F353413

General Info

Members Datasets Scaffolds Average Seq Length
241 123 482 230

Family's Representative Sequence

Representative Sequence 3300003373|JGI25407J50210_10001063|JGI25407J50210_100010634
Length 246
Sequence MTPPGEAAAGTTGTPAAAAPSRVLVVDDESPMLRALGTNLRARRYQVDLARTGEEALHLAARHRPDAVILDLGLPGISGIEVIEGLRGWTAVPIIILSARGAEHDKVAALDAGADDYVTKPFGMDELLARLRAALRRIAPAPESAMVETPDFTVDLAAKRVTGPDGEVRLTPTEWGLVEVLVRNAGKLVSQRQLLQDVWGPNYGEETNYLRVHMAHIRRKLEPDPSRPRYFLTEPGMGYRFTGPDG

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
14 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
17 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
18 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
19 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
20 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
21 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
22 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
23 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
24 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
25 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
39 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
48 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
49 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
51 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
52 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
53 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
54 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
55 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
56 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
57 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
58 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
59 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
60 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
61 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
62 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
63 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
64 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
65 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
66 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
67 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
68 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
69 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
70 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
71 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
72 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
73 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
74 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
75 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
76 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
77 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
78 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
79 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
81 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
93 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
94 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
95 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
96 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
97 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
98 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
99 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
100 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
101 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
102 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
103 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
104 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
105 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
108 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
109 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
110 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
111 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
112 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
113 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
114 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
115 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
116 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
117 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
118 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
119 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
120 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
121 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
122 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
123 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.14
Nodule 0
Rhizoplane 6.22
Rhizosphere 67.22
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10001063 3300003373 Bacteria 6032
2 Ga0065704_10163973 3300005289 Bacteria 1335
3 Ga0070683_100250992 3300005329 Bacteria 1683
4 Ga0070690_100052348 3300005330 Bacteria 2610
5 Ga0070668_100120764 3300005347 Bacteria 2094
6 Ga0070688_100033352 3300005365 Bacteria 3112
7 Ga0070714_100286927 3300005435 Bacteria 1531
8 Ga0070700_100050216 3300005441 Bacteria 2593
9 Ga0068867_100006194 3300005459 Bacteria 8472
10 Ga0070698_100027465 3300005471 Bacteria 5919
11 Ga0070686_100025153 3300005544 Bacteria 3578
12 Ga0068856_100067892 3300005614 Bacteria 3524
13 Ga0068860_100036186 3300005843 Bacteria 4732
14 Ga0068862_100266591 3300005844 Bacteria 1565
15 Ga0081455_10011754 3300005937 Bacteria 8768
16 Ga0081455_10087760 3300005937 Bacteria 2530
17 Ga0081538_10001293 3300005981 Bacteria 25953
18 Ga0081538_10002593 3300005981 Bacteria 17531
19 Ga0081538_10012797 3300005981 Bacteria 6700
20 Ga0075365_10001783 3300006038 Bacteria 10040
21 Ga0075365_10003870 3300006038 Bacteria 7827
22 Ga0075365_10007119 3300006038 Bacteria 6240
23 Ga0075365_10007193 3300006038 Bacteria 6214
24 Ga0075365_10022401 3300006038 Bacteria 3958
25 Ga0075365_10086671 3300006038 Bacteria 2128
26 Ga0075365_10209752 3300006038 Bacteria 1365
27 Ga0075365_10228032 3300006038 Bacteria 1307
28 Ga0075365_10350326 3300006038 Bacteria 1041
29 Ga0075368_10022409 3300006042 Bacteria 2405
30 Ga0075363_100002059 3300006048 Bacteria 8036
31 Ga0075363_100011091 3300006048 Bacteria 4305
32 Ga0075363_100015618 3300006048 Bacteria 3735
33 Ga0075363_100032796 3300006048 Bacteria 2700
34 Ga0075363_100060786 3300006048 Bacteria 2035
35 Ga0075363_100222405 3300006048 Bacteria 1082
36 Ga0075363_100265850 3300006048 Bacteria 990
37 Ga0075364_10039335 3300006051 Bacteria 3065
38 Ga0075364_10042482 3300006051 Bacteria 2954
39 Ga0075364_10058335 3300006051 Bacteria 2530
40 Ga0075364_10086359 3300006051 Bacteria 2078
41 Ga0075364_10091238 3300006051 Bacteria 2021
42 Ga0075364_10195689 3300006051 Bacteria 1369
43 Ga0075364_10253524 3300006051 Bacteria 1196
44 Ga0075432_10064750 3300006058 Bacteria 1306
45 Ga0075362_10000997 3300006177 Bacteria 8679
46 Ga0075362_10007171 3300006177 Bacteria 4204
47 Ga0075362_10025652 3300006177 Bacteria 2512
48 Ga0075367_10041578 3300006178 Bacteria 2688
49 Ga0075367_10083765 3300006178 Bacteria 1932
50 Ga0075367_10085681 3300006178 Bacteria 1912
51 Ga0075367_10252128 3300006178 Bacteria 1107
52 Ga0075366_10109438 3300006195 Bacteria 1661
53 Ga0075366_10126711 3300006195 Bacteria 1540
54 Ga0075370_10134724 3300006353 Bacteria 1442
55 Ga0075370_10142791 3300006353 Bacteria 1400
56 Ga0075370_10244284 3300006353 Bacteria 1063
57 Ga0075428_100001250 3300006844 Bacteria 27181
58 Ga0075428_100057986 3300006844 Bacteria 4240
59 Ga0075428_100295802 3300006844 Bacteria 1741
60 Ga0075430_100179481 3300006846 Bacteria 1761
61 Ga0075431_100000670 3300006847 Bacteria 29251
62 Ga0075431_100004688 3300006847 Bacteria 13431
63 Ga0075431_100008763 3300006847 Bacteria 10135
64 Ga0075429_100000367 3300006880 Bacteria 33345
65 Ga0075429_100003834 3300006880 Bacteria 12843
66 Ga0075429_100535088 3300006880 Bacteria 1027
67 Ga0111539_10013168 3300009094 Bacteria 10342
68 Ga0111539_11288585 3300009094 Bacteria 848
69 Ga0114129_10002399 3300009147 Bacteria 26037
70 Ga0114129_10004557 3300009147 Bacteria 19557
71 Ga0114129_10077465 3300009147 Bacteria 4625
72 Ga0114129_10165353 3300009147 Bacteria 3020
73 Ga0105243_10784929 3300009148 Bacteria 937
74 Ga0105242_10008442 3300009176 Bacteria 7915
75 Ga0105242_10590070 3300009176 Bacteria 1071
76 Ga0157369_10153753 3300013105 Bacteria 2431
77 Ga0157378_10003075 3300013297 Bacteria 14824
78 Ga0157372_10960148 3300013307 Bacteria 991
79 Ga0157375_10069079 3300013308 Bacteria 3538
80 Ga0157375_10442368 3300013308 Bacteria 1466
81 Ga0157379_10013092 3300014968 Bacteria 7264
82 Ga0157379_10450005 3300014968 Bacteria 1189
83 Ga0207642_10028866 3300025899 Bacteria 2290
84 Ga0207644_10050998 3300025931 Bacteria 2968
85 Ga0207686_10160433 3300025934 Bacteria 1575
86 Ga0207686_10203172 3300025934 Bacteria 1420
87 Ga0207670_10583598 3300025936 Bacteria 916
88 Ga0207704_10012685 3300025938 Bacteria 4187
89 Ga0207708_10253680 3300026075 Bacteria 1418
90 Ga0207648_10001986 3300026089 Bacteria 22344
91 Ga0207675_100039473 3300026118 Bacteria 4406
92 Ga0207675_100116605 3300026118 Bacteria 2524
93 Ga0209813_10029128 3300027866 Bacteria 1615
94 Ga0209813_10030311 3300027866 Bacteria 1589
95 Ga0207428_10042677 3300027907 Bacteria 3667
96 Ga0268264_10011222 3300028381 Bacteria 7403
97 Ga0268264_10027574 3300028381 Bacteria 4643
98 Ga0268264_10383429 3300028381 Bacteria 1346
99 Ga0307413_10088055 3300031824 Bacteria 2013
100 Ga0307410_10160150 3300031852 Bacteria 1685
101 Ga0307409_100035970 3300031995 Bacteria 3634
102 Ga0307416_101461070 3300032002 Bacteria 789
103 Ga0373931_0000019 3300035691 Bacteria 186534
104 Ga0395900_0098036 3300037418 Bacteria 3012
105 Ga0395900_0408188 3300037418 Bacteria 1321
106 Ga0395898_0018715 3300037466 Bacteria 7060
107 Ga0395901_0007628 3300038443 Bacteria 10920
108 Ga0395901_0135335 3300038443 Bacteria 2590
109 Ga0451837_1660932 3300041494 Bacteria 1816
110 Ga0439448_0002776 3300042005 Bacteria 4790
111 Ga0439450_028644 3300042008 Bacteria 1240
112 Ga0451577_0504353 3300042876 Bacteria 1099
113 Ga0439440_0003109 3300042993 Bacteria 3175
114 Ga0466963_0144836 3300044694 Bacteria 1648
115 Ga0466964_0038707 3300044706 Bacteria 1919
116 Ga0453684_0096527 3300044712 Bacteria 3631
117 Ga0453684_0252407 3300044712 Bacteria 2025
118 Ga0495636_0232879 3300047318 Bacteria 848
119 Ga0496101_0043551 3300048904 Bacteria 3208
120 Ga0496102_0059674 3300048905 Bacteria 3489
121 Ga0496103_0459461 3300048906 Bacteria 816
122 Ga0496104_0228380 3300048907 Bacteria 1773
123 Ga0496104_0516573 3300048907 Bacteria 1106
124 Ga0496105_0077122 3300048908 Bacteria 2752
125 Ga0496107_0056543 3300048910 Bacteria 2835
126 Ga0496108_0017786 3300048911 Bacteria 5813
127 Ga0496109_0015890 3300048912 Bacteria 6573
128 Ga0496109_0042880 3300048912 Bacteria 4101
129 Ga0496109_0426428 3300048912 Bacteria 1253
130 Ga0496111_0057904 3300048914 Bacteria 2805
131 Ga0496112_0002453 3300048915 Bacteria 14960
132 Ga0496113_0137739 3300048916 Bacteria 1919
133 Ga0496114_0030330 3300048917 Bacteria 4449
134 Ga0501031_0023712 3300049568 Bacteria 3999
135 Ga0501031_0074195 3300049568 Bacteria 2215
136 Ga0501033_0003270 3300049570 Bacteria 13411
137 Ga0501033_0059660 3300049570 Bacteria 2817
138 Ga0501034_0008506 3300049571 Bacteria 10837
139 Ga0501034_0026332 3300049571 Bacteria 5924
140 Ga0501034_1184005 3300049571 Bacteria 643
141 Ga0501036_0018608 3300049572 Bacteria 5824
142 Ga0501036_0048295 3300049572 Bacteria 3603
143 Ga0501036_0248898 3300049572 Bacteria 1490
144 Ga0501037_0167146 3300049573 Bacteria 1565
145 Ga0501038_0004575 3300049574 Bacteria 12874
146 Ga0501038_0097098 3300049574 Bacteria 2458
147 Ga0501039_0002201 3300049575 Bacteria 14424
148 Ga0501039_0052411 3300049575 Bacteria 3157
149 Ga0501040_0001028 3300049576 Bacteria 17701
150 Ga0501040_0029485 3300049576 Bacteria 3704
151 Ga0501041_0093070 3300049577 Bacteria 1861
152 Ga0501042_0011089 3300049578 Bacteria 6070
153 Ga0501042_0040738 3300049578 Bacteria 3301
154 Ga0501042_0666380 3300049578 Bacteria 756
155 Ga0501043_0048894 3300049579 Bacteria 3324
156 Ga0501046_0020404 3300049580 Bacteria 5481
157 Ga0501046_0091313 3300049580 Bacteria 2342
158 Ga0501048_0007016 3300049582 Bacteria 8559
159 Ga0501048_0009627 3300049582 Bacteria 7250
160 Ga0501048_0118785 3300049582 Bacteria 1868
161 Ga0501068_0105901 3300049584 Bacteria 1746
162 Ga0501069_0142359 3300049585 Bacteria 1376
163 Ga0501069_0517513 3300049585 Bacteria 712
164 Ga0501070_0177032 3300049586 Bacteria 1756
165 Ga0501071_0004032 3300049587 Bacteria 9275
166 Ga0501071_0062828 3300049587 Bacteria 2691
167 Ga0501071_0178437 3300049587 Bacteria 1591
168 Ga0501072_0006013 3300049588 Bacteria 9252
169 Ga0501072_0025873 3300049588 Bacteria 4572
170 Ga0501072_0300706 3300049588 Bacteria 1275
171 Ga0501074_0053412 3300049590 Bacteria 2915
172 Ga0501074_0141877 3300049590 Bacteria 1718
173 Ga0501075_0006103 3300049591 Bacteria 8274
174 Ga0501075_0012579 3300049591 Bacteria 6019
175 Ga0501075_0034734 3300049591 Bacteria 3756
176 Ga0501076_0014483 3300049592 Bacteria 5942
177 Ga0501076_0099721 3300049592 Bacteria 2340
178 Ga0501076_0164298 3300049592 Bacteria 1809
179 Ga0501077_0000891 3300049593 Bacteria 17957
180 Ga0501077_0013301 3300049593 Bacteria 5160
181 Ga0501079_0005124 3300049741 Bacteria 9739
182 Ga0501079_0006243 3300049741 Bacteria 8946
183 Ga0501079_0049402 3300049741 Bacteria 3246
184 Ga0501080_0047108 3300049742 Bacteria 4013
185 Ga0501080_0281754 3300049742 Bacteria 1511
186 Ga0501080_0342288 3300049742 Bacteria 1351
187 Ga0501081_0003048 3300049743 Bacteria 10638
188 Ga0501081_0090756 3300049743 Bacteria 2148
189 Ga0501083_0067305 3300049744 Bacteria 2385
190 Ga0501035_0048203 3300049822 Bacteria 3821
191 Ga0501044_0085428 3300049823 Bacteria 3189
192 Ga0501044_0512467 3300049823 Bacteria 1100
193 Ga0501045_0001848 3300049824 Bacteria 14314
194 Ga0501045_0022026 3300049824 Bacteria 4559
195 nmdc:mga03683_51258_c1 3300050489 Bacteria 1722
196 nmdc:mga03n38_114119_c1 3300050490 Bacteria 1320
197 nmdc:mga03n38_137688_c1 3300050490 Bacteria 1216
198 nmdc:mga03n38_162065_c1 3300050490 Bacteria 1133
199 nmdc:mga03n38_81106_c1 3300050490 Bacteria 1525
200 nmdc:mga00v17_2283_c1 3300050491 Bacteria 9838
201 nmdc:mga00v17_27282_c1 3300050491 Bacteria 3334
202 nmdc:mga00v17_692_c1 3300050491 Bacteria 15750
203 nmdc:mga00v17_74154_c1 3300050491 Bacteria 2114
204 nmdc:mga0yw44_151695_c1 3300050492 Bacteria 1512
205 nmdc:mga0yw44_16527_c1 3300050492 Bacteria 2664
206 nmdc:mga0yw44_23380_c1 3300050492 Bacteria 3481
207 nmdc:mga0yw44_267438_c1 3300050492 Bacteria 1141
208 nmdc:mga0yw44_348961_c1 3300050492 Bacteria 996
209 nmdc:mga0yw44_35853_c1 3300050492 Bacteria 2919
210 nmdc:mga0yw44_4351_c1 3300050492 Bacteria 6476
211 nmdc:mga0yw44_4834_c1 3300050492 Bacteria 6258
212 nmdc:mga0yw44_534_c1 3300050492 Bacteria 13665
213 nmdc:mga06z11_186969_c1 3300050494 Bacteria 1197
214 nmdc:mga06z11_23590_c1 3300050494 Bacteria 2893
215 nmdc:mga06z11_8469_c1 3300050494 Bacteria 4290
216 nmdc:mga04h51_22031_c1 3300050495 Bacteria 1923
217 nmdc:mga04h51_53253_c1 3300050495 Bacteria 1365
218 nmdc:mga07m45_196062_c1 3300050496 Bacteria 1174
219 nmdc:mga05p37_4351_c1 3300050507 Bacteria 16540
220 nmdc:mga05p37_46714_c1 3300050507 Bacteria 5323
221 nmdc:mga05p37_6057_c1 3300050507 Bacteria 14238
222 nmdc:mga05p37_67925_c1 3300050507 Bacteria 4385
223 nmdc:mga09592_126760_c1 3300050508 Bacteria 2195
224 nmdc:mga09592_5529_c1 3300050508 Bacteria 10284
225 nmdc:mga09592_971_c1 3300050508 Bacteria 22641
226 nmdc:mga0qj67_565971_c1 3300050509 Bacteria 911
227 nmdc:mga0qj67_744_c1 3300050509 Bacteria 22077
228 nmdc:mga06r32_2060_c1 3300050510 Bacteria 17993
229 nmdc:mga06r32_2084_c1 3300050510 Bacteria 17895
230 nmdc:mga06r32_8712_c1 3300050510 Bacteria 9142
231 Ga0495612_0058152 3300053078 Bacteria 1598
232 Ga0500568_0000031 3300053139 Bacteria 153522
233 Ga0501084_0001967 3300054114 Bacteria 16416
234 Ga0501084_0002061 3300054114 Bacteria 16048
235 Ga0501084_0192553 3300054114 Bacteria 1720
236 Ga0501082_0009750 3300060353 Bacteria 8274
237 Ga0501082_0045261 3300060353 Bacteria 3795
238 Ga0501082_0215639 3300060353 Bacteria 1670
239 Ga0530510_0012100 3300061734 Bacteria 6055
240 Ga0530510_0016402 3300061734 Bacteria 5243
241 Ga0530510_0016664 3300061734 Bacteria 5203
242 JGI25407J50210_10001063
243 Ga0065704_10163973
244 Ga0070683_100250992
245 Ga0070690_100052348
246 Ga0070668_100120764
247 Ga0070688_100033352
248 Ga0070714_100286927
249 Ga0070700_100050216
250 Ga0068867_100006194
251 Ga0070698_100027465
252 Ga0070686_100025153
253 Ga0068856_100067892
254 Ga0068860_100036186
255 Ga0068862_100266591
256 Ga0081455_10011754
257 Ga0081455_10087760
258 Ga0081538_10001293
259 Ga0081538_10002593
260 Ga0081538_10012797
261 Ga0075365_10001783
262 Ga0075365_10003870
263 Ga0075365_10007119
264 Ga0075365_10007193
265 Ga0075365_10022401
266 Ga0075365_10086671
267 Ga0075365_10209752
268 Ga0075365_10228032
269 Ga0075365_10350326
270 Ga0075368_10022409
271 Ga0075363_100002059
272 Ga0075363_100011091
273 Ga0075363_100015618
274 Ga0075363_100032796
275 Ga0075363_100060786
276 Ga0075363_100222405
277 Ga0075363_100265850
278 Ga0075364_10039335
279 Ga0075364_10042482
280 Ga0075364_10058335
281 Ga0075364_10086359
282 Ga0075364_10091238
283 Ga0075364_10195689
284 Ga0075364_10253524
285 Ga0075432_10064750
286 Ga0075362_10000997
287 Ga0075362_10007171
288 Ga0075362_10025652
289 Ga0075367_10041578
290 Ga0075367_10083765
291 Ga0075367_10085681
292 Ga0075367_10252128
293 Ga0075366_10109438
294 Ga0075366_10126711
295 Ga0075370_10134724
296 Ga0075370_10142791
297 Ga0075370_10244284
298 Ga0075428_100001250
299 Ga0075428_100057986
300 Ga0075428_100295802
301 Ga0075430_100179481
302 Ga0075431_100000670
303 Ga0075431_100004688
304 Ga0075431_100008763
305 Ga0075429_100000367
306 Ga0075429_100003834
307 Ga0075429_100535088
308 Ga0111539_10013168
309 Ga0111539_11288585
310 Ga0114129_10002399
311 Ga0114129_10004557
312 Ga0114129_10077465
313 Ga0114129_10165353
314 Ga0105243_10784929
315 Ga0105242_10008442
316 Ga0105242_10590070
317 Ga0157369_10153753
318 Ga0157378_10003075
319 Ga0157372_10960148
320 Ga0157375_10069079
321 Ga0157375_10442368
322 Ga0157379_10013092
323 Ga0157379_10450005
324 Ga0207642_10028866
325 Ga0207644_10050998
326 Ga0207686_10160433
327 Ga0207686_10203172
328 Ga0207670_10583598
329 Ga0207704_10012685
330 Ga0207708_10253680
331 Ga0207648_10001986
332 Ga0207675_100039473
333 Ga0207675_100116605
334 Ga0209813_10029128
335 Ga0209813_10030311
336 Ga0207428_10042677
337 Ga0268264_10011222
338 Ga0268264_10027574
339 Ga0268264_10383429
340 Ga0307413_10088055
341 Ga0307410_10160150
342 Ga0307409_100035970
343 Ga0307416_101461070
344 Ga0373931_0000019
345 Ga0395900_0098036
346 Ga0395900_0408188
347 Ga0395898_0018715
348 Ga0395901_0007628
349 Ga0395901_0135335
350 Ga0451837_1660932
351 Ga0439448_0002776
352 Ga0439450_028644
353 Ga0451577_0504353
354 Ga0439440_0003109
355 Ga0466963_0144836
356 Ga0466964_0038707
357 Ga0453684_0096527
358 Ga0453684_0252407
359 Ga0495636_0232879
360 Ga0496101_0043551
361 Ga0496102_0059674
362 Ga0496103_0459461
363 Ga0496104_0228380
364 Ga0496104_0516573
365 Ga0496105_0077122
366 Ga0496107_0056543
367 Ga0496108_0017786
368 Ga0496109_0015890
369 Ga0496109_0042880
370 Ga0496109_0426428
371 Ga0496111_0057904
372 Ga0496112_0002453
373 Ga0496113_0137739
374 Ga0496114_0030330
375 Ga0501031_0023712
376 Ga0501031_0074195
377 Ga0501033_0003270
378 Ga0501033_0059660
379 Ga0501034_0008506
380 Ga0501034_0026332
381 Ga0501034_1184005
382 Ga0501036_0018608
383 Ga0501036_0048295
384 Ga0501036_0248898
385 Ga0501037_0167146
386 Ga0501038_0004575
387 Ga0501038_0097098
388 Ga0501039_0002201
389 Ga0501039_0052411
390 Ga0501040_0001028
391 Ga0501040_0029485
392 Ga0501041_0093070
393 Ga0501042_0011089
394 Ga0501042_0040738
395 Ga0501042_0666380
396 Ga0501043_0048894
397 Ga0501046_0020404
398 Ga0501046_0091313
399 Ga0501048_0007016
400 Ga0501048_0009627
401 Ga0501048_0118785
402 Ga0501068_0105901
403 Ga0501069_0142359
404 Ga0501069_0517513
405 Ga0501070_0177032
406 Ga0501071_0004032
407 Ga0501071_0062828
408 Ga0501071_0178437
409 Ga0501072_0006013
410 Ga0501072_0025873
411 Ga0501072_0300706
412 Ga0501074_0053412
413 Ga0501074_0141877
414 Ga0501075_0006103
415 Ga0501075_0012579
416 Ga0501075_0034734
417 Ga0501076_0014483
418 Ga0501076_0099721
419 Ga0501076_0164298
420 Ga0501077_0000891
421 Ga0501077_0013301
422 Ga0501079_0005124
423 Ga0501079_0006243
424 Ga0501079_0049402
425 Ga0501080_0047108
426 Ga0501080_0281754
427 Ga0501080_0342288
428 Ga0501081_0003048
429 Ga0501081_0090756
430 Ga0501083_0067305
431 Ga0501035_0048203
432 Ga0501044_0085428
433 Ga0501044_0512467
434 Ga0501045_0001848
435 Ga0501045_0022026
436 nmdc:mga03683_51258_c1
437 nmdc:mga03n38_114119_c1
438 nmdc:mga03n38_137688_c1
439 nmdc:mga03n38_162065_c1
440 nmdc:mga03n38_81106_c1
441 nmdc:mga00v17_2283_c1
442 nmdc:mga00v17_27282_c1
443 nmdc:mga00v17_692_c1
444 nmdc:mga00v17_74154_c1
445 nmdc:mga0yw44_151695_c1
446 nmdc:mga0yw44_16527_c1
447 nmdc:mga0yw44_23380_c1
448 nmdc:mga0yw44_267438_c1
449 nmdc:mga0yw44_348961_c1
450 nmdc:mga0yw44_35853_c1
451 nmdc:mga0yw44_4351_c1
452 nmdc:mga0yw44_4834_c1
453 nmdc:mga0yw44_534_c1
454 nmdc:mga06z11_186969_c1
455 nmdc:mga06z11_23590_c1
456 nmdc:mga06z11_8469_c1
457 nmdc:mga04h51_22031_c1
458 nmdc:mga04h51_53253_c1
459 nmdc:mga07m45_196062_c1
460 nmdc:mga05p37_4351_c1
461 nmdc:mga05p37_46714_c1
462 nmdc:mga05p37_6057_c1
463 nmdc:mga05p37_67925_c1
464 nmdc:mga09592_126760_c1
465 nmdc:mga09592_5529_c1
466 nmdc:mga09592_971_c1
467 nmdc:mga0qj67_565971_c1
468 nmdc:mga0qj67_744_c1
469 nmdc:mga06r32_2060_c1
470 nmdc:mga06r32_2084_c1
471 nmdc:mga06r32_8712_c1
472 Ga0495612_0058152
473 Ga0500568_0000031
474 Ga0501084_0001967
475 Ga0501084_0002061
476 Ga0501084_0192553
477 Ga0501082_0009750
478 Ga0501082_0045261
479 Ga0501082_0215639
480 Ga0530510_0012100
481 Ga0530510_0016402
482 Ga0530510_0016664

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

23

132

0.98

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

165

241

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ifh-assembly1.cif.gz_A unphosphorylated spo0f from paenisporosarcina sp. tg-14 0.9717 21 136
2zwm-assembly1.cif.gz_B crystal structure of yycf receiver domain from bacillus subtilis 0.9702 21 137
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9695 22 137
1nxx-assembly1.cif.gz_A-2 micarec ph 5.5 0.9694 22 137
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9691 22 137
ID Description Score Start End Superfamily
af_P9WGN1_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9975 21 98 3.40.50.2300
af_Q2G2U6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9928 22 103 3.40.50.2300
af_O69730_8_88_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9888 20 96 3.40.50.2300
af_P9WGN1_116_225_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9851 143 241 1.10.10.10
af_Q2FXN6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9845 22 101 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A7X7DME9-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9819 20 137 GO:0000155
AF-A0A523EAV0-F1-model_v4 Diguanylate cyclase 0.9767 20 137 GO:0000160
GO:0005886
GO:0043709
GO:0052621
GO:1902201
AF-A0A4Q3UW49-F1-model_v4 Response regulator transcription factor 0.9743 21 96 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A3M1M3I0-F1-model_v4 Adenylate/guanylate cyclase domain-containing response regulator 0.9733 18 137 GO:0000156
GO:0000976
GO:0004016
GO:0005829
GO:0006355
GO:0009190
GO:0032993
AF-A0A836WKU4-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9698 21 137 GO:0000155
GO:0000156
GO:0007234
GO:0030295

Map