867
173 Ga0373943_0050298 3300035170 Bacteria 2048
174 Ga0373946_0000932 3300035171 Bacteria 10016
175 Ga0373942_0000407 3300035207 Bacteria 11965
176 Ga0373961_0000874 3300035241 Bacteria 10149
177 Ga0373962_0000227 3300035242 Bacteria 11822
178 Ga0373924_0005612 3300035410 Bacteria 4450
179 Ga0373931_0005692 3300035691 Bacteria 5789
180 Ga0373935_0311549 3300035692 Bacteria 1115
181 Ga0373947_0009090 3300035725 Bacteria 5710
182 Ga0373925_0011134 3300037068 Bacteria 6524
183 Ga0395900_0291424 3300037418 Bacteria 1621
184 Ga0450894_009132 3300042131 Bacteria 1284
185 Ga0450896_008348 3300042133 Bacteria 1435
186 Ga0450908_007090 3300042184 Bacteria 2118
187 Ga0450918_011879 3300042531 Bacteria 1518
188 Ga0451577_0167276 3300042876 Bacteria 1981
189 Ga0453684_0089679 3300044712 Bacteria 3802
190 Ga0451576_0006468 3300045051 Bacteria 14357
191 Ga0495603_0055750 3300046455 Bacteria 2341
192 Ga0495651_0000874 3300046462 Bacteria 23391
193 Ga0495580_0173677 3300046472 Bacteria 1489
194 Ga0495608_0027343 3300046511 Bacteria 3881
195 Ga0495628_0014947 3300046516 Bacteria 6493
196 Ga0495586_0083868 3300046535 Bacteria 1754
197 Ga0495667_0019410 3300046559 Bacteria 4586
198 Ga0495588_0009288 3300046674 Bacteria 4540
199 Ga0495599_0076796 3300046678 Bacteria 2086
200 Ga0495658_0017598 3300046683 Bacteria 3696
201 Ga0495613_0002594 3300046689 Bacteria 13577
202 Ga0495600_0023521 3300046809 Bacteria 3964
203 Ga0495674_0009802 3300047319 Bacteria 9096
204 Ga0495676_0140686 3300047321 Bacteria 1730
205 Ga0495680_0000742 3300047322 Bacteria 36551
206 Ga0495684_0001701 3300047471 Bacteria 17687
207 Ga0496102_0182923 3300048905 Bacteria 1975
208 Ga0496104_0023012 3300048907 Bacteria 5726
209 Ga0496105_0134458 3300048908 Bacteria 2037
210 Ga0496106_0080504 3300048909 Bacteria 2501
211 Ga0496110_0013169 3300048913 Bacteria 6830
212 Ga0496114_0057889 3300048917 Bacteria 3236
213 Ga0496114_0115351 3300048917 Bacteria 2305
214 Ga0496114_0325240 3300048917 Bacteria 1359
215 Ga0496115_0198742 3300048918 Bacteria 1656
216 Ga0501075_0125986 3300049591 Bacteria 1950
217 nmdc:mga0k408_149487_c1 3300050493 Bacteria 1391
218 nmdc:mga05p37_3363_c1 3300050507 Bacteria 18664
219 nmdc:mga05p37_49_c1 3300050507 Bacteria 103776
220 nmdc:mga09592_282251_c1 3300050508 Bacteria 1440
221 nmdc:mga0qj67_251421_c1 3300050509 Bacteria 1434
222 nmdc:mga0qj67_336473_c1 3300050509 Bacteria 1221
223 nmdc:mga0qj67_50157_c1 3300050509 Unclassified 3300
224 nmdc:mga06r32_20884_c1 3300050510 Bacteria 6036
225 nmdc:mga08y16_112913_c1 3300050511 Bacteria 2829
226 nmdc:mga08y16_71667_c1 3300050511 Plasmid 3611
227 nmdc:mga0n895_132565_c1 3300050512 Unclassified 2517
228 nmdc:mga0n895_139365_c1 3300050512 Unclassified 2453
229 nmdc:mga0n895_14946_c1 3300050512 Bacteria 7072
230 nmdc:mga0n895_3160_c1 3300050512 Bacteria 13158
231 nmdc:mga0n895_411103_c1 3300050512 Bacteria 1368
232 nmdc:mga0rr50_19480_c1 3300050513 Bacteria 4582
233 nmdc:mga0rr50_298132_c1 3300050513 Bacteria 1348
234 nmdc:mga0rr50_29947_c1 3300050513 Bacteria 3846
235 nmdc:mga08x19_230130_c1 3300050514 Bacteria 1276
236 nmdc:mga08x19_30222_c1 3300050514 Bacteria 3403
237 nmdc:mga0a205_33210_c1 3300050515 Bacteria 4948
238 Ga0495601_0006056 3300053077 Bacteria 7058
239 Ga0495595_0008864 3300053084 Bacteria 4143
240 Ga0500566_0170366 3300053094 Bacteria 1126
241 Ga0501084_0313748 3300054114 Bacteria 1324

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042133 Ga0450896_008348 Ga0450896_008348_156_1154 293
2 3300035170 Ga0373943_0050298 Ga0373943_0050298_53_1045 297
3 3300050512 nmdc:mga0n895_411103_c1 nmdc:mga0n895_411103_c1_428_1339 298
4 3300006880 Ga0075429_100287224 Ga0075429_1002872242 300
5 3300035113 Ga0373936_0168113 Ga0373936_0168113_36_941 300
6 3300050508 nmdc:mga09592_282251_c1 nmdc:mga09592_282251_c1_219_1214 300
7 3300007076 Ga0075435_100001806 Ga0075435_10000180612 305
8 3300026078 Ga0207702_10484222 Ga0207702_104842221 305
9 3300046535 Ga0495586_0083868 Ga0495586_0083868_776_1708 305
10 3300035692 Ga0373935_0311549 Ga0373935_0311549_73_1065 307
11 3300027360 Ga0209969_1001753 Ga0209969_10017534 308
12 3300027364 Ga0209967_1000944 Ga0209967_10009445 308
13 3300027462 Ga0210000_1003436 Ga0210000_10034362 308
14 3300027682 Ga0209971_1009943 Ga0209971_10099434 308
15 3300046683 Ga0495658_0017598 Ga0495658_0017598_2441_3433 309
16 3300006844 Ga0075428_100005775 Ga0075428_10000577511 313
17 3300006846 Ga0075430_100060314 Ga0075430_1000603145 313
18 3300006847 Ga0075431_100039575 Ga0075431_1000395755 313
19 3300006880 Ga0075429_100064722 Ga0075429_1000647222 313
20 3300009147 Ga0114129_10012920 Ga0114129_100129207 313
21 3300050507 nmdc:mga05p37_3363_c1 nmdc:mga05p37_3363_c1_12285_13268 313
22 3300050509 nmdc:mga0qj67_50157_c1 nmdc:mga0qj67_50157_c1_2126_3109 313
23 3300050510 nmdc:mga06r32_20884_c1 nmdc:mga06r32_20884_c1_1752_2735 313
24 3300037418 Ga0395900_0291424 Ga0395900_0291424_487_1464 315
25 3300042131 Ga0450894_009132 Ga0450894_009132_70_1113 315
26 3300042184 Ga0450908_007090 Ga0450908_007090_839_1882 315
27 3300042531 Ga0450918_011879 Ga0450918_011879_409_1452 315
28 3300005459 Ga0068867_100008585 Ga0068867_1000085856 317
29 3300006237 Ga0097621_100034837 Ga0097621_1000348373 317
30 3300006358 Ga0068871_100015063 Ga0068871_1000150632 317
31 3300006881 Ga0068865_100002762 Ga0068865_1000027622 317
32 3300009176 Ga0105242_10007267 Ga0105242_100072674 317
33 3300009177 Ga0105248_10298428 Ga0105248_102984282 317
34 3300013306 Ga0163162_10282965 Ga0163162_102829652 317
35 3300014969 Ga0157376_10025459 Ga0157376_100254592 317
36 3300025927 Ga0207687_10089072 Ga0207687_100890722 317
37 3300025934 Ga0207686_10009979 Ga0207686_100099795 317
38 3300026023 Ga0207677_10116187 Ga0207677_101161872 317
39 3300027543 Ga0209999_1000966 Ga0209999_10009662 317
40 3300048917 Ga0496114_0115351 Ga0496114_0115351_916_1890 317
41 3300005338 Ga0068868_100042621 Ga0068868_1000426212 319
42 3300005459 Ga0068867_100248590 Ga0068867_1002485902 319
43 3300005548 Ga0070665_100009349 Ga0070665_1000093495 319
44 3300005834 Ga0068851_10126536 Ga0068851_101265361 319
45 3300005842 Ga0068858_100010573 Ga0068858_1000105733 319
46 3300006881 Ga0068865_100128821 Ga0068865_1001288212 319
47 3300009098 Ga0105245_10029805 Ga0105245_100298052 319
48 3300009101 Ga0105247_10114305 Ga0105247_101143052 319
49 3300009176 Ga0105242_10001435 Ga0105242_100014359 319
50 3300009177 Ga0105248_10008180 Ga0105248_1000818010 319
51 3300011119 Ga0105246_10167005 Ga0105246_101670052 319
52 3300014968 Ga0157379_10024219 Ga0157379_100242193 319
53 3300014969 Ga0157376_10044298 Ga0157376_100442982 319
54 3300025900 Ga0207710_10075277 Ga0207710_100752772 319
55 3300025934 Ga0207686_10013852 Ga0207686_100138522 319
56 3300026023 Ga0207677_10012308 Ga0207677_100123083 319
57 3300026089 Ga0207648_10267806 Ga0207648_102678061 319
58 3300028381 Ga0268264_10102295 Ga0268264_101022951 319
59 3300005331 Ga0070670_100106917 Ga0070670_1001069172 320
60 3300005617 Ga0068859_100509702 Ga0068859_1005097022 320
61 3300006931 Ga0097620_100509679 Ga0097620_1005096792 320
62 3300009098 Ga0105245_10059098 Ga0105245_100590983 320
63 3300025925 Ga0207650_10078432 Ga0207650_100784322 320
64 3300026095 Ga0207676_10266466 Ga0207676_102664661 320
65 3300005330 Ga0070690_100008060 Ga0070690_1000080603 321
66 3300005338 Ga0068868_100137726 Ga0068868_1001377262 321
67 3300005615 Ga0070702_100011618 Ga0070702_1000116182 321
68 3300026023 Ga0207677_10145316 Ga0207677_101453162 321
69 3300048917 Ga0496114_0057889 Ga0496114_0057889_1211_2197 321
70 3300005355 Ga0070671_100096042 Ga0070671_1000960421 324
71 3300005458 Ga0070681_10051671 Ga0070681_100516713 324
72 3300005547 Ga0070693_100088498 Ga0070693_1000884982 324
73 3300005563 Ga0068855_100078218 Ga0068855_1000782185 324
74 3300005577 Ga0068857_100281529 Ga0068857_1002815291 324
75 3300005614 Ga0068856_100148654 Ga0068856_1001486542 324
76 3300006195 Ga0075366_10074586 Ga0075366_100745862 324
77 3300006871 Ga0075434_100544844 Ga0075434_1005448442 324
78 3300009093 Ga0105240_10168722 Ga0105240_101687223 324
79 3300013307 Ga0157372_10178831 Ga0157372_101788315 324
80 3300025912 Ga0207707_10068249 Ga0207707_100682493 324
81 3300025921 Ga0207652_10201034 Ga0207652_102010342 324
82 3300025949 Ga0207667_10092976 Ga0207667_100929763 324
83 3300025949 Ga0207667_10135971 Ga0207667_101359712 324
84 3300034816 Ga0373930_0010707 Ga0373930_0010707_526_1632 324
85 3300034819 Ga0373958_0002780 Ga0373958_0002780_784_1890 324
86 3300034820 Ga0373959_0001040 Ga0373959_0001040_2860_3966 324
87 3300034957 Ga0373938_0008268 Ga0373938_0008268_691_1797 324
88 3300035084 Ga0373928_0001486 Ga0373928_0001486_2784_3890 324
89 3300035088 Ga0373940_0001205 Ga0373940_0001205_1645_2751 324
90 3300035090 Ga0373949_0004604 Ga0373949_0004604_1962_3068 324
91 3300035091 Ga0373951_0001473 Ga0373951_0001473_1069_2175 324
92 3300035092 Ga0373952_0009032 Ga0373952_0009032_532_1638 324
93 3300035114 Ga0373939_0000529 Ga0373939_0000529_4139_5245 324
94 3300035115 Ga0373941_0017079 Ga0373941_0017079_408_1514 324
95 3300035121 Ga0373960_0005820 Ga0373960_0005820_1277_2383 324
96 3300035207 Ga0373942_0000407 Ga0373942_0000407_9590_10696 324
97 3300035241 Ga0373961_0000874 Ga0373961_0000874_3381_4487 324
98 3300035242 Ga0373962_0000227 Ga0373962_0000227_5968_7074 324
99 3300035691 Ga0373931_0005692 Ga0373931_0005692_412_1518 324
100 3300045051 Ga0451576_0006468 Ga0451576_0006468_1393_2511 324
101 3300048908 Ga0496105_0134458 Ga0496105_0134458_151_1140 324
102 3300048917 Ga0496114_0325240 Ga0496114_0325240_288_1262 324
103 3300050493 nmdc:mga0k408_149487_c1 nmdc:mga0k408_149487_c1_200_1177 324
104 3300006844 Ga0075428_100148703 Ga0075428_1001487033 325
105 3300009147 Ga0114129_10088392 Ga0114129_100883923 325
106 3300035116 Ga0373945_0045241 Ga0373945_0045241_192_1169 325
107 3300035116 Ga0373945_0074066 Ga0373945_0074066_171_1148 325
108 3300035171 Ga0373946_0000932 Ga0373946_0000932_4291_5268 325
109 3300035410 Ga0373924_0005612 Ga0373924_0005612_1422_2399 325
110 3300035725 Ga0373947_0009090 Ga0373947_0009090_4447_5424 325
111 3300037068 Ga0373925_0011134 Ga0373925_0011134_1965_2942 325
112 3300046516 Ga0495628_0014947 Ga0495628_0014947_3528_4505 325
113 3300046678 Ga0495599_0076796 Ga0495599_0076796_490_1467 325
114 3300048905 Ga0496102_0182923 Ga0496102_0182923_236_1216 325
115 3300050507 nmdc:mga05p37_49_c1 nmdc:mga05p37_49_c1_101541_102518 325
116 3300005295 Ga0065707_10001858 Ga0065707_100018586 326
117 3300005331 Ga0070670_100050723 Ga0070670_1000507235 326
118 3300005331 Ga0070670_100255240 Ga0070670_1002552402 326
119 3300005333 Ga0070677_10000420 Ga0070677_100004205 326
120 3300005334 Ga0068869_100075997 Ga0068869_1000759973 326
121 3300005340 Ga0070689_100029180 Ga0070689_1000291805 326
122 3300005365 Ga0070688_100186220 Ga0070688_1001862201 326
123 3300005367 Ga0070667_100010789 Ga0070667_1000107899 326
124 3300005367 Ga0070667_100226924 Ga0070667_1002269242 326
125 3300005438 Ga0070701_10035150 Ga0070701_100351502 326
126 3300005440 Ga0070705_100061991 Ga0070705_1000619913 326
127 3300005441 Ga0070700_100070890 Ga0070700_1000708903 326
128 3300005441 Ga0070700_100143542 Ga0070700_1001435421 326
129 3300005444 Ga0070694_100023665 Ga0070694_1000236653 326
130 3300005444 Ga0070694_100028635 Ga0070694_1000286352 326
131 3300005468 Ga0070707_100028266 Ga0070707_1000282664 326
132 3300005536 Ga0070697_100316293 Ga0070697_1003162931 326
133 3300005543 Ga0070672_100023381 Ga0070672_1000233814 326
134 3300005544 Ga0070686_100031482 Ga0070686_1000314823 326
135 3300005545 Ga0070695_100007891 Ga0070695_1000078915 326
136 3300005547 Ga0070693_100142309 Ga0070693_1001423092 326
137 3300005549 Ga0070704_100038093 Ga0070704_1000380932 326
138 3300005549 Ga0070704_100177734 Ga0070704_1001777342 326
139 3300005564 Ga0070664_100044542 Ga0070664_1000445422 326
140 3300005616 Ga0068852_100310303 Ga0068852_1003103032 326
141 3300005617 Ga0068859_100095266 Ga0068859_1000952662 326
142 3300005617 Ga0068859_100258615 Ga0068859_1002586151 326
143 3300005618 Ga0068864_100404384 Ga0068864_1004043841 326
144 3300005840 Ga0068870_10000546 Ga0068870_1000054620 326
145 3300005842 Ga0068858_100011597 Ga0068858_1000115973 326
146 3300005843 Ga0068860_100100748 Ga0068860_1001007482 326
147 3300006844 Ga0075428_100075575 Ga0075428_1000755752 326
148 3300006852 Ga0075433_10000251 Ga0075433_100002515 326
149 3300006871 Ga0075434_100110478 Ga0075434_1001104782 326
150 3300006871 Ga0075434_100313147 Ga0075434_1003131473 326
151 3300006881 Ga0068865_100026865 Ga0068865_1000268652 326
152 3300006914 Ga0075436_100021785 Ga0075436_1000217854 326
153 3300006914 Ga0075436_100037687 Ga0075436_1000376872 326
154 3300006931 Ga0097620_100095256 Ga0097620_1000952562 326
155 3300006931 Ga0097620_100258602 Ga0097620_1002586023 326
156 3300006931 Ga0097620_100418760 Ga0097620_1004187602 326
157 3300007076 Ga0075435_100025708 Ga0075435_1000257082 326
158 3300007076 Ga0075435_100308588 Ga0075435_1003085881 326
159 3300009094 Ga0111539_10011239 Ga0111539_100112392 326
160 3300009094 Ga0111539_10021064 Ga0111539_100210647 326
161 3300009094 Ga0111539_10058465 Ga0111539_100584652 326
162 3300009147 Ga0114129_10335613 Ga0114129_103356132 326
163 3300009177 Ga0105248_10018188 Ga0105248_100181882 326
164 3300009177 Ga0105248_10048491 Ga0105248_100484913 326
165 3300009177 Ga0105248_10418826 Ga0105248_104188261 326
166 3300009553 Ga0105249_10002679 Ga0105249_1000267913 326
167 3300009553 Ga0105249_10122063 Ga0105249_101220634 326
168 3300011119 Ga0105246_10040903 Ga0105246_100409033 326
169 3300013306 Ga0163162_10116413 Ga0163162_101164132 326
170 3300013308 Ga0157375_10112145 Ga0157375_101121452 326
171 3300014969 Ga0157376_10001026 Ga0157376_100010266 326
172 3300017792 Ga0163161_10034480 Ga0163161_100344803 326
173 3300025315 Ga0207697_10001459 Ga0207697_1000145917 326
174 3300025893 Ga0207682_10000402 Ga0207682_1000040222 326
175 3300025901 Ga0207688_10000481 Ga0207688_100004813 326
176 3300025907 Ga0207645_10074569 Ga0207645_100745692 326
177 3300025907 Ga0207645_10214352 Ga0207645_102143521 326
178 3300025908 Ga0207643_10000340 Ga0207643_1000034015 326
179 3300025925 Ga0207650_10053649 Ga0207650_100536494 326
180 3300025925 Ga0207650_10174077 Ga0207650_101740772 326
181 3300025933 Ga0207706_10129402 Ga0207706_101294021 326
182 3300025938 Ga0207704_10117820 Ga0207704_101178202 326
183 3300025939 Ga0207665_10164777 Ga0207665_101647772 326
184 3300025940 Ga0207691_10024891 Ga0207691_100248913 326
185 3300025940 Ga0207691_10131171 Ga0207691_101311713 326
186 3300025942 Ga0207689_10004051 Ga0207689_1000405110 326
187 3300025945 Ga0207679_10038551 Ga0207679_100385513 326
188 3300025961 Ga0207712_10154160 Ga0207712_101541601 326
189 3300026023 Ga0207677_10007039 Ga0207677_100070392 326
190 3300026075 Ga0207708_10010238 Ga0207708_100102385 326
191 3300026095 Ga0207676_10099351 Ga0207676_100993512 326
192 3300026116 Ga0207674_10161833 Ga0207674_101618331 326
193 3300026118 Ga0207675_100236888 Ga0207675_1002368882 326
194 3300026121 Ga0207683_10044667 Ga0207683_100446673 326
195 3300027876 Ga0209974_10007495 Ga0209974_100074953 326
196 3300027907 Ga0207428_10028823 Ga0207428_100288232 326
197 3300027907 Ga0207428_10069664 Ga0207428_100696643 326
198 3300028381 Ga0268264_10122546 Ga0268264_101225463 326
199 3300028381 Ga0268264_10318298 Ga0268264_103182981 326
200 3300028563 Ga0265319_1009727 Ga0265319_10097272 326
201 3300028800 Ga0265338_10013245 Ga0265338_100132456 326
202 3300031240 Ga0265320_10052267 Ga0265320_100522673 326
203 3300031344 Ga0265316_10118675 Ga0265316_101186752 326
204 3300032002 Ga0307416_100175121 Ga0307416_1001751211 326
205 3300042876 Ga0451577_0167276 Ga0451577_0167276_400_1380 326
206 3300044712 Ga0453684_0089679 Ga0453684_0089679_1690_2670 326
207 3300046455 Ga0495603_0055750 Ga0495603_0055750_1008_1988 326
208 3300046462 Ga0495651_0000874 Ga0495651_0000874_16827_17828 326
209 3300046472 Ga0495580_0173677 Ga0495580_0173677_351_1373 326
210 3300046511 Ga0495608_0027343 Ga0495608_0027343_327_1349 326
211 3300046559 Ga0495667_0019410 Ga0495667_0019410_2901_3902 326
212 3300046674 Ga0495588_0009288 Ga0495588_0009288_3279_4259 326
213 3300046689 Ga0495613_0002594 Ga0495613_0002594_4963_5985 326
214 3300046809 Ga0495600_0023521 Ga0495600_0023521_1779_2780 326
215 3300047319 Ga0495674_0009802 Ga0495674_0009802_6098_7120 326
216 3300047321 Ga0495676_0140686 Ga0495676_0140686_535_1515 326
217 3300047322 Ga0495680_0000742 Ga0495680_0000742_16959_17960 326
218 3300047471 Ga0495684_0001701 Ga0495684_0001701_9885_10907 326
219 3300048907 Ga0496104_0023012 Ga0496104_0023012_3171_4157 326
220 3300048909 Ga0496106_0080504 Ga0496106_0080504_356_1537 326
221 3300048913 Ga0496110_0013169 Ga0496110_0013169_1693_2679 326
222 3300048918 Ga0496115_0198742 Ga0496115_0198742_619_1605 326
223 3300049591 Ga0501075_0125986 Ga0501075_0125986_194_1183 326
224 3300050509 nmdc:mga0qj67_251421_c1 nmdc:mga0qj67_251421_c1_177_1292 326
225 3300050509 nmdc:mga0qj67_336473_c1 nmdc:mga0qj67_336473_c1_16_1011 326
226 3300050511 nmdc:mga08y16_112913_c1 nmdc:mga08y16_112913_c1_173_1165 326
227 3300050511 nmdc:mga08y16_71667_c1 nmdc:mga08y16_71667_c1_1017_2024 326
228 3300050512 nmdc:mga0n895_132565_c1 nmdc:mga0n895_132565_c1_177_1169 326
229 3300050512 nmdc:mga0n895_139365_c1 nmdc:mga0n895_139365_c1_406_1401 326
230 3300050512 nmdc:mga0n895_14946_c1 nmdc:mga0n895_14946_c1_87_1073 326
231 3300050512 nmdc:mga0n895_3160_c1 nmdc:mga0n895_3160_c1_5644_6636 326
232 3300050513 nmdc:mga0rr50_19480_c1 nmdc:mga0rr50_19480_c1_109_1095 326
233 3300050513 nmdc:mga0rr50_298132_c1 nmdc:mga0rr50_298132_c1_329_1312 326
234 3300050513 nmdc:mga0rr50_29947_c1 nmdc:mga0rr50_29947_c1_1172_2164 326
235 3300050514 nmdc:mga08x19_230130_c1 nmdc:mga08x19_230130_c1_113_1132 326
236 3300050514 nmdc:mga08x19_30222_c1 nmdc:mga08x19_30222_c1_14_1039 326
237 3300050515 nmdc:mga0a205_33210_c1 nmdc:mga0a205_33210_c1_3913_4905 326
238 3300053077 Ga0495601_0006056 Ga0495601_0006056_3386_4408 326
239 3300053084 Ga0495595_0008864 Ga0495595_0008864_2123_3145 326
240 3300053094 Ga0500566_0170366 Ga0500566_0170366_53_1036 326
241 3300054114 Ga0501084_0313748 Ga0501084_0313748_185_1165 326

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02826

2-Hacid_dh_C

D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain

126

300

0.97

PF00389

2-Hacid_dh

D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain

22

331

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gg9-assembly2.cif.gz_B crystal structure of putative d-3-phosphoglycerate dehydrogenase oxidoreductase from ralstonia solanacearum 0.9626 2 322
3gg9-assembly2.cif.gz_C crystal structure of putative d-3-phosphoglycerate dehydrogenase oxidoreductase from ralstonia solanacearum 0.9616 1 322
4s1v-assembly1.cif.gz_B crystal structure of phosphoglycerate oxidoreductase from vibrio cholerae o395 0.9562 1 311
3gg9-assembly2.cif.gz_C crystal structure of putative d-3-phosphoglycerate dehydrogenase oxidoreductase from ralstonia solanacearum 0.9472 1 322
3gg9-assembly2.cif.gz_B crystal structure of putative d-3-phosphoglycerate dehydrogenase oxidoreductase from ralstonia solanacearum 0.9452 2 322
ID Description Score Start End Superfamily
4s1vD02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9675 105 290 3.40.50.720
3gg9C01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9628 1 99 3.40.50.720
4s1vA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9448 1 100 3.40.50.720
4s1vD02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9377 105 290 3.40.50.720
af_Q7XRA3_150_294_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9362 140 290 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A820NVB4-F1-model_v4 D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding domain-containing protein 1 141 282 GO:0016491
GO:0051287
AF-A0A6I2IYD8-F1-model_v4 deleted 0.9993 141 267
AF-A0A820NVB4-F1-model_v4 D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding domain-containing protein 0.9932 141 282 GO:0016491
GO:0051287
AF-A0A6I2IYD8-F1-model_v4 deleted 0.9915 141 267
AF-A0A821D8N8-F1-model_v4 methionine synthase (EC 2.1.1.13) (5-methyltetrahydrofolate--homocysteine methyltransferase) (Vitamin-B12 dependent methionine synthase) 0.9913 1 326 GO:0005829
GO:0008705
GO:0016616
GO:0031419
GO:0032259
GO:0046653
GO:0046872
GO:0050667
GO:0051287

Feature Viewer

pLDDT pTM Quality
94.13 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map