F353560
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 241 | 174 | 241 | 331 |
Family's Representative Sequence
| Representative Sequence | 3300005458|Ga0070681_10051671|Ga0070681_100516713 |
| Length | 341 |
| Sequence | MRRIPPSQFMGVRSGITVSILDDYFDTLHTLPCFAKLAPFDVTIWNDHVDDVDVLAERLQDSEVVVLIRERTKIQAPLLARLPKLRLISQRSVYPHIDIAACTSRGVIVSSNQQSDACHAAAELTWALVLAAVRQIPAQVEALRRGTWQLGVGSTLRGKTLGIYGYGRIGKVVAGYGDAFGMDVCVWSGERARAQAAADGYRVAATKDSFFEECDVISLHLRLVDATRGIVTAADLARMKPTSLLVNTSRAGLVAPGALLDALRAGRPGLAAVDVYDQEPLSPTDPLLTMPNVVCTPHIGYVTRDEYEKQFSDVFDQILAYAAGTPLNVVNPDVLARPNGV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 3 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 17 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 26 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 28 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 29 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 31 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 32 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 33 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 34 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 35 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 36 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 37 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 38 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 40 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 41 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 42 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 43 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 44 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 45 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 46 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 47 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 48 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 50 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 99 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 101 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 102 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 103 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 104 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 105 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 106 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 107 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 108 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 109 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 110 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 111 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 112 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 113 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 114 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 115 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 116 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 117 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 118 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 119 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 120 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 121 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 122 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 123 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 124 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 125 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 126 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 127 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 128 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 129 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 130 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 131 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 132 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 133 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 134 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 135 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 136 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 137 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 154 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 155 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 156 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 157 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 158 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 159 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 160 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 161 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 162 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 163 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 164 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 165 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 166 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 167 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 168 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 169 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 170 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 171 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 174 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.24 |
| Nodule | 0 |
| Rhizoplane | 3.73 |
| Rhizosphere | 95.02 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065707_10001858 | 3300005295 | Bacteria | 5857 |
| 2 | Ga0070690_100008060 | 3300005330 | Bacteria | 6049 |
| 3 | Ga0070670_100050723 | 3300005331 | Bacteria | 3565 |
| 4 | Ga0070670_100106917 | 3300005331 | Bacteria | 2411 |
| 5 | Ga0070670_100255240 | 3300005331 | Bacteria | 1528 |
| 6 | Ga0070677_10000420 | 3300005333 | Bacteria | 14639 |
| 7 | Ga0068869_100075997 | 3300005334 | Unclassified | 2496 |
| 8 | Ga0068868_100042621 | 3300005338 | Bacteria | 3543 |
| 9 | Ga0068868_100137726 | 3300005338 | Bacteria | 2002 |
| 10 | Ga0070689_100029180 | 3300005340 | Bacteria | 4173 |
| 11 | Ga0070671_100096042 | 3300005355 | Bacteria | 2485 |
| 12 | Ga0070688_100186220 | 3300005365 | Bacteria | 1443 |
| 13 | Ga0070667_100010789 | 3300005367 | Bacteria | 7549 |
| 14 | Ga0070667_100226924 | 3300005367 | Bacteria | 1664 |
| 15 | Ga0070701_10035150 | 3300005438 | Bacteria | 2516 |
| 16 | Ga0070705_100061991 | 3300005440 | Bacteria | 2225 |
| 17 | Ga0070700_100070890 | 3300005441 | Bacteria | 2224 |
| 18 | Ga0070700_100143542 | 3300005441 | Bacteria | 1625 |
| 19 | Ga0070694_100023665 | 3300005444 | Bacteria | 3954 |
| 20 | Ga0070694_100028635 | 3300005444 | Bacteria | 3626 |
| 21 | Ga0070681_10051671 | 3300005458 | Bacteria | 4100 |
| 22 | Ga0068867_100008585 | 3300005459 | Bacteria | 7212 |
| 23 | Ga0068867_100248590 | 3300005459 | Bacteria | 1445 |
| 24 | Ga0070707_100028266 | 3300005468 | Bacteria | 5335 |
| 25 | Ga0070697_100316293 | 3300005536 | Bacteria | 1344 |
| 26 | Ga0070672_100023381 | 3300005543 | Bacteria | 4555 |
| 27 | Ga0070686_100031482 | 3300005544 | Unclassified | 3244 |
| 28 | Ga0070695_100007891 | 3300005545 | Bacteria | 6301 |
| 29 | Ga0070693_100088498 | 3300005547 | Bacteria | 1862 |
| 30 | Ga0070693_100142309 | 3300005547 | Bacteria | 1511 |
| 31 | Ga0070665_100009349 | 3300005548 | Bacteria | 9919 |
| 32 | Ga0070704_100038093 | 3300005549 | Bacteria | 3291 |
| 33 | Ga0070704_100177734 | 3300005549 | Bacteria | 1699 |
| 34 | Ga0068855_100078218 | 3300005563 | Bacteria | 3837 |
| 35 | Ga0070664_100044542 | 3300005564 | Bacteria | 3747 |
| 36 | Ga0068857_100281529 | 3300005577 | Bacteria | 1530 |
| 37 | Ga0068856_100148654 | 3300005614 | Bacteria | 2351 |
| 38 | Ga0070702_100011618 | 3300005615 | Bacteria | 4385 |
| 39 | Ga0068852_100310303 | 3300005616 | Bacteria | 1529 |
| 40 | Ga0068859_100095266 | 3300005617 | Bacteria | 3029 |
| 41 | Ga0068859_100258615 | 3300005617 | Bacteria | 1832 |
| 42 | Ga0068859_100509702 | 3300005617 | Bacteria | 1298 |
| 43 | Ga0068864_100404384 | 3300005618 | Bacteria | 1298 |
| 44 | Ga0068851_10126536 | 3300005834 | Bacteria | 1378 |
| 45 | Ga0068870_10000546 | 3300005840 | Bacteria | 14240 |
| 46 | Ga0068858_100010573 | 3300005842 | Bacteria | 8741 |
| 47 | Ga0068858_100011597 | 3300005842 | Bacteria | 8311 |
| 48 | Ga0068860_100100748 | 3300005843 | Bacteria | 2756 |
| 49 | Ga0075366_10074586 | 3300006195 | Bacteria | 2023 |
| 50 | Ga0097621_100034837 | 3300006237 | Bacteria | 4018 |
| 51 | Ga0068871_100015063 | 3300006358 | Bacteria | 5779 |
| 52 | Ga0075428_100005775 | 3300006844 | Bacteria | 13739 |
| 53 | Ga0075428_100075575 | 3300006844 | Bacteria | 3678 |
| 54 | Ga0075428_100148703 | 3300006844 | Bacteria | 2545 |
| 55 | Ga0075430_100060314 | 3300006846 | Unclassified | 3188 |
| 56 | Ga0075431_100039575 | 3300006847 | Unclassified | 4857 |
| 57 | Ga0075433_10000251 | 3300006852 | Bacteria | 31061 |
| 58 | Ga0075434_100110478 | 3300006871 | Unclassified | 2760 |
| 59 | Ga0075434_100313147 | 3300006871 | Bacteria | 1590 |
| 60 | Ga0075434_100544844 | 3300006871 | Bacteria | 1180 |
| 61 | Ga0075429_100064722 | 3300006880 | Bacteria | 3184 |
| 62 | Ga0075429_100287224 | 3300006880 | Bacteria | 1440 |
| 63 | Ga0068865_100002762 | 3300006881 | Bacteria | 10437 |
| 64 | Ga0068865_100026865 | 3300006881 | Bacteria | 3798 |
| 65 | Ga0068865_100128821 | 3300006881 | Bacteria | 1893 |
| 66 | Ga0075436_100021785 | 3300006914 | Bacteria | 4398 |
| 67 | Ga0075436_100037687 | 3300006914 | Bacteria | 3338 |
| 68 | Ga0097620_100095256 | 3300006931 | Bacteria | 3029 |
| 69 | Ga0097620_100258602 | 3300006931 | Bacteria | 1832 |
| 70 | Ga0097620_100418760 | 3300006931 | Bacteria | 1436 |
| 71 | Ga0097620_100509679 | 3300006931 | Bacteria | 1298 |
| 72 | Ga0075435_100001806 | 3300007076 | Bacteria | 13924 |
| 73 | Ga0075435_100025708 | 3300007076 | Bacteria | 4585 |
| 74 | Ga0075435_100308588 | 3300007076 | Bacteria | 1354 |
| 75 | Ga0105240_10168722 | 3300009093 | Bacteria | 2594 |
| 76 | Ga0111539_10011239 | 3300009094 | Bacteria | 11247 |
| 77 | Ga0111539_10021064 | 3300009094 | Bacteria | 8029 |
| 78 | Ga0111539_10058465 | 3300009094 | Bacteria | 4574 |
| 79 | Ga0105245_10029805 | 3300009098 | Bacteria | 4824 |
| 80 | Ga0105245_10059098 | 3300009098 | Bacteria | 3452 |
| 81 | Ga0105247_10114305 | 3300009101 | Bacteria | 1741 |
| 82 | Ga0114129_10012920 | 3300009147 | Bacteria | 11882 |
| 83 | Ga0114129_10088392 | 3300009147 | Bacteria | 4295 |
| 84 | Ga0114129_10335613 | 3300009147 | Bacteria | 2006 |
| 85 | Ga0105242_10001435 | 3300009176 | Bacteria | 18756 |
| 86 | Ga0105242_10007267 | 3300009176 | Bacteria | 8544 |
| 87 | Ga0105248_10008180 | 3300009177 | Bacteria | 11488 |
| 88 | Ga0105248_10018188 | 3300009177 | Bacteria | 7762 |
| 89 | Ga0105248_10048491 | 3300009177 | Unclassified | 4765 |
| 90 | Ga0105248_10298428 | 3300009177 | Bacteria | 1814 |
| 91 | Ga0105248_10418826 | 3300009177 | Bacteria | 1508 |
| 92 | Ga0105249_10002679 | 3300009553 | Bacteria | 15400 |
| 93 | Ga0105249_10122063 | 3300009553 | Bacteria | 2477 |
| 94 | Ga0105246_10040903 | 3300011119 | Bacteria | 3131 |
| 95 | Ga0105246_10167005 | 3300011119 | Bacteria | 1682 |
| 96 | Ga0163162_10116413 | 3300013306 | Bacteria | 2773 |
| 97 | Ga0163162_10282965 | 3300013306 | Bacteria | 1790 |
| 98 | Ga0157372_10178831 | 3300013307 | Bacteria | 2455 |
| 99 | Ga0157375_10112145 | 3300013308 | Unclassified | 2827 |
| 100 | Ga0157379_10024219 | 3300014968 | Bacteria | 5388 |
| 101 | Ga0157376_10001026 | 3300014969 | Bacteria | 18248 |
| 102 | Ga0157376_10025459 | 3300014969 | Bacteria | 4661 |
| 103 | Ga0157376_10044298 | 3300014969 | Bacteria | 3657 |
| 104 | Ga0163161_10034480 | 3300017792 | Bacteria | 3622 |
| 105 | Ga0207697_10001459 | 3300025315 | Bacteria | 12904 |
| 106 | Ga0207682_10000402 | 3300025893 | Bacteria | 19956 |
| 107 | Ga0207710_10075277 | 3300025900 | Bacteria | 1556 |
| 108 | Ga0207688_10000481 | 3300025901 | Bacteria | 19121 |
| 109 | Ga0207645_10074569 | 3300025907 | Bacteria | 2172 |
| 110 | Ga0207645_10214352 | 3300025907 | Bacteria | 1269 |
| 111 | Ga0207643_10000340 | 3300025908 | Bacteria | 31897 |
| 112 | Ga0207707_10068249 | 3300025912 | Bacteria | 3098 |
| 113 | Ga0207652_10201034 | 3300025921 | Bacteria | 1793 |
| 114 | Ga0207650_10053649 | 3300025925 | Bacteria | 2988 |
| 115 | Ga0207650_10078432 | 3300025925 | Bacteria | 2499 |
| 116 | Ga0207650_10174077 | 3300025925 | Bacteria | 1712 |
| 117 | Ga0207687_10089072 | 3300025927 | Bacteria | 2246 |
| 118 | Ga0207706_10129402 | 3300025933 | Unclassified | 2220 |
| 119 | Ga0207686_10009979 | 3300025934 | Bacteria | 5164 |
| 120 | Ga0207686_10013852 | 3300025934 | Bacteria | 4473 |
| 121 | Ga0207704_10117820 | 3300025938 | Bacteria | 1810 |
| 122 | Ga0207665_10164777 | 3300025939 | Bacteria | 1597 |
| 123 | Ga0207691_10024891 | 3300025940 | Bacteria | 5625 |
| 124 | Ga0207691_10131171 | 3300025940 | Bacteria | 2214 |
| 125 | Ga0207689_10004051 | 3300025942 | Bacteria | 13314 |
| 126 | Ga0207679_10038551 | 3300025945 | Bacteria | 3405 |
| 127 | Ga0207667_10092976 | 3300025949 | Bacteria | 3115 |
| 128 | Ga0207667_10135971 | 3300025949 | Bacteria | 2531 |
| 129 | Ga0207712_10154160 | 3300025961 | Bacteria | 1778 |
| 130 | Ga0207677_10007039 | 3300026023 | Bacteria | 6187 |
| 131 | Ga0207677_10012308 | 3300026023 | Bacteria | 4912 |
| 132 | Ga0207677_10116187 | 3300026023 | Bacteria | 2003 |
| 133 | Ga0207677_10145316 | 3300026023 | Bacteria | 1822 |
| 134 | Ga0207708_10010238 | 3300026075 | Bacteria | 6963 |
| 135 | Ga0207702_10484222 | 3300026078 | Bacteria | 1204 |
| 136 | Ga0207648_10267806 | 3300026089 | Bacteria | 1526 |
| 137 | Ga0207676_10099351 | 3300026095 | Bacteria | 2409 |
| 138 | Ga0207676_10266466 | 3300026095 | Bacteria | 1549 |
| 139 | Ga0207674_10161833 | 3300026116 | Bacteria | 2192 |
| 140 | Ga0207675_100236888 | 3300026118 | Bacteria | 1762 |
| 141 | Ga0207683_10044667 | 3300026121 | Unclassified | 3874 |
| 142 | Ga0209969_1001753 | 3300027360 | Bacteria | 2992 |
| 143 | Ga0209967_1000944 | 3300027364 | Bacteria | 3717 |
| 144 | Ga0210000_1003436 | 3300027462 | Bacteria | 2283 |
| 145 | Ga0209999_1000966 | 3300027543 | Bacteria | 4847 |
| 146 | Ga0209971_1009943 | 3300027682 | Bacteria | 2251 |
| 147 | Ga0209974_10007495 | 3300027876 | Bacteria | 3757 |
| 148 | Ga0207428_10028823 | 3300027907 | Plasmid | 4609 |
| 149 | Ga0207428_10069664 | 3300027907 | Bacteria | 2766 |
| 150 | Ga0268264_10102295 | 3300028381 | Bacteria | 2493 |
| 151 | Ga0268264_10122546 | 3300028381 | Bacteria | 2293 |
| 152 | Ga0268264_10318298 | 3300028381 | Bacteria | 1470 |
| 153 | Ga0265319_1009727 | 3300028563 | Bacteria | 4066 |
| 154 | Ga0265338_10013245 | 3300028800 | Bacteria | 9332 |
| 155 | Ga0265320_10052267 | 3300031240 | Bacteria | 1979 |
| 156 | Ga0265316_10118675 | 3300031344 | Bacteria | 1999 |
| 157 | Ga0307416_100175121 | 3300032002 | Bacteria | 2003 |
| 158 | Ga0373930_0010707 | 3300034816 | Bacteria | 1645 |
| 159 | Ga0373958_0002780 | 3300034819 | Bacteria | 2482 |
| 160 | Ga0373959_0001040 | 3300034820 | Bacteria | 4561 |
| 161 | Ga0373938_0008268 | 3300034957 | Bacteria | 1854 |
| 162 | Ga0373928_0001486 | 3300035084 | Bacteria | 4562 |
| 163 | Ga0373940_0001205 | 3300035088 | Bacteria | 4560 |
| 164 | Ga0373949_0004604 | 3300035090 | Bacteria | 3142 |
| 165 | Ga0373951_0001473 | 3300035091 | Bacteria | 6146 |
| 166 | Ga0373952_0009032 | 3300035092 | Bacteria | 1900 |
| 167 | Ga0373936_0168113 | 3300035113 | Bacteria | 958 |
| 168 | Ga0373939_0000529 | 3300035114 | Bacteria | 9592 |
| 169 | Ga0373941_0017079 | 3300035115 | Bacteria | 1982 |
| 170 | Ga0373945_0045241 | 3300035116 | Bacteria | 1603 |
| 171 | Ga0373945_0074066 | 3300035116 | Unclassified | 1294 |
| 172 | Ga0373960_0005820 | 3300035121 | Bacteria | 2867 |
| 173 | Ga0373943_0050298 | 3300035170 | Bacteria | 2048 |
| 174 | Ga0373946_0000932 | 3300035171 | Bacteria | 10016 |
| 175 | Ga0373942_0000407 | 3300035207 | Bacteria | 11965 |
| 176 | Ga0373961_0000874 | 3300035241 | Bacteria | 10149 |
| 177 | Ga0373962_0000227 | 3300035242 | Bacteria | 11822 |
| 178 | Ga0373924_0005612 | 3300035410 | Bacteria | 4450 |
| 179 | Ga0373931_0005692 | 3300035691 | Bacteria | 5789 |
| 180 | Ga0373935_0311549 | 3300035692 | Bacteria | 1115 |
| 181 | Ga0373947_0009090 | 3300035725 | Bacteria | 5710 |
| 182 | Ga0373925_0011134 | 3300037068 | Bacteria | 6524 |
| 183 | Ga0395900_0291424 | 3300037418 | Bacteria | 1621 |
| 184 | Ga0450894_009132 | 3300042131 | Bacteria | 1284 |
| 185 | Ga0450896_008348 | 3300042133 | Bacteria | 1435 |
| 186 | Ga0450908_007090 | 3300042184 | Bacteria | 2118 |
| 187 | Ga0450918_011879 | 3300042531 | Bacteria | 1518 |
| 188 | Ga0451577_0167276 | 3300042876 | Bacteria | 1981 |
| 189 | Ga0453684_0089679 | 3300044712 | Bacteria | 3802 |
| 190 | Ga0451576_0006468 | 3300045051 | Bacteria | 14357 |
| 191 | Ga0495603_0055750 | 3300046455 | Bacteria | 2341 |
| 192 | Ga0495651_0000874 | 3300046462 | Bacteria | 23391 |
| 193 | Ga0495580_0173677 | 3300046472 | Bacteria | 1489 |
| 194 | Ga0495608_0027343 | 3300046511 | Bacteria | 3881 |
| 195 | Ga0495628_0014947 | 3300046516 | Bacteria | 6493 |
| 196 | Ga0495586_0083868 | 3300046535 | Bacteria | 1754 |
| 197 | Ga0495667_0019410 | 3300046559 | Bacteria | 4586 |
| 198 | Ga0495588_0009288 | 3300046674 | Bacteria | 4540 |
| 199 | Ga0495599_0076796 | 3300046678 | Bacteria | 2086 |
| 200 | Ga0495658_0017598 | 3300046683 | Bacteria | 3696 |
| 201 | Ga0495613_0002594 | 3300046689 | Bacteria | 13577 |
| 202 | Ga0495600_0023521 | 3300046809 | Bacteria | 3964 |
| 203 | Ga0495674_0009802 | 3300047319 | Bacteria | 9096 |
| 204 | Ga0495676_0140686 | 3300047321 | Bacteria | 1730 |
| 205 | Ga0495680_0000742 | 3300047322 | Bacteria | 36551 |
| 206 | Ga0495684_0001701 | 3300047471 | Bacteria | 17687 |
| 207 | Ga0496102_0182923 | 3300048905 | Bacteria | 1975 |
| 208 | Ga0496104_0023012 | 3300048907 | Bacteria | 5726 |
| 209 | Ga0496105_0134458 | 3300048908 | Bacteria | 2037 |
| 210 | Ga0496106_0080504 | 3300048909 | Bacteria | 2501 |
| 211 | Ga0496110_0013169 | 3300048913 | Bacteria | 6830 |
| 212 | Ga0496114_0057889 | 3300048917 | Bacteria | 3236 |
| 213 | Ga0496114_0115351 | 3300048917 | Bacteria | 2305 |
| 214 | Ga0496114_0325240 | 3300048917 | Bacteria | 1359 |
| 215 | Ga0496115_0198742 | 3300048918 | Bacteria | 1656 |
| 216 | Ga0501075_0125986 | 3300049591 | Bacteria | 1950 |
| 217 | nmdc:mga0k408_149487_c1 | 3300050493 | Bacteria | 1391 |
| 218 | nmdc:mga05p37_3363_c1 | 3300050507 | Bacteria | 18664 |
| 219 | nmdc:mga05p37_49_c1 | 3300050507 | Bacteria | 103776 |
| 220 | nmdc:mga09592_282251_c1 | 3300050508 | Bacteria | 1440 |
| 221 | nmdc:mga0qj67_251421_c1 | 3300050509 | Bacteria | 1434 |
| 222 | nmdc:mga0qj67_336473_c1 | 3300050509 | Bacteria | 1221 |
| 223 | nmdc:mga0qj67_50157_c1 | 3300050509 | Unclassified | 3300 |
| 224 | nmdc:mga06r32_20884_c1 | 3300050510 | Bacteria | 6036 |
| 225 | nmdc:mga08y16_112913_c1 | 3300050511 | Bacteria | 2829 |
| 226 | nmdc:mga08y16_71667_c1 | 3300050511 | Plasmid | 3611 |
| 227 | nmdc:mga0n895_132565_c1 | 3300050512 | Unclassified | 2517 |
| 228 | nmdc:mga0n895_139365_c1 | 3300050512 | Unclassified | 2453 |
| 229 | nmdc:mga0n895_14946_c1 | 3300050512 | Bacteria | 7072 |
| 230 | nmdc:mga0n895_3160_c1 | 3300050512 | Bacteria | 13158 |
| 231 | nmdc:mga0n895_411103_c1 | 3300050512 | Bacteria | 1368 |
| 232 | nmdc:mga0rr50_19480_c1 | 3300050513 | Bacteria | 4582 |
| 233 | nmdc:mga0rr50_298132_c1 | 3300050513 | Bacteria | 1348 |
| 234 | nmdc:mga0rr50_29947_c1 | 3300050513 | Bacteria | 3846 |
| 235 | nmdc:mga08x19_230130_c1 | 3300050514 | Bacteria | 1276 |
| 236 | nmdc:mga08x19_30222_c1 | 3300050514 | Bacteria | 3403 |
| 237 | nmdc:mga0a205_33210_c1 | 3300050515 | Bacteria | 4948 |
| 238 | Ga0495601_0006056 | 3300053077 | Bacteria | 7058 |
| 239 | Ga0495595_0008864 | 3300053084 | Bacteria | 4143 |
| 240 | Ga0500566_0170366 | 3300053094 | Bacteria | 1126 |
| 241 | Ga0501084_0313748 | 3300054114 | Bacteria | 1324 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042133 | Ga0450896_008348 | Ga0450896_008348_156_1154 | 293 |
| 2 | 3300035170 | Ga0373943_0050298 | Ga0373943_0050298_53_1045 | 297 |
| 3 | 3300050512 | nmdc:mga0n895_411103_c1 | nmdc:mga0n895_411103_c1_428_1339 | 298 |
| 4 | 3300006880 | Ga0075429_100287224 | Ga0075429_1002872242 | 300 |
| 5 | 3300035113 | Ga0373936_0168113 | Ga0373936_0168113_36_941 | 300 |
| 6 | 3300050508 | nmdc:mga09592_282251_c1 | nmdc:mga09592_282251_c1_219_1214 | 300 |
| 7 | 3300007076 | Ga0075435_100001806 | Ga0075435_10000180612 | 305 |
| 8 | 3300026078 | Ga0207702_10484222 | Ga0207702_104842221 | 305 |
| 9 | 3300046535 | Ga0495586_0083868 | Ga0495586_0083868_776_1708 | 305 |
| 10 | 3300035692 | Ga0373935_0311549 | Ga0373935_0311549_73_1065 | 307 |
| 11 | 3300027360 | Ga0209969_1001753 | Ga0209969_10017534 | 308 |
| 12 | 3300027364 | Ga0209967_1000944 | Ga0209967_10009445 | 308 |
| 13 | 3300027462 | Ga0210000_1003436 | Ga0210000_10034362 | 308 |
| 14 | 3300027682 | Ga0209971_1009943 | Ga0209971_10099434 | 308 |
| 15 | 3300046683 | Ga0495658_0017598 | Ga0495658_0017598_2441_3433 | 309 |
| 16 | 3300006844 | Ga0075428_100005775 | Ga0075428_10000577511 | 313 |
| 17 | 3300006846 | Ga0075430_100060314 | Ga0075430_1000603145 | 313 |
| 18 | 3300006847 | Ga0075431_100039575 | Ga0075431_1000395755 | 313 |
| 19 | 3300006880 | Ga0075429_100064722 | Ga0075429_1000647222 | 313 |
| 20 | 3300009147 | Ga0114129_10012920 | Ga0114129_100129207 | 313 |
| 21 | 3300050507 | nmdc:mga05p37_3363_c1 | nmdc:mga05p37_3363_c1_12285_13268 | 313 |
| 22 | 3300050509 | nmdc:mga0qj67_50157_c1 | nmdc:mga0qj67_50157_c1_2126_3109 | 313 |
| 23 | 3300050510 | nmdc:mga06r32_20884_c1 | nmdc:mga06r32_20884_c1_1752_2735 | 313 |
| 24 | 3300037418 | Ga0395900_0291424 | Ga0395900_0291424_487_1464 | 315 |
| 25 | 3300042131 | Ga0450894_009132 | Ga0450894_009132_70_1113 | 315 |
| 26 | 3300042184 | Ga0450908_007090 | Ga0450908_007090_839_1882 | 315 |
| 27 | 3300042531 | Ga0450918_011879 | Ga0450918_011879_409_1452 | 315 |
| 28 | 3300005459 | Ga0068867_100008585 | Ga0068867_1000085856 | 317 |
| 29 | 3300006237 | Ga0097621_100034837 | Ga0097621_1000348373 | 317 |
| 30 | 3300006358 | Ga0068871_100015063 | Ga0068871_1000150632 | 317 |
| 31 | 3300006881 | Ga0068865_100002762 | Ga0068865_1000027622 | 317 |
| 32 | 3300009176 | Ga0105242_10007267 | Ga0105242_100072674 | 317 |
| 33 | 3300009177 | Ga0105248_10298428 | Ga0105248_102984282 | 317 |
| 34 | 3300013306 | Ga0163162_10282965 | Ga0163162_102829652 | 317 |
| 35 | 3300014969 | Ga0157376_10025459 | Ga0157376_100254592 | 317 |
| 36 | 3300025927 | Ga0207687_10089072 | Ga0207687_100890722 | 317 |
| 37 | 3300025934 | Ga0207686_10009979 | Ga0207686_100099795 | 317 |
| 38 | 3300026023 | Ga0207677_10116187 | Ga0207677_101161872 | 317 |
| 39 | 3300027543 | Ga0209999_1000966 | Ga0209999_10009662 | 317 |
| 40 | 3300048917 | Ga0496114_0115351 | Ga0496114_0115351_916_1890 | 317 |
| 41 | 3300005338 | Ga0068868_100042621 | Ga0068868_1000426212 | 319 |
| 42 | 3300005459 | Ga0068867_100248590 | Ga0068867_1002485902 | 319 |
| 43 | 3300005548 | Ga0070665_100009349 | Ga0070665_1000093495 | 319 |
| 44 | 3300005834 | Ga0068851_10126536 | Ga0068851_101265361 | 319 |
| 45 | 3300005842 | Ga0068858_100010573 | Ga0068858_1000105733 | 319 |
| 46 | 3300006881 | Ga0068865_100128821 | Ga0068865_1001288212 | 319 |
| 47 | 3300009098 | Ga0105245_10029805 | Ga0105245_100298052 | 319 |
| 48 | 3300009101 | Ga0105247_10114305 | Ga0105247_101143052 | 319 |
| 49 | 3300009176 | Ga0105242_10001435 | Ga0105242_100014359 | 319 |
| 50 | 3300009177 | Ga0105248_10008180 | Ga0105248_1000818010 | 319 |
| 51 | 3300011119 | Ga0105246_10167005 | Ga0105246_101670052 | 319 |
| 52 | 3300014968 | Ga0157379_10024219 | Ga0157379_100242193 | 319 |
| 53 | 3300014969 | Ga0157376_10044298 | Ga0157376_100442982 | 319 |
| 54 | 3300025900 | Ga0207710_10075277 | Ga0207710_100752772 | 319 |
| 55 | 3300025934 | Ga0207686_10013852 | Ga0207686_100138522 | 319 |
| 56 | 3300026023 | Ga0207677_10012308 | Ga0207677_100123083 | 319 |
| 57 | 3300026089 | Ga0207648_10267806 | Ga0207648_102678061 | 319 |
| 58 | 3300028381 | Ga0268264_10102295 | Ga0268264_101022951 | 319 |
| 59 | 3300005331 | Ga0070670_100106917 | Ga0070670_1001069172 | 320 |
| 60 | 3300005617 | Ga0068859_100509702 | Ga0068859_1005097022 | 320 |
| 61 | 3300006931 | Ga0097620_100509679 | Ga0097620_1005096792 | 320 |
| 62 | 3300009098 | Ga0105245_10059098 | Ga0105245_100590983 | 320 |
| 63 | 3300025925 | Ga0207650_10078432 | Ga0207650_100784322 | 320 |
| 64 | 3300026095 | Ga0207676_10266466 | Ga0207676_102664661 | 320 |
| 65 | 3300005330 | Ga0070690_100008060 | Ga0070690_1000080603 | 321 |
| 66 | 3300005338 | Ga0068868_100137726 | Ga0068868_1001377262 | 321 |
| 67 | 3300005615 | Ga0070702_100011618 | Ga0070702_1000116182 | 321 |
| 68 | 3300026023 | Ga0207677_10145316 | Ga0207677_101453162 | 321 |
| 69 | 3300048917 | Ga0496114_0057889 | Ga0496114_0057889_1211_2197 | 321 |
| 70 | 3300005355 | Ga0070671_100096042 | Ga0070671_1000960421 | 324 |
| 71 | 3300005458 | Ga0070681_10051671 | Ga0070681_100516713 | 324 |
| 72 | 3300005547 | Ga0070693_100088498 | Ga0070693_1000884982 | 324 |
| 73 | 3300005563 | Ga0068855_100078218 | Ga0068855_1000782185 | 324 |
| 74 | 3300005577 | Ga0068857_100281529 | Ga0068857_1002815291 | 324 |
| 75 | 3300005614 | Ga0068856_100148654 | Ga0068856_1001486542 | 324 |
| 76 | 3300006195 | Ga0075366_10074586 | Ga0075366_100745862 | 324 |
| 77 | 3300006871 | Ga0075434_100544844 | Ga0075434_1005448442 | 324 |
| 78 | 3300009093 | Ga0105240_10168722 | Ga0105240_101687223 | 324 |
| 79 | 3300013307 | Ga0157372_10178831 | Ga0157372_101788315 | 324 |
| 80 | 3300025912 | Ga0207707_10068249 | Ga0207707_100682493 | 324 |
| 81 | 3300025921 | Ga0207652_10201034 | Ga0207652_102010342 | 324 |
| 82 | 3300025949 | Ga0207667_10092976 | Ga0207667_100929763 | 324 |
| 83 | 3300025949 | Ga0207667_10135971 | Ga0207667_101359712 | 324 |
| 84 | 3300034816 | Ga0373930_0010707 | Ga0373930_0010707_526_1632 | 324 |
| 85 | 3300034819 | Ga0373958_0002780 | Ga0373958_0002780_784_1890 | 324 |
| 86 | 3300034820 | Ga0373959_0001040 | Ga0373959_0001040_2860_3966 | 324 |
| 87 | 3300034957 | Ga0373938_0008268 | Ga0373938_0008268_691_1797 | 324 |
| 88 | 3300035084 | Ga0373928_0001486 | Ga0373928_0001486_2784_3890 | 324 |
| 89 | 3300035088 | Ga0373940_0001205 | Ga0373940_0001205_1645_2751 | 324 |
| 90 | 3300035090 | Ga0373949_0004604 | Ga0373949_0004604_1962_3068 | 324 |
| 91 | 3300035091 | Ga0373951_0001473 | Ga0373951_0001473_1069_2175 | 324 |
| 92 | 3300035092 | Ga0373952_0009032 | Ga0373952_0009032_532_1638 | 324 |
| 93 | 3300035114 | Ga0373939_0000529 | Ga0373939_0000529_4139_5245 | 324 |
| 94 | 3300035115 | Ga0373941_0017079 | Ga0373941_0017079_408_1514 | 324 |
| 95 | 3300035121 | Ga0373960_0005820 | Ga0373960_0005820_1277_2383 | 324 |
| 96 | 3300035207 | Ga0373942_0000407 | Ga0373942_0000407_9590_10696 | 324 |
| 97 | 3300035241 | Ga0373961_0000874 | Ga0373961_0000874_3381_4487 | 324 |
| 98 | 3300035242 | Ga0373962_0000227 | Ga0373962_0000227_5968_7074 | 324 |
| 99 | 3300035691 | Ga0373931_0005692 | Ga0373931_0005692_412_1518 | 324 |
| 100 | 3300045051 | Ga0451576_0006468 | Ga0451576_0006468_1393_2511 | 324 |
| 101 | 3300048908 | Ga0496105_0134458 | Ga0496105_0134458_151_1140 | 324 |
| 102 | 3300048917 | Ga0496114_0325240 | Ga0496114_0325240_288_1262 | 324 |
| 103 | 3300050493 | nmdc:mga0k408_149487_c1 | nmdc:mga0k408_149487_c1_200_1177 | 324 |
| 104 | 3300006844 | Ga0075428_100148703 | Ga0075428_1001487033 | 325 |
| 105 | 3300009147 | Ga0114129_10088392 | Ga0114129_100883923 | 325 |
| 106 | 3300035116 | Ga0373945_0045241 | Ga0373945_0045241_192_1169 | 325 |
| 107 | 3300035116 | Ga0373945_0074066 | Ga0373945_0074066_171_1148 | 325 |
| 108 | 3300035171 | Ga0373946_0000932 | Ga0373946_0000932_4291_5268 | 325 |
| 109 | 3300035410 | Ga0373924_0005612 | Ga0373924_0005612_1422_2399 | 325 |
| 110 | 3300035725 | Ga0373947_0009090 | Ga0373947_0009090_4447_5424 | 325 |
| 111 | 3300037068 | Ga0373925_0011134 | Ga0373925_0011134_1965_2942 | 325 |
| 112 | 3300046516 | Ga0495628_0014947 | Ga0495628_0014947_3528_4505 | 325 |
| 113 | 3300046678 | Ga0495599_0076796 | Ga0495599_0076796_490_1467 | 325 |
| 114 | 3300048905 | Ga0496102_0182923 | Ga0496102_0182923_236_1216 | 325 |
| 115 | 3300050507 | nmdc:mga05p37_49_c1 | nmdc:mga05p37_49_c1_101541_102518 | 325 |
| 116 | 3300005295 | Ga0065707_10001858 | Ga0065707_100018586 | 326 |
| 117 | 3300005331 | Ga0070670_100050723 | Ga0070670_1000507235 | 326 |
| 118 | 3300005331 | Ga0070670_100255240 | Ga0070670_1002552402 | 326 |
| 119 | 3300005333 | Ga0070677_10000420 | Ga0070677_100004205 | 326 |
| 120 | 3300005334 | Ga0068869_100075997 | Ga0068869_1000759973 | 326 |
| 121 | 3300005340 | Ga0070689_100029180 | Ga0070689_1000291805 | 326 |
| 122 | 3300005365 | Ga0070688_100186220 | Ga0070688_1001862201 | 326 |
| 123 | 3300005367 | Ga0070667_100010789 | Ga0070667_1000107899 | 326 |
| 124 | 3300005367 | Ga0070667_100226924 | Ga0070667_1002269242 | 326 |
| 125 | 3300005438 | Ga0070701_10035150 | Ga0070701_100351502 | 326 |
| 126 | 3300005440 | Ga0070705_100061991 | Ga0070705_1000619913 | 326 |
| 127 | 3300005441 | Ga0070700_100070890 | Ga0070700_1000708903 | 326 |
| 128 | 3300005441 | Ga0070700_100143542 | Ga0070700_1001435421 | 326 |
| 129 | 3300005444 | Ga0070694_100023665 | Ga0070694_1000236653 | 326 |
| 130 | 3300005444 | Ga0070694_100028635 | Ga0070694_1000286352 | 326 |
| 131 | 3300005468 | Ga0070707_100028266 | Ga0070707_1000282664 | 326 |
| 132 | 3300005536 | Ga0070697_100316293 | Ga0070697_1003162931 | 326 |
| 133 | 3300005543 | Ga0070672_100023381 | Ga0070672_1000233814 | 326 |
| 134 | 3300005544 | Ga0070686_100031482 | Ga0070686_1000314823 | 326 |
| 135 | 3300005545 | Ga0070695_100007891 | Ga0070695_1000078915 | 326 |
| 136 | 3300005547 | Ga0070693_100142309 | Ga0070693_1001423092 | 326 |
| 137 | 3300005549 | Ga0070704_100038093 | Ga0070704_1000380932 | 326 |
| 138 | 3300005549 | Ga0070704_100177734 | Ga0070704_1001777342 | 326 |
| 139 | 3300005564 | Ga0070664_100044542 | Ga0070664_1000445422 | 326 |
| 140 | 3300005616 | Ga0068852_100310303 | Ga0068852_1003103032 | 326 |
| 141 | 3300005617 | Ga0068859_100095266 | Ga0068859_1000952662 | 326 |
| 142 | 3300005617 | Ga0068859_100258615 | Ga0068859_1002586151 | 326 |
| 143 | 3300005618 | Ga0068864_100404384 | Ga0068864_1004043841 | 326 |
| 144 | 3300005840 | Ga0068870_10000546 | Ga0068870_1000054620 | 326 |
| 145 | 3300005842 | Ga0068858_100011597 | Ga0068858_1000115973 | 326 |
| 146 | 3300005843 | Ga0068860_100100748 | Ga0068860_1001007482 | 326 |
| 147 | 3300006844 | Ga0075428_100075575 | Ga0075428_1000755752 | 326 |
| 148 | 3300006852 | Ga0075433_10000251 | Ga0075433_100002515 | 326 |
| 149 | 3300006871 | Ga0075434_100110478 | Ga0075434_1001104782 | 326 |
| 150 | 3300006871 | Ga0075434_100313147 | Ga0075434_1003131473 | 326 |
| 151 | 3300006881 | Ga0068865_100026865 | Ga0068865_1000268652 | 326 |
| 152 | 3300006914 | Ga0075436_100021785 | Ga0075436_1000217854 | 326 |
| 153 | 3300006914 | Ga0075436_100037687 | Ga0075436_1000376872 | 326 |
| 154 | 3300006931 | Ga0097620_100095256 | Ga0097620_1000952562 | 326 |
| 155 | 3300006931 | Ga0097620_100258602 | Ga0097620_1002586023 | 326 |
| 156 | 3300006931 | Ga0097620_100418760 | Ga0097620_1004187602 | 326 |
| 157 | 3300007076 | Ga0075435_100025708 | Ga0075435_1000257082 | 326 |
| 158 | 3300007076 | Ga0075435_100308588 | Ga0075435_1003085881 | 326 |
| 159 | 3300009094 | Ga0111539_10011239 | Ga0111539_100112392 | 326 |
| 160 | 3300009094 | Ga0111539_10021064 | Ga0111539_100210647 | 326 |
| 161 | 3300009094 | Ga0111539_10058465 | Ga0111539_100584652 | 326 |
| 162 | 3300009147 | Ga0114129_10335613 | Ga0114129_103356132 | 326 |
| 163 | 3300009177 | Ga0105248_10018188 | Ga0105248_100181882 | 326 |
| 164 | 3300009177 | Ga0105248_10048491 | Ga0105248_100484913 | 326 |
| 165 | 3300009177 | Ga0105248_10418826 | Ga0105248_104188261 | 326 |
| 166 | 3300009553 | Ga0105249_10002679 | Ga0105249_1000267913 | 326 |
| 167 | 3300009553 | Ga0105249_10122063 | Ga0105249_101220634 | 326 |
| 168 | 3300011119 | Ga0105246_10040903 | Ga0105246_100409033 | 326 |
| 169 | 3300013306 | Ga0163162_10116413 | Ga0163162_101164132 | 326 |
| 170 | 3300013308 | Ga0157375_10112145 | Ga0157375_101121452 | 326 |
| 171 | 3300014969 | Ga0157376_10001026 | Ga0157376_100010266 | 326 |
| 172 | 3300017792 | Ga0163161_10034480 | Ga0163161_100344803 | 326 |
| 173 | 3300025315 | Ga0207697_10001459 | Ga0207697_1000145917 | 326 |
| 174 | 3300025893 | Ga0207682_10000402 | Ga0207682_1000040222 | 326 |
| 175 | 3300025901 | Ga0207688_10000481 | Ga0207688_100004813 | 326 |
| 176 | 3300025907 | Ga0207645_10074569 | Ga0207645_100745692 | 326 |
| 177 | 3300025907 | Ga0207645_10214352 | Ga0207645_102143521 | 326 |
| 178 | 3300025908 | Ga0207643_10000340 | Ga0207643_1000034015 | 326 |
| 179 | 3300025925 | Ga0207650_10053649 | Ga0207650_100536494 | 326 |
| 180 | 3300025925 | Ga0207650_10174077 | Ga0207650_101740772 | 326 |
| 181 | 3300025933 | Ga0207706_10129402 | Ga0207706_101294021 | 326 |
| 182 | 3300025938 | Ga0207704_10117820 | Ga0207704_101178202 | 326 |
| 183 | 3300025939 | Ga0207665_10164777 | Ga0207665_101647772 | 326 |
| 184 | 3300025940 | Ga0207691_10024891 | Ga0207691_100248913 | 326 |
| 185 | 3300025940 | Ga0207691_10131171 | Ga0207691_101311713 | 326 |
| 186 | 3300025942 | Ga0207689_10004051 | Ga0207689_1000405110 | 326 |
| 187 | 3300025945 | Ga0207679_10038551 | Ga0207679_100385513 | 326 |
| 188 | 3300025961 | Ga0207712_10154160 | Ga0207712_101541601 | 326 |
| 189 | 3300026023 | Ga0207677_10007039 | Ga0207677_100070392 | 326 |
| 190 | 3300026075 | Ga0207708_10010238 | Ga0207708_100102385 | 326 |
| 191 | 3300026095 | Ga0207676_10099351 | Ga0207676_100993512 | 326 |
| 192 | 3300026116 | Ga0207674_10161833 | Ga0207674_101618331 | 326 |
| 193 | 3300026118 | Ga0207675_100236888 | Ga0207675_1002368882 | 326 |
| 194 | 3300026121 | Ga0207683_10044667 | Ga0207683_100446673 | 326 |
| 195 | 3300027876 | Ga0209974_10007495 | Ga0209974_100074953 | 326 |
| 196 | 3300027907 | Ga0207428_10028823 | Ga0207428_100288232 | 326 |
| 197 | 3300027907 | Ga0207428_10069664 | Ga0207428_100696643 | 326 |
| 198 | 3300028381 | Ga0268264_10122546 | Ga0268264_101225463 | 326 |
| 199 | 3300028381 | Ga0268264_10318298 | Ga0268264_103182981 | 326 |
| 200 | 3300028563 | Ga0265319_1009727 | Ga0265319_10097272 | 326 |
| 201 | 3300028800 | Ga0265338_10013245 | Ga0265338_100132456 | 326 |
| 202 | 3300031240 | Ga0265320_10052267 | Ga0265320_100522673 | 326 |
| 203 | 3300031344 | Ga0265316_10118675 | Ga0265316_101186752 | 326 |
| 204 | 3300032002 | Ga0307416_100175121 | Ga0307416_1001751211 | 326 |
| 205 | 3300042876 | Ga0451577_0167276 | Ga0451577_0167276_400_1380 | 326 |
| 206 | 3300044712 | Ga0453684_0089679 | Ga0453684_0089679_1690_2670 | 326 |
| 207 | 3300046455 | Ga0495603_0055750 | Ga0495603_0055750_1008_1988 | 326 |
| 208 | 3300046462 | Ga0495651_0000874 | Ga0495651_0000874_16827_17828 | 326 |
| 209 | 3300046472 | Ga0495580_0173677 | Ga0495580_0173677_351_1373 | 326 |
| 210 | 3300046511 | Ga0495608_0027343 | Ga0495608_0027343_327_1349 | 326 |
| 211 | 3300046559 | Ga0495667_0019410 | Ga0495667_0019410_2901_3902 | 326 |
| 212 | 3300046674 | Ga0495588_0009288 | Ga0495588_0009288_3279_4259 | 326 |
| 213 | 3300046689 | Ga0495613_0002594 | Ga0495613_0002594_4963_5985 | 326 |
| 214 | 3300046809 | Ga0495600_0023521 | Ga0495600_0023521_1779_2780 | 326 |
| 215 | 3300047319 | Ga0495674_0009802 | Ga0495674_0009802_6098_7120 | 326 |
| 216 | 3300047321 | Ga0495676_0140686 | Ga0495676_0140686_535_1515 | 326 |
| 217 | 3300047322 | Ga0495680_0000742 | Ga0495680_0000742_16959_17960 | 326 |
| 218 | 3300047471 | Ga0495684_0001701 | Ga0495684_0001701_9885_10907 | 326 |
| 219 | 3300048907 | Ga0496104_0023012 | Ga0496104_0023012_3171_4157 | 326 |
| 220 | 3300048909 | Ga0496106_0080504 | Ga0496106_0080504_356_1537 | 326 |
| 221 | 3300048913 | Ga0496110_0013169 | Ga0496110_0013169_1693_2679 | 326 |
| 222 | 3300048918 | Ga0496115_0198742 | Ga0496115_0198742_619_1605 | 326 |
| 223 | 3300049591 | Ga0501075_0125986 | Ga0501075_0125986_194_1183 | 326 |
| 224 | 3300050509 | nmdc:mga0qj67_251421_c1 | nmdc:mga0qj67_251421_c1_177_1292 | 326 |
| 225 | 3300050509 | nmdc:mga0qj67_336473_c1 | nmdc:mga0qj67_336473_c1_16_1011 | 326 |
| 226 | 3300050511 | nmdc:mga08y16_112913_c1 | nmdc:mga08y16_112913_c1_173_1165 | 326 |
| 227 | 3300050511 | nmdc:mga08y16_71667_c1 | nmdc:mga08y16_71667_c1_1017_2024 | 326 |
| 228 | 3300050512 | nmdc:mga0n895_132565_c1 | nmdc:mga0n895_132565_c1_177_1169 | 326 |
| 229 | 3300050512 | nmdc:mga0n895_139365_c1 | nmdc:mga0n895_139365_c1_406_1401 | 326 |
| 230 | 3300050512 | nmdc:mga0n895_14946_c1 | nmdc:mga0n895_14946_c1_87_1073 | 326 |
| 231 | 3300050512 | nmdc:mga0n895_3160_c1 | nmdc:mga0n895_3160_c1_5644_6636 | 326 |
| 232 | 3300050513 | nmdc:mga0rr50_19480_c1 | nmdc:mga0rr50_19480_c1_109_1095 | 326 |
| 233 | 3300050513 | nmdc:mga0rr50_298132_c1 | nmdc:mga0rr50_298132_c1_329_1312 | 326 |
| 234 | 3300050513 | nmdc:mga0rr50_29947_c1 | nmdc:mga0rr50_29947_c1_1172_2164 | 326 |
| 235 | 3300050514 | nmdc:mga08x19_230130_c1 | nmdc:mga08x19_230130_c1_113_1132 | 326 |
| 236 | 3300050514 | nmdc:mga08x19_30222_c1 | nmdc:mga08x19_30222_c1_14_1039 | 326 |
| 237 | 3300050515 | nmdc:mga0a205_33210_c1 | nmdc:mga0a205_33210_c1_3913_4905 | 326 |
| 238 | 3300053077 | Ga0495601_0006056 | Ga0495601_0006056_3386_4408 | 326 |
| 239 | 3300053084 | Ga0495595_0008864 | Ga0495595_0008864_2123_3145 | 326 |
| 240 | 3300053094 | Ga0500566_0170366 | Ga0500566_0170366_53_1036 | 326 |
| 241 | 3300054114 | Ga0501084_0313748 | Ga0501084_0313748_185_1165 | 326 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3gg9-assembly2.cif.gz_B | crystal structure of putative d-3-phosphoglycerate dehydrogenase oxidoreductase from ralstonia solanacearum | 0.9626 | 2 | 322 |
| 3gg9-assembly2.cif.gz_C | crystal structure of putative d-3-phosphoglycerate dehydrogenase oxidoreductase from ralstonia solanacearum | 0.9616 | 1 | 322 |
| 4s1v-assembly1.cif.gz_B | crystal structure of phosphoglycerate oxidoreductase from vibrio cholerae o395 | 0.9562 | 1 | 311 |
| 3gg9-assembly2.cif.gz_C | crystal structure of putative d-3-phosphoglycerate dehydrogenase oxidoreductase from ralstonia solanacearum | 0.9472 | 1 | 322 |
| 3gg9-assembly2.cif.gz_B | crystal structure of putative d-3-phosphoglycerate dehydrogenase oxidoreductase from ralstonia solanacearum | 0.9452 | 2 | 322 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4s1vD02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9675 | 105 | 290 | 3.40.50.720 |
| 3gg9C01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9628 | 1 | 99 | 3.40.50.720 |
| 4s1vA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9448 | 1 | 100 | 3.40.50.720 |
| 4s1vD02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9377 | 105 | 290 | 3.40.50.720 |
| af_Q7XRA3_150_294_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9362 | 140 | 290 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A820NVB4-F1-model_v4 | D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding domain-containing protein | 1 | 141 | 282 |
GO:0016491
GO:0051287 |
| AF-A0A6I2IYD8-F1-model_v4 | deleted | 0.9993 | 141 | 267 |
|
| AF-A0A820NVB4-F1-model_v4 | D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding domain-containing protein | 0.9932 | 141 | 282 |
GO:0016491
GO:0051287 |
| AF-A0A6I2IYD8-F1-model_v4 | deleted | 0.9915 | 141 | 267 |
|
| AF-A0A821D8N8-F1-model_v4 | methionine synthase (EC 2.1.1.13) (5-methyltetrahydrofolate--homocysteine methyltransferase) (Vitamin-B12 dependent methionine synthase) | 0.9913 | 1 | 326 |
GO:0005829
GO:0008705 GO:0016616 GO:0031419 GO:0032259 GO:0046653 GO:0046872 GO:0050667 GO:0051287 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar