F353339

General Info

Members Datasets Scaffolds Average Seq Length
240 203 480 337

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2835188231|2835191795
Length 404
Sequence TAAGAADGTADGTAGGAAGASSTTPGAWEPDVLPGFERLTLPLAPDDEGPVVATLVRRAQRPPATTGAGRAADGHAGGAPDRGVDVLYVHGWIDYFFQTHVADFWERLGVRFYALDLRKYGRSLRPHQTPGFVTSLRTYDEDLEAALAAMGHASGTTDRRRLVLMGHSTGGLTLSLWAGRHPGRADGLVLNSPWLEFQTREVGRRVLEPGIRAQAAVAPYSRLVNVDLGFYARSISARFDGEWDYDATWRPDLGWRATPAWLAAVFRGHEQVARGLGIDVPILVLLSARSTIGVRWHPDMLTSDSVLDVVGVARRVPSLGSLVTLVRLDGALHDVTLSAAPVRDVVWRETQRWFDAYVAPAPVPPAAPPASPERAFRERVVRLARLARLSAARAPSRALGPSTR

Samples

Sample ID Description Type Environment
1 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
2 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
42 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
43 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
44 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
45 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
46 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
68 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
69 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
70 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
71 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
72 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
73 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
74 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
75 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
76 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
79 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
80 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
81 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
82 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
83 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
84 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
85 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
86 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
87 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
88 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
89 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
90 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
91 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
92 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
93 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
94 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
95 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
96 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
97 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
98 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
99 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
100 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
101 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
102 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
103 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
104 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
105 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
106 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
115 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
116 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
118 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
119 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
120 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
121 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
122 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
123 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
124 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
125 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
126 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
127 2501939600 Micromonospora sp. L5 Isolate Unclassified
128 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
129 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
130 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
131 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
132 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
133 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
134 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
135 2643221549 Agromyces sp. Root1464 Isolate Unclassified
136 2643221572 Leifsonia sp. Root60 Isolate Unclassified
137 2643221613 Oerskovia sp. Root22 Isolate Unclassified
138 2643221616 Leifsonia sp. Root227 Isolate Unclassified
139 2643221619 Agromyces sp. Root81 Isolate Unclassified
140 2643221649 Leifsonia sp. Root4 Isolate Unclassified
141 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
142 2643221721 Oerskovia sp. Root918 Isolate Unclassified
143 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
144 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
145 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
146 2808606372 Agromyces sp. 23-23 Isolate Unclassified
147 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
148 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
149 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
150 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
151 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
152 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
153 2855683550 Micromonospora sp. RP3T Isolate Unclassified
154 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
155 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
156 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
157 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
158 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
159 2858868258 Micromonospora sp. MH33 Isolate Unclassified
160 2858882152 Micromonospora noduli MED15 Isolate Nodule
161 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
162 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
163 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
164 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
165 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
166 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
167 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
168 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
169 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
170 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
171 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
172 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
173 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
174 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
175 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
176 2902582711 Micromonospora sp. AP08 Isolate Unclassified
177 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
178 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
179 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
180 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
181 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
182 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
183 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
184 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
185 2928153084 Leifsonia sp. 563 Isolate Unclassified
186 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
187 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
188 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
189 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
190 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
191 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
192 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
193 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
194 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
195 649633069 Micromonospora sp. L5 Isolate Unclassified
196 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
197 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
198 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
199 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
200 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
201 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
202 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
203 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 66.25
Metatranscriptomes 0.83
Isolates 32.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.58
Nodule 2.5
Rhizoplane 1.67
Rhizosphere 60.42
Stem 0
Stem Tuber 0.42
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10002175 3300002067 Bacteria 6886
2 JGI25164J39214_1001280 3300002772 Bacteria 6455
3 JGI25406J46586_10032842 3300003203 Bacteria 1924
4 JGI25165J46597_1000014 3300003214 Bacteria 390383
5 Ga0006562J51391_1005681 3300003578 Bacteria 7890
6 Ga0006562J51391_1005682 3300003578 Bacteria 9800
7 Ga0070658_10022573 3300005327 Bacteria 5050
8 Ga0070658_10055826 3300005327 Bacteria 3209
9 Ga0070680_100109018 3300005336 Bacteria 2303
10 Ga0070682_100042991 3300005337 Bacteria 2792
11 Ga0070682_100288249 3300005337 Bacteria 1200
12 Ga0070660_100051969 3300005339 Bacteria 3158
13 Ga0070687_100080961 3300005343 Bacteria 1772
14 Ga0070661_100017019 3300005344 Bacteria 5150
15 Ga0070692_10207149 3300005345 Bacteria 1152
16 Ga0070668_100003275 3300005347 Bacteria 11940
17 Ga0070668_100216747 3300005347 Bacteria 1577
18 Ga0070669_100139019 3300005353 Bacteria 1871
19 Ga0070659_100450480 3300005366 Bacteria 1092
20 Ga0070667_100033556 3300005367 Bacteria 4291
21 Ga0070678_100137430 3300005456 Bacteria 1951
22 Ga0070681_10087447 3300005458 Bacteria 3069
23 Ga0070679_100043531 3300005530 Bacteria 4471
24 Ga0068855_100272921 3300005563 Bacteria 1880
25 Ga0070664_100228149 3300005564 Bacteria 1668
26 Ga0068857_100426906 3300005577 Bacteria 1236
27 Ga0068864_100215969 3300005618 Bacteria 1768
28 Ga0068861_100266432 3300005719 Bacteria 1469
29 Ga0068863_100286409 3300005841 Bacteria 1597
30 Ga0068858_100005687 3300005842 Bacteria 12184
31 Ga0068862_100050108 3300005844 Bacteria 3568
32 Ga0081540_1023750 3300005983 Bacteria 3575
33 Ga0081540_1049212 3300005983 Bacteria 2104
34 Ga0081539_10004371 3300005985 Bacteria 15728
35 Ga0081539_10007093 3300005985 Bacteria 10362
36 Ga0075430_100004407 3300006846 Bacteria 11882
37 Ga0075431_100069366 3300006847 Bacteria 3637
38 Ga0075429_100017248 3300006880 Bacteria 6246
39 Ga0105244_10007549 3300009036 Bacteria 6904
40 Ga0105244_10086375 3300009036 Bacteria 1547
41 Ga0114129_10621508 3300009147 Bacteria 1397
42 Ga0105243_10360882 3300009148 Bacteria 1337
43 Ga0157369_10005654 3300013105 Bacteria 14525
44 Ga0157369_10019258 3300013105 Bacteria 7636
45 Ga0157378_10070197 3300013297 Bacteria 3144
46 Ga0157372_10392207 3300013307 Bacteria 1618
47 Ga0157372_10637385 3300013307 Bacteria 1241
48 Ga0157375_10224549 3300013308 Bacteria 2037
49 Ga0163163_10247512 3300014325 Bacteria 1833
50 Ga0157380_10101648 3300014326 Bacteria 2396
51 Ga0163161_10149648 3300017792 Bacteria 1773
52 Ga0207427_100121 3300025231 Bacteria 99954
53 Ga0209437_100933 3300025233 Bacteria 11082
54 Ga0209233_1000014 3300025261 Bacteria 996641
55 Ga0209051_1002275 3300025303 Bacteria 14067
56 Ga0207705_10020441 3300025909 Bacteria 4731
57 Ga0207705_10076438 3300025909 Bacteria 2434
58 Ga0207660_10167393 3300025917 Bacteria 1699
59 Ga0207662_10076989 3300025918 Bacteria 2028
60 Ga0207649_10051071 3300025920 Bacteria 2560
61 Ga0207652_10019555 3300025921 Bacteria 5571
62 Ga0207681_10141897 3300025923 Bacteria 1790
63 Ga0207650_10265795 3300025925 Bacteria 1393
64 Ga0207700_10326615 3300025928 Bacteria 1331
65 Ga0207691_10067717 3300025940 Bacteria 3228
66 Ga0207661_10022896 3300025944 Bacteria 4712
67 Ga0207679_10051564 3300025945 Bacteria 3012
68 Ga0207667_10212442 3300025949 Bacteria 1983
69 Ga0207668_10152717 3300025972 Bacteria 1789
70 Ga0207658_10121494 3300025986 Bacteria 2083
71 Ga0207708_10135580 3300026075 Bacteria 1928
72 Ga0207648_10125184 3300026089 Bacteria 2261
73 Ga0207674_10016934 3300026116 Bacteria 7961
74 Ga0207683_10163855 3300026121 Bacteria 2011
75 Ga0207683_10172071 3300026121 Bacteria 1962
76 Ga0268266_10074585 3300028379 Bacteria 2946
77 Ga0268265_10288875 3300028380 Bacteria 1471
78 Ga0307515_10000217 3300028794 Bacteria 142129
79 Ga0307515_10022713 3300028794 Bacteria 11041
80 Ga0307515_10035104 3300028794 Bacteria 8173
81 Ga0307512_10007625 3300030522 Bacteria 10677
82 Ga0307512_10011102 3300030522 Bacteria 8549
83 Ga0307513_10152822 3300031456 Bacteria 2213
84 Ga0307509_10009891 3300031507 Bacteria 11793
85 Ga0307509_10269890 3300031507 Bacteria 1470
86 Ga0307408_100065236 3300031548 Bacteria 2670
87 Ga0307408_100248892 3300031548 Bacteria 1465
88 Ga0307508_10000473 3300031616 Bacteria 48634
89 Ga0307508_10013028 3300031616 Bacteria 7605
90 Ga0307508_10089339 3300031616 Bacteria 2666
91 Ga0307516_10000728 3300031730 Bacteria 44930
92 Ga0307516_10018155 3300031730 Bacteria 7315
93 Ga0307516_10044101 3300031730 Bacteria 4415
94 Ga0307413_10114518 3300031824 Bacteria 1813
95 Ga0307410_10147377 3300031852 Bacteria 1748
96 Ga0307406_10022448 3300031901 Bacteria 3745
97 Ga0307416_100667649 3300032002 Bacteria 1126
98 Ga0307415_100105072 3300032126 Bacteria 2082
99 Ga0307507_10039863 3300033179 Bacteria 4731
100 Ga0373940_0001881 3300035088 Bacteria 3945
101 Ga0373951_0000239 3300035091 Bacteria 18591
102 Ga0373941_0012166 3300035115 Bacteria 2243
103 Ga0373942_0000302 3300035207 Bacteria 13526
104 Ga0373962_0005317 3300035242 Bacteria 3115
105 Ga0373935_0036350 3300035692 Bacteria 3078
106 Ga0395900_0161863 3300037418 Bacteria 2282
107 Ga0395898_0020746 3300037466 Bacteria 6671
108 Ga0395898_0073048 3300037466 Bacteria 3313
109 Ga0395905_0007842 3300037471 Bacteria 10578
110 Ga0395901_0015485 3300038443 Bacteria 7764
111 Ga0395901_0250931 3300038443 Bacteria 1843
112 Ga0451791_0895918 3300041451 Bacteria 3605
113 Ga0451853_2277828 3300041512 Bacteria 1949
114 Ga0466965_0000004 3300044683 Bacteria 229348
115 Ga0495638_0105327 3300046460 Bacteria 1681
116 Ga0495594_0008729 3300046499 Bacteria 5225
117 Ga0496105_0373358 3300048908 Bacteria 1136
118 Ga0496108_0000040 3300048911 Bacteria 147522
119 Ga0496108_0289939 3300048911 Bacteria 1425
120 Ga0496117_0008492 3300048920 Bacteria 9745
121 Ga0496117_0010911 3300048920 Bacteria 8191
122 Ga0496118_0029140 3300048921 Bacteria 4635
123 Ga0496119_0001062 3300048922 Bacteria 35053
124 Ga0496120_0003758 3300048923 Bacteria 13435
125 Ga0496122_0000095 3300048925 Bacteria 200509
126 Ga0496123_0000100 3300048926 Bacteria 170019
127 Ga0496124_0010327 3300048927 Bacteria 9472
128 Ga0496125_0028437 3300048928 Bacteria 5049
129 Ga0496126_0006146 3300048929 Bacteria 13455
130 Ga0496126_0052423 3300048929 Bacteria 3707
131 Ga0501031_0259629 3300049568 Bacteria 1129
132 Ga0501032_0023508 3300049569 Bacteria 4256
133 Ga0501034_0082976 3300049571 Bacteria 3207
134 Ga0501034_0405864 3300049571 Bacteria 1285
135 Ga0501037_0125907 3300049573 Bacteria 1840
136 Ga0501037_0256520 3300049573 Bacteria 1222
137 Ga0501038_0017402 3300049574 Bacteria 6497
138 Ga0501038_0067340 3300049574 Bacteria 3046
139 Ga0501038_0192266 3300049574 Bacteria 1641
140 Ga0501039_0060167 3300049575 Bacteria 2941
141 Ga0501043_0030597 3300049579 Bacteria 4230
142 Ga0501043_0142451 3300049579 Bacteria 1877
143 Ga0501047_0074876 3300049581 Bacteria 3259
144 Ga0501047_0240506 3300049581 Bacteria 1661
145 Ga0501047_0325377 3300049581 Bacteria 1376
146 Ga0501070_0000262 3300049586 Bacteria 49716
147 Ga0501070_0079041 3300049586 Bacteria 2722
148 Ga0501070_0104363 3300049586 Bacteria 2344
149 Ga0501071_0182640 3300049587 Bacteria 1572
150 Ga0501035_0090050 3300049822 Bacteria 2701
151 Ga0501044_0035717 3300049823 Bacteria 5203
152 Ga0501044_0161767 3300049823 Bacteria 2215
153 nmdc:mga05p37_71085_c1 3300050507 Bacteria 4281
154 nmdc:mga09592_42244_c1 3300050508 Bacteria 3835
155 nmdc:mga0qj67_15008_c1 3300050509 Bacteria 5860
156 nmdc:mga06r32_405326_c1 3300050510 Bacteria 1346
157 Ga0500635_0000063 3300053080 Bacteria 70358
158 Ga0500644_0017670 3300053088 Bacteria 2075
159 Ga0500644_0049026 3300053088 Bacteria 1440
160 Ga0500568_0000935 3300053139 Bacteria 20164
161 Ga0500600_0028454 3300053149 Bacteria 3306
162 2835191795 2835188231 Bacteria 3476928
163 2501939648 2501939600 Bacteria 6907073
164 2515497363 2515154088 Bacteria 5526283
165 2515720903 2515154129 Bacteria 5584369
166 2515758306 2515154137 Bacteria 5711575
167 2516082650 2515154202 Bacteria 5471270
168 2516091811 2515154203 Bacteria 5458536
169 2587862288 2585428094 Bacteria 3604039
170 2623591348 2622736626 Bacteria 7181580
171 2643766728 2643221549 Bacteria 4042819
172 2643877430 2643221572 Bacteria 3614809
173 2644081493 2643221613 Bacteria 4622396
174 2644094525 2643221616 Bacteria 4066575
175 2644113356 2643221619 Bacteria 4158469
176 2644279890 2643221649 Bacteria 3867359
177 2644384485 2643221669 Bacteria 3611286
178 2644664787 2643221721 Bacteria 4486924
179 2723640411 2721755702 Bacteria 4373124
180 2753268541 2751185782 Bacteria 11227053
181 2772643408 2772190715 Bacteria 6959372
182 2808899435 2808606372 Bacteria 4649509
183 2831937660 2831935698 Bacteria 5963223
184 2832009898 2832004796 Bacteria 6538017
185 2844844697 2844841374 Bacteria 3917147
186 2852679384 2852677369 Bacteria 3768884
187 2855673640 2855670206 Bacteria 7120389
188 2855677944 2855676851 Bacteria 7063653
189 2855689136 2855683550 Bacteria 7134265
190 2856858277 2856858025 Bacteria 7255264
191 2857291103 2857288857 Bacteria 7189066
192 2857731975 2857729791 Bacteria 4040535
193 2857740745 2857740372 Bacteria 4782044
194 2858854011 2858848962 Bacteria 6963058
195 2858870004 2858868258 Bacteria 7683772
196 2858886980 2858882152 Bacteria 7230291
197 2858894501 2858888857 Bacteria 7060307
198 2858896416 2858895516 Bacteria 7378898
199 2858907380 2858902515 Bacteria 7086037
200 2866069420 2866065130 Bacteria 6518152
201 2867307046 2867302475 Bacteria 7087181
202 2867316947 2867312974 Bacteria 7058875
203 2867325323 2867319477 Bacteria 7069771
204 2867508230 2867507094 Bacteria 6506033
205 2869048894 2869048445 Bacteria 6875584
206 2869066714 2869061728 Bacteria 7112407
207 2869069361 2869068681 Bacteria 7205615
208 2880495788 2880489317 Bacteria 7096270
209 2880496575 2880495981 Bacteria 7340502
210 2884763975 2884763398 Bacteria 4091164
211 2895661754 2895660088 Bacteria 3782833
212 2902584074 2902582711 Bacteria 6187705
213 2904499206 2904497146 Bacteria 4731781
214 2904778297 2904776348 Bacteria 4658726
215 2910813615 2910809715 Bacteria 4982797
216 2919035654 2919034639 Bacteria 4763403
217 2919056655 2919055335 Bacteria 3875751
218 2919444242 2919443155 Bacteria 4072969
219 2919539152 2919538618 Bacteria 4677069
220 2919540324 2919538618 Bacteria 4677069
221 2928124162 2928121344 Bacteria 3972376
222 2928155463 2928153084 Bacteria 4020257
223 2929225214 2929219909 Bacteria 6984360
224 2929231814 2929226422 Bacteria 7248583
225 2932427732 2932426870 Bacteria 4547726
226 2932434143 2932431166 Bacteria 4215299
227 2933418703 2933418574 Bacteria 4476724
228 2935409950 2935409751 Bacteria 4179611
229 2935894173 2935890801 Bacteria 4593001
230 2939677603 2939674588 Bacteria 4844420
231 2996224422 2996221748 Bacteria 6799777
232 649813485 649633069 Bacteria 6962533
233 8003833427 8003830390 Bacteria 6541657
234 8003857463 8003856774 Bacteria 7675274
235 8003874731 8003870546 Bacteria 7396674
236 8046355000 8046352972 Bacteria 3613806
237 8054704839 8054704163 Bacteria 7247792
238 8054730025 8054727385 Bacteria 7558670
239 8054737364 8054734606 Bacteria 6947278
240 8055416968 8055412473 Bacteria 6257500
241 JGI24735J21928_10002175
242 JGI25164J39214_1001280
243 JGI25406J46586_10032842
244 JGI25165J46597_1000014
245 Ga0006562J51391_1005681
246 Ga0006562J51391_1005682
247 Ga0070658_10022573
248 Ga0070658_10055826
249 Ga0070680_100109018
250 Ga0070682_100042991
251 Ga0070682_100288249
252 Ga0070660_100051969
253 Ga0070687_100080961
254 Ga0070661_100017019
255 Ga0070692_10207149
256 Ga0070668_100003275
257 Ga0070668_100216747
258 Ga0070669_100139019
259 Ga0070659_100450480
260 Ga0070667_100033556
261 Ga0070678_100137430
262 Ga0070681_10087447
263 Ga0070679_100043531
264 Ga0068855_100272921
265 Ga0070664_100228149
266 Ga0068857_100426906
267 Ga0068864_100215969
268 Ga0068861_100266432
269 Ga0068863_100286409
270 Ga0068858_100005687
271 Ga0068862_100050108
272 Ga0081540_1023750
273 Ga0081540_1049212
274 Ga0081539_10004371
275 Ga0081539_10007093
276 Ga0075430_100004407
277 Ga0075431_100069366
278 Ga0075429_100017248
279 Ga0105244_10007549
280 Ga0105244_10086375
281 Ga0114129_10621508
282 Ga0105243_10360882
283 Ga0157369_10005654
284 Ga0157369_10019258
285 Ga0157378_10070197
286 Ga0157372_10392207
287 Ga0157372_10637385
288 Ga0157375_10224549
289 Ga0163163_10247512
290 Ga0157380_10101648
291 Ga0163161_10149648
292 Ga0207427_100121
293 Ga0209437_100933
294 Ga0209233_1000014
295 Ga0209051_1002275
296 Ga0207705_10020441
297 Ga0207705_10076438
298 Ga0207660_10167393
299 Ga0207662_10076989
300 Ga0207649_10051071
301 Ga0207652_10019555
302 Ga0207681_10141897
303 Ga0207650_10265795
304 Ga0207700_10326615
305 Ga0207691_10067717
306 Ga0207661_10022896
307 Ga0207679_10051564
308 Ga0207667_10212442
309 Ga0207668_10152717
310 Ga0207658_10121494
311 Ga0207708_10135580
312 Ga0207648_10125184
313 Ga0207674_10016934
314 Ga0207683_10163855
315 Ga0207683_10172071
316 Ga0268266_10074585
317 Ga0268265_10288875
318 Ga0307515_10000217
319 Ga0307515_10022713
320 Ga0307515_10035104
321 Ga0307512_10007625
322 Ga0307512_10011102
323 Ga0307513_10152822
324 Ga0307509_10009891
325 Ga0307509_10269890
326 Ga0307408_100065236
327 Ga0307408_100248892
328 Ga0307508_10000473
329 Ga0307508_10013028
330 Ga0307508_10089339
331 Ga0307516_10000728
332 Ga0307516_10018155
333 Ga0307516_10044101
334 Ga0307413_10114518
335 Ga0307410_10147377
336 Ga0307406_10022448
337 Ga0307416_100667649
338 Ga0307415_100105072
339 Ga0307507_10039863
340 Ga0373940_0001881
341 Ga0373951_0000239
342 Ga0373941_0012166
343 Ga0373942_0000302
344 Ga0373962_0005317
345 Ga0373935_0036350
346 Ga0395900_0161863
347 Ga0395898_0020746
348 Ga0395898_0073048
349 Ga0395905_0007842
350 Ga0395901_0015485
351 Ga0395901_0250931
352 Ga0451791_0895918
353 Ga0451853_2277828
354 Ga0466965_0000004
355 Ga0495638_0105327
356 Ga0495594_0008729
357 Ga0496105_0373358
358 Ga0496108_0000040
359 Ga0496108_0289939
360 Ga0496117_0008492
361 Ga0496117_0010911
362 Ga0496118_0029140
363 Ga0496119_0001062
364 Ga0496120_0003758
365 Ga0496122_0000095
366 Ga0496123_0000100
367 Ga0496124_0010327
368 Ga0496125_0028437
369 Ga0496126_0006146
370 Ga0496126_0052423
371 Ga0501031_0259629
372 Ga0501032_0023508
373 Ga0501034_0082976
374 Ga0501034_0405864
375 Ga0501037_0125907
376 Ga0501037_0256520
377 Ga0501038_0017402
378 Ga0501038_0067340
379 Ga0501038_0192266
380 Ga0501039_0060167
381 Ga0501043_0030597
382 Ga0501043_0142451
383 Ga0501047_0074876
384 Ga0501047_0240506
385 Ga0501047_0325377
386 Ga0501070_0000262
387 Ga0501070_0079041
388 Ga0501070_0104363
389 Ga0501071_0182640
390 Ga0501035_0090050
391 Ga0501044_0035717
392 Ga0501044_0161767
393 nmdc:mga05p37_71085_c1
394 nmdc:mga09592_42244_c1
395 nmdc:mga0qj67_15008_c1
396 nmdc:mga06r32_405326_c1
397 Ga0500635_0000063
398 Ga0500644_0017670
399 Ga0500644_0049026
400 Ga0500568_0000935
401 Ga0500600_0028454
402 2835191795
403 2501939648
404 2515497363
405 2515720903
406 2515758306
407 2516082650
408 2516091811
409 2587862288
410 2623591348
411 2643766728
412 2643877430
413 2644081493
414 2644094525
415 2644113356
416 2644279890
417 2644384485
418 2644664787
419 2723640411
420 2753268541
421 2772643408
422 2808899435
423 2831937660
424 2832009898
425 2844844697
426 2852679384
427 2855673640
428 2855677944
429 2855689136
430 2856858277
431 2857291103
432 2857731975
433 2857740745
434 2858854011
435 2858870004
436 2858886980
437 2858894501
438 2858896416
439 2858907380
440 2866069420
441 2867307046
442 2867316947
443 2867325323
444 2867508230
445 2869048894
446 2869066714
447 2869069361
448 2880495788
449 2880496575
450 2884763975
451 2895661754
452 2902584074
453 2904499206
454 2904778297
455 2910813615
456 2919035654
457 2919056655
458 2919444242
459 2919539152
460 2919540324
461 2928124162
462 2928155463
463 2929225214
464 2929231814
465 2932427732
466 2932434143
467 2933418703
468 2935409950
469 2935894173
470 2939677603
471 2996224422
472 649813485
473 8003833427
474 8003857463
475 8003874731
476 8046355000
477 8054704839
478 8054730025
479 8054737364
480 8055416968

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12146

Hydrolase_4

Serine aminopeptidase, S33

81

298

0.81

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

86

240

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p0y-assembly1.cif.gz_A crystal structure of mtbmgl k74a (substrate analog complex) 0.8371 16 335
7p0y-assembly1.cif.gz_A crystal structure of mtbmgl k74a (substrate analog complex) 0.8317 16 335
6eic-assembly3.cif.gz_B crystal structure of rv0183, a monoglyceride lipase from mycobacterium tuberculosis 0.8268 16 335
6qe2-assembly2.cif.gz_B crystal structure of paleococcus ferrophilus monoacylglycerol lipase. 0.82 55 334
6eic-assembly3.cif.gz_B crystal structure of rv0183, a monoglyceride lipase from mycobacterium tuberculosis 0.8188 16 335
ID Description Score Start End Superfamily
af_O05805_38_331_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9146 52 335 3.40.50.1820
af_O05805_38_331_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8754 52 335 3.40.50.1820
af_O07427_2_279_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8253 16 335 3.40.50.1820
af_O07427_2_279_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8199 16 335 3.40.50.1820
af_O94305_2_276_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8001 51 334 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A3D3KU88-F1-model_v4 Alpha/beta hydrolase 0.977 160 335 GO:0016787
AF-A0A496PGQ4-F1-model_v4 Alpha/beta hydrolase 0.9763 33 335 GO:0016787
AF-A0A7X6ZB33-F1-model_v4 Alpha/beta hydrolase 0.9694 234 334
AF-A0A3B9VUX8-F1-model_v4 Alpha/beta hydrolase 0.9679 4 337 GO:0006654
GO:0042171
GO:0052689
GO:0055088
AF-A0A7Y0CJ20-F1-model_v4 Alpha/beta hydrolase 0.9676 52 334 GO:0016787

Map