F353336

General Info

Members Datasets Scaffolds Average Seq Length
240 188 480 305

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2739367654|2739605008
Length 332
Sequence FAGTPEPAVASLEALLGSRHEVVAVLTRADAPSGRGRKLTPSPVRARAEEAGLRVITDVPRGDEFVAMLQELEIDAAPVVAYGHILRPAVLAVPRLGWVNLHFSVLPAWRGAAPVQRAVIAGDEVTGATTFLLDEGMDTGPVLGTTTETIRPTDTSGDLLGRLAVSGAQLLVSTLDALEDGTLQPQQQPADGVSVAPKLTTDDARVLWTDPALAVDRLVRGCTPAPGAWTLLPDGSRLGLGPVSPRPEVTDLTAGEVRALKHEVLVGTATHAVALGEVRPVGKKAMPAPDWARGGGRALVEAGLVLGGATAPASTSASATATTPATTTGASA

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
14 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
15 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
16 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
21 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
22 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
23 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
44 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
45 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
67 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
68 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
69 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
70 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
71 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
72 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
73 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
74 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
75 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
76 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
77 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
78 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
79 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
80 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
81 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
84 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
85 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
86 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
87 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
88 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
89 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
90 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
91 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
92 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
93 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
94 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
95 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
96 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
97 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
98 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
99 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
100 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
101 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
102 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
103 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
104 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
105 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
106 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
107 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
108 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
109 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
110 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
111 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
112 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
113 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
114 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
115 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
116 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
131 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
132 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
133 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
134 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
135 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
136 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
137 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
138 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
139 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
140 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
141 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
142 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
143 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
145 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
146 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
147 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
148 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
149 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
150 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
151 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
152 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
153 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
154 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
155 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
156 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
157 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
158 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
159 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
160 2643221613 Oerskovia sp. Root22 Isolate Unclassified
161 2643221617 Nocardioides sp. Root79 Isolate Unclassified
162 2643221620 Nocardioides sp. Root240 Isolate Unclassified
163 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
164 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
165 2643221711 Terrabacter sp. Root85 Isolate Unclassified
166 2643221721 Oerskovia sp. Root918 Isolate Unclassified
167 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
168 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
169 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
170 2738541305 Nocardioides sp. CF167 Isolate Unclassified
171 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
172 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
173 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
174 2808606394 Promicromonospora sp. C35 Isolate Unclassified
175 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
176 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
177 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
178 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
179 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
180 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
181 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
182 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
183 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
184 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
185 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
186 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
187 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
188 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.25
Metatranscriptomes 0.42
Isolates 13.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.92
Nodule 0
Rhizoplane 9.58
Rhizosphere 76.67
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10065750 3300005327 Bacteria 2960
2 Ga0070683_100075856 3300005329 Bacteria 3142
3 Ga0070683_100162444 3300005329 Bacteria 2119
4 Ga0068869_100082753 3300005334 Bacteria 2399
5 Ga0068868_100071813 3300005338 Bacteria 2761
6 Ga0070691_10019276 3300005341 Bacteria 3147
7 Ga0070668_100298376 3300005347 Bacteria 1351
8 Ga0070714_100114192 3300005435 Bacteria 2395
9 Ga0070714_100292722 3300005435 Bacteria 1516
10 Ga0070713_100116180 3300005436 Bacteria 2340
11 Ga0070713_100412582 3300005436 Bacteria 1263
12 Ga0070705_100013973 3300005440 Bacteria 4119
13 Ga0070707_100388880 3300005468 Bacteria 1354
14 Ga0070664_100232327 3300005564 Bacteria 1653
15 Ga0068856_100193773 3300005614 Bacteria 2046
16 Ga0068852_100111194 3300005616 Bacteria 2491
17 Ga0068852_100126242 3300005616 Bacteria 2350
18 Ga0068859_100534216 3300005617 Bacteria 1267
19 Ga0068864_100113746 3300005618 Bacteria 2413
20 Ga0068866_10086680 3300005718 Bacteria 1695
21 Ga0068863_100270284 3300005841 Bacteria 1645
22 Ga0068858_100077913 3300005842 Bacteria 3079
23 Ga0068860_100115560 3300005843 Bacteria 2566
24 Ga0075363_100080488 3300006048 Bacteria 1781
25 Ga0070712_100309015 3300006175 Bacteria 1282
26 Ga0075369_10034128 3300006186 Bacteria 2159
27 Ga0075369_10041217 3300006186 Bacteria 1976
28 Ga0075370_10081232 3300006353 Bacteria 1863
29 Ga0075428_100005358 3300006844 Bacteria 14264
30 Ga0075430_100003045 3300006846 Bacteria 14018
31 Ga0075431_100137226 3300006847 Bacteria 2522
32 Ga0075434_100248626 3300006871 Bacteria 1797
33 Ga0068865_100050880 3300006881 Bacteria 2864
34 Ga0097620_100534223 3300006931 Bacteria 1267
35 Ga0105245_10030465 3300009098 Bacteria 4770
36 Ga0105245_10471300 3300009098 Bacteria 1267
37 Ga0114129_10027684 3300009147 Bacteria 8025
38 Ga0105243_10004006 3300009148 Bacteria 11735
39 Ga0105242_10014505 3300009176 Bacteria 6105
40 Ga0105238_10091221 3300009551 Bacteria 3034
41 Ga0105238_10237687 3300009551 Bacteria 1799
42 Ga0105249_10279318 3300009553 Bacteria 1667
43 Ga0105249_10400398 3300009553 Bacteria 1403
44 Ga0105239_10193225 3300010375 Bacteria 2279
45 Ga0157369_10020377 3300013105 Bacteria 7413
46 Ga0157374_10018926 3300013296 Bacteria 6088
47 Ga0157378_10012337 3300013297 Bacteria 7482
48 Ga0163162_10097039 3300013306 Bacteria 3036
49 Ga0157375_10001756 3300013308 Bacteria 18597
50 Ga0157375_10210226 3300013308 Bacteria 2103
51 Ga0163163_10057865 3300014325 Bacteria 3833
52 Ga0163163_10116505 3300014325 Bacteria 2703
53 Ga0157376_10026052 3300014969 Bacteria 4615
54 Ga0213876_10001219 3300021384 Bacteria 16232
55 Ga0224712_10030673 3300022467 Bacteria 1943
56 Ga0207645_10050575 3300025907 Bacteria 2654
57 Ga0207649_10134121 3300025920 Bacteria 1686
58 Ga0207652_10054737 3300025921 Bacteria 3430
59 Ga0207687_10265717 3300025927 Bacteria 1369
60 Ga0207664_10242900 3300025929 Bacteria 1569
61 Ga0207664_10364586 3300025929 Bacteria 1280
62 Ga0207690_10156678 3300025932 Bacteria 1694
63 Ga0207686_10018213 3300025934 Bacteria 3972
64 Ga0207709_10017014 3300025935 Bacteria 4053
65 Ga0207670_10345820 3300025936 Bacteria 1176
66 Ga0207661_10401901 3300025944 Bacteria 1242
67 Ga0207667_10219366 3300025949 Bacteria 1949
68 Ga0207677_10066754 3300026023 Bacteria 2517
69 Ga0207703_10197601 3300026035 Bacteria 1785
70 Ga0207702_10235380 3300026078 Bacteria 1713
71 Ga0207702_10355787 3300026078 Bacteria 1402
72 Ga0207641_10093710 3300026088 Bacteria 2633
73 Ga0207676_10030291 3300026095 Bacteria 4061
74 Ga0207674_10085895 3300026116 Bacteria 3141
75 Ga0207683_10041249 3300026121 Bacteria 4029
76 Ga0207683_10047396 3300026121 Bacteria 3764
77 Ga0207698_10133903 3300026142 Bacteria 2123
78 Ga0268266_10149513 3300028379 Bacteria 2104
79 Ga0307515_10009461 3300028794 Bacteria 18832
80 Ga0316181_1066290 3300030744 Bacteria 2119
81 Ga0265320_10069728 3300031240 Bacteria 1659
82 Ga0265325_10009217 3300031241 Bacteria 5777
83 Ga0265340_10004454 3300031247 Bacteria 7830
84 Ga0265316_10041675 3300031344 Bacteria 3673
85 Ga0265314_10044141 3300031711 Bacteria 3162
86 Ga0316576_10054891 3300031727 Bacteria 2906
87 Ga0307413_10150792 3300031824 Bacteria 1620
88 Ga0307416_100289482 3300032002 Bacteria 1621
89 Ga0307415_100278077 3300032126 Bacteria 1375
90 Ga0307507_10001045 3300033179 Bacteria 61644
91 Ga0373945_0103963 3300035116 Bacteria 1114
92 Ga0373947_0157779 3300035725 Bacteria 1465
93 Ga0395900_0077525 3300037418 Bacteria 3414
94 Ga0395898_0035563 3300037466 Bacteria 4951
95 Ga0395898_0127184 3300037466 Bacteria 2441
96 Ga0395901_0001374 3300038443 Bacteria 25464
97 Ga0436365_0093685 3300039437 Bacteria 33238
98 Ga0439461_0013024 3300041410 Bacteria 1564
99 Ga0439445_0044917 3300042004 Bacteria 1181
100 Ga0466969_0013761 3300044656 Bacteria 4260
101 Ga0466972_0040605 3300044658 Bacteria 2266
102 Ga0466972_0048795 3300044658 Bacteria 2045
103 Ga0466966_0013323 3300044684 Bacteria 5443
104 Ga0466961_0010469 3300044693 Bacteria 5917
105 Ga0466961_0035287 3300044693 Bacteria 3212
106 Ga0466963_0046819 3300044694 Bacteria 2853
107 Ga0466971_0010631 3300044719 Bacteria 4024
108 Ga0466971_0019249 3300044719 Bacteria 3030
109 Ga0466968_0060985 3300044735 Bacteria 1627
110 Ga0466968_0117614 3300044735 Bacteria 1200
111 Ga0466970_0003311 3300044765 Bacteria 7829
112 Ga0466957_0018997 3300044842 Bacteria 4041
113 Ga0466959_0019546 3300045049 Bacteria 4981
114 Ga0466959_0020878 3300045049 Bacteria 4826
115 Ga0466959_0174598 3300045049 Bacteria 1506
116 Ga0466967_0075686 3300045976 Bacteria 3026
117 Ga0466967_0077718 3300045976 Bacteria 2988
118 Ga0466967_0273959 3300045976 Bacteria 1618
119 Ga0495627_037621 3300046453 Bacteria 1500
120 Ga0495635_0282753 3300046663 Bacteria 1114
121 Ga0495604_0248410 3300047317 Bacteria 1214
122 Ga0495676_0245216 3300047321 Bacteria 1225
123 Ga0496101_0030713 3300048904 Bacteria 3771
124 Ga0496101_0116512 3300048904 Bacteria 2016
125 Ga0496102_0008231 3300048905 Bacteria 8928
126 Ga0496103_0100186 3300048906 Bacteria 1833
127 Ga0496103_0262141 3300048906 Bacteria 1112
128 Ga0496104_0036726 3300048907 Bacteria 4580
129 Ga0496105_0004495 3300048908 Bacteria 10496
130 Ga0496105_0061715 3300048908 Bacteria 3093
131 Ga0496105_0166062 3300048908 Bacteria 1811
132 Ga0496107_0121619 3300048910 Bacteria 1923
133 Ga0496108_0022043 3300048911 Bacteria 5237
134 Ga0496109_0298457 3300048912 Bacteria 1519
135 Ga0496110_0028262 3300048913 Bacteria 4815
136 Ga0496110_0170511 3300048913 Bacteria 1974
137 Ga0496110_0518595 3300048913 Bacteria 1084
138 Ga0496112_0192829 3300048915 Bacteria 1999
139 Ga0496112_0282825 3300048915 Bacteria 1606
140 Ga0496112_0301158 3300048915 Bacteria 1549
141 Ga0496113_0007480 3300048916 Bacteria 7035
142 Ga0496113_0070342 3300048916 Bacteria 2660
143 Ga0496114_0004692 3300048917 Bacteria 10627
144 Ga0496114_0020481 3300048917 Bacteria 5368
145 Ga0496114_0191685 3300048917 Bacteria 1789
146 Ga0496119_0035100 3300048922 Bacteria 3291
147 Ga0496122_0000899 3300048925 Bacteria 54992
148 Ga0496125_0000025 3300048928 Bacteria 440074
149 Ga0501031_0003503 3300049568 Bacteria 10070
150 Ga0501033_0003603 3300049570 Bacteria 12641
151 Ga0501033_0064764 3300049570 Bacteria 2689
152 Ga0501034_0138333 3300049571 Bacteria 2415
153 Ga0501034_0556388 3300049571 Bacteria 1056
154 Ga0501036_0002084 3300049572 Bacteria 15586
155 Ga0501036_0113537 3300049572 Bacteria 2289
156 Ga0501037_0040591 3300049573 Bacteria 3424
157 Ga0501038_0017844 3300049574 Bacteria 6412
158 Ga0501038_0063457 3300049574 Bacteria 3153
159 Ga0501039_0053620 3300049575 Bacteria 3120
160 Ga0501040_0008639 3300049576 Bacteria 6615
161 Ga0501041_0001086 3300049577 Bacteria 14885
162 Ga0501041_0236476 3300049577 Bacteria 1147
163 Ga0501042_0019429 3300049578 Bacteria 4717
164 Ga0501042_0038549 3300049578 Bacteria 3393
165 Ga0501043_0022590 3300049579 Bacteria 4931
166 Ga0501043_0075761 3300049579 Bacteria 2642
167 Ga0501043_0226005 3300049579 Bacteria 1447
168 Ga0501046_0031794 3300049580 Bacteria 4276
169 Ga0501047_0061479 3300049581 Bacteria 3624
170 Ga0501047_0138033 3300049581 Bacteria 2318
171 Ga0501048_0011205 3300049582 Bacteria 6683
172 Ga0501067_0012962 3300049583 Bacteria 4614
173 Ga0501068_0061128 3300049584 Bacteria 2288
174 Ga0501070_0172079 3300049586 Bacteria 1783
175 Ga0501071_0000025 3300049587 Bacteria 49332
176 Ga0501071_0002516 3300049587 Bacteria 11156
177 Ga0501072_0072155 3300049588 Bacteria 2728
178 Ga0501072_0083601 3300049588 Bacteria 2530
179 Ga0501074_0022174 3300049590 Bacteria 4614
180 Ga0501075_0001906 3300049591 Bacteria 13758
181 Ga0501076_0014374 3300049592 Bacteria 5962
182 Ga0501077_0004027 3300049593 Bacteria 8868
183 Ga0501079_0005079 3300049741 Bacteria 9774
184 Ga0501079_0071953 3300049741 Bacteria 2671
185 Ga0501080_0022049 3300049742 Bacteria 5900
186 Ga0501081_0033070 3300049743 Bacteria 3511
187 Ga0501083_0014607 3300049744 Bacteria 5490
188 Ga0501035_0006938 3300049822 Bacteria 10581
189 Ga0501035_0019234 3300049822 Bacteria 6287
190 Ga0501044_0002127 3300049823 Bacteria 22728
191 Ga0501044_0023930 3300049823 Bacteria 6491
192 Ga0501044_0060638 3300049823 Bacteria 3873
193 Ga0501044_0090180 3300049823 Bacteria 3093
194 nmdc:mga07m45_143780_c1 3300050496 Bacteria 1382
195 nmdc:mga05p37_11787_c1 3300050507 Bacteria 10420
196 nmdc:mga09592_218816_c1 3300050508 Bacteria 1650
197 nmdc:mga0n895_164891_c1 3300050512 Bacteria 2247
198 nmdc:mga08x19_7720_c1 3300050514 Bacteria 6389
199 nmdc:mga0sz30_4988_c1 3300050516 Bacteria 4843
200 Ga0495601_0442661 3300053077 Bacteria 841
201 Ga0500568_0032682 3300053139 Bacteria 2139
202 Ga0501084_0002071 3300054114 Bacteria 16010
203 Ga0501084_0105884 3300054114 Bacteria 2362
204 Ga0501082_0006666 3300060353 Bacteria 9992
205 Ga0501082_0109992 3300060353 Bacteria 2385
206 Ga0466962_0002669 3300061719 Bacteria 8488
207 Ga0466962_0024358 3300061719 Bacteria 2907
208 Ga0530510_0005027 3300061734 Bacteria 9131
209 2739605008 2739367654 Bacteria 6049412
210 2523386766 2523231044 Bacteria 6434991
211 2643849677 2643221567 Bacteria 4163945
212 2644083342 2643221613 Bacteria 4622396
213 2644102355 2643221617 Bacteria 5139111
214 2644115579 2643221620 Bacteria 5134593
215 2644135680 2643221624 Bacteria 4384879
216 2644527071 2643221694 Bacteria 4392972
217 2644611036 2643221711 Bacteria 4865335
218 2644666373 2643221721 Bacteria 4486924
219 2644670196 2643221722 Bacteria 4247614
220 2729904941 2728369276 Bacteria 5610032
221 2738695708 2738541272 Bacteria 6848551
222 2738868131 2738541305 Bacteria 4910150
223 2739326151 2738543027 Bacteria 6409078
224 2760308048 2758568522 Bacteria 5953541
225 2760623328 2758568621 Bacteria 5967089
226 2809028214 2808606394 Bacteria 6248540
227 2819691887 2818991462 Bacteria 4320267
228 2819729335 2818991469 Bacteria 4644110
229 2839986866 2839986021 Bacteria 3685650
230 2861527668 2861520306 Bacteria 8348283
231 2883824602 2883821847 Bacteria 5121194
232 2904769784 2904765812 Bacteria 5369154
233 2904771357 2904770941 Bacteria 5580202
234 2919423148 2919420072 Bacteria 5390363
235 2919435756 2919432681 Bacteria 5390474
236 2919472228 2919468124 Bacteria 9133025
237 2932431915 2932431166 Bacteria 4215299
238 2935891036 2935890801 Bacteria 4593001
239 3006427800 3006425503 Bacteria 6491253
240 8056582246 8056579771 Bacteria 5840325
241 Ga0070658_10065750
242 Ga0070683_100075856
243 Ga0070683_100162444
244 Ga0068869_100082753
245 Ga0068868_100071813
246 Ga0070691_10019276
247 Ga0070668_100298376
248 Ga0070714_100114192
249 Ga0070714_100292722
250 Ga0070713_100116180
251 Ga0070713_100412582
252 Ga0070705_100013973
253 Ga0070707_100388880
254 Ga0070664_100232327
255 Ga0068856_100193773
256 Ga0068852_100111194
257 Ga0068852_100126242
258 Ga0068859_100534216
259 Ga0068864_100113746
260 Ga0068866_10086680
261 Ga0068863_100270284
262 Ga0068858_100077913
263 Ga0068860_100115560
264 Ga0075363_100080488
265 Ga0070712_100309015
266 Ga0075369_10034128
267 Ga0075369_10041217
268 Ga0075370_10081232
269 Ga0075428_100005358
270 Ga0075430_100003045
271 Ga0075431_100137226
272 Ga0075434_100248626
273 Ga0068865_100050880
274 Ga0097620_100534223
275 Ga0105245_10030465
276 Ga0105245_10471300
277 Ga0114129_10027684
278 Ga0105243_10004006
279 Ga0105242_10014505
280 Ga0105238_10091221
281 Ga0105238_10237687
282 Ga0105249_10279318
283 Ga0105249_10400398
284 Ga0105239_10193225
285 Ga0157369_10020377
286 Ga0157374_10018926
287 Ga0157378_10012337
288 Ga0163162_10097039
289 Ga0157375_10001756
290 Ga0157375_10210226
291 Ga0163163_10057865
292 Ga0163163_10116505
293 Ga0157376_10026052
294 Ga0213876_10001219
295 Ga0224712_10030673
296 Ga0207645_10050575
297 Ga0207649_10134121
298 Ga0207652_10054737
299 Ga0207687_10265717
300 Ga0207664_10242900
301 Ga0207664_10364586
302 Ga0207690_10156678
303 Ga0207686_10018213
304 Ga0207709_10017014
305 Ga0207670_10345820
306 Ga0207661_10401901
307 Ga0207667_10219366
308 Ga0207677_10066754
309 Ga0207703_10197601
310 Ga0207702_10235380
311 Ga0207702_10355787
312 Ga0207641_10093710
313 Ga0207676_10030291
314 Ga0207674_10085895
315 Ga0207683_10041249
316 Ga0207683_10047396
317 Ga0207698_10133903
318 Ga0268266_10149513
319 Ga0307515_10009461
320 Ga0316181_1066290
321 Ga0265320_10069728
322 Ga0265325_10009217
323 Ga0265340_10004454
324 Ga0265316_10041675
325 Ga0265314_10044141
326 Ga0316576_10054891
327 Ga0307413_10150792
328 Ga0307416_100289482
329 Ga0307415_100278077
330 Ga0307507_10001045
331 Ga0373945_0103963
332 Ga0373947_0157779
333 Ga0395900_0077525
334 Ga0395898_0035563
335 Ga0395898_0127184
336 Ga0395901_0001374
337 Ga0436365_0093685
338 Ga0439461_0013024
339 Ga0439445_0044917
340 Ga0466969_0013761
341 Ga0466972_0040605
342 Ga0466972_0048795
343 Ga0466966_0013323
344 Ga0466961_0010469
345 Ga0466961_0035287
346 Ga0466963_0046819
347 Ga0466971_0010631
348 Ga0466971_0019249
349 Ga0466968_0060985
350 Ga0466968_0117614
351 Ga0466970_0003311
352 Ga0466957_0018997
353 Ga0466959_0019546
354 Ga0466959_0020878
355 Ga0466959_0174598
356 Ga0466967_0075686
357 Ga0466967_0077718
358 Ga0466967_0273959
359 Ga0495627_037621
360 Ga0495635_0282753
361 Ga0495604_0248410
362 Ga0495676_0245216
363 Ga0496101_0030713
364 Ga0496101_0116512
365 Ga0496102_0008231
366 Ga0496103_0100186
367 Ga0496103_0262141
368 Ga0496104_0036726
369 Ga0496105_0004495
370 Ga0496105_0061715
371 Ga0496105_0166062
372 Ga0496107_0121619
373 Ga0496108_0022043
374 Ga0496109_0298457
375 Ga0496110_0028262
376 Ga0496110_0170511
377 Ga0496110_0518595
378 Ga0496112_0192829
379 Ga0496112_0282825
380 Ga0496112_0301158
381 Ga0496113_0007480
382 Ga0496113_0070342
383 Ga0496114_0004692
384 Ga0496114_0020481
385 Ga0496114_0191685
386 Ga0496119_0035100
387 Ga0496122_0000899
388 Ga0496125_0000025
389 Ga0501031_0003503
390 Ga0501033_0003603
391 Ga0501033_0064764
392 Ga0501034_0138333
393 Ga0501034_0556388
394 Ga0501036_0002084
395 Ga0501036_0113537
396 Ga0501037_0040591
397 Ga0501038_0017844
398 Ga0501038_0063457
399 Ga0501039_0053620
400 Ga0501040_0008639
401 Ga0501041_0001086
402 Ga0501041_0236476
403 Ga0501042_0019429
404 Ga0501042_0038549
405 Ga0501043_0022590
406 Ga0501043_0075761
407 Ga0501043_0226005
408 Ga0501046_0031794
409 Ga0501047_0061479
410 Ga0501047_0138033
411 Ga0501048_0011205
412 Ga0501067_0012962
413 Ga0501068_0061128
414 Ga0501070_0172079
415 Ga0501071_0000025
416 Ga0501071_0002516
417 Ga0501072_0072155
418 Ga0501072_0083601
419 Ga0501074_0022174
420 Ga0501075_0001906
421 Ga0501076_0014374
422 Ga0501077_0004027
423 Ga0501079_0005079
424 Ga0501079_0071953
425 Ga0501080_0022049
426 Ga0501081_0033070
427 Ga0501083_0014607
428 Ga0501035_0006938
429 Ga0501035_0019234
430 Ga0501044_0002127
431 Ga0501044_0023930
432 Ga0501044_0060638
433 Ga0501044_0090180
434 nmdc:mga07m45_143780_c1
435 nmdc:mga05p37_11787_c1
436 nmdc:mga09592_218816_c1
437 nmdc:mga0n895_164891_c1
438 nmdc:mga08x19_7720_c1
439 nmdc:mga0sz30_4988_c1
440 Ga0495601_0442661
441 Ga0500568_0032682
442 Ga0501084_0002071
443 Ga0501084_0105884
444 Ga0501082_0006666
445 Ga0501082_0109992
446 Ga0466962_0002669
447 Ga0466962_0024358
448 Ga0530510_0005027
449 2739605008
450 2523386766
451 2643849677
452 2644083342
453 2644102355
454 2644115579
455 2644135680
456 2644527071
457 2644611036
458 2644666373
459 2644670196
460 2729904941
461 2738695708
462 2738868131
463 2739326151
464 2760308048
465 2760623328
466 2809028214
467 2819691887
468 2819729335
469 2839986866
470 2861527668
471 2883824602
472 2904769784
473 2904771357
474 2919423148
475 2919435756
476 2919472228
477 2932431915
478 2935891036
479 3006427800
480 8056582246

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02911

Formyl_trans_C

Formyl transferase, C-terminal domain

198

296

0.95

PF00551

Formyl_trans_N

Formyl transferase

1

175

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4iqf-assembly2.cif.gz_B crystal structure of methyionyl-trna formyltransferase from bacillus anthracis 0.9527 1 308
4iqf-assembly2.cif.gz_B crystal structure of methyionyl-trna formyltransferase from bacillus anthracis 0.9467 1 308
3tqq-assembly1.cif.gz_A structure of the methionyl-trna formyltransferase (fmt) from coxiella burnetii 0.943 2 309
2fmt-assembly2.cif.gz_B methionyl-trnafmet formyltransferase complexed with formyl-methionyl-trnafmet 0.9351 2 309
3tqq-assembly1.cif.gz_A structure of the methionyl-trna formyltransferase (fmt) from coxiella burnetii 0.931 2 309
ID Description Score Start End Superfamily
af_P9WND3_1_310_3.40.50.12230 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9797 1 303 3.40.50.12230
3tqqA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.977 2 206 3.40.50.170
3tqqA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.962 2 206 3.40.50.170
af_P9WND3_1_310_3.40.50.12230 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9578 1 303 3.40.50.12230
3rfoA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9569 1 206 3.40.50.170
ID Description Score Start End GO Terms
AF-A0A1H2DD92-F1-model_v4 deleted 0.9889 1 308
AF-A0A2P9IMP2-F1-model_v4 deleted 0.9884 1 292
AF-A0A7C7KXL8-F1-model_v4 methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9876 1 242 GO:0004479
GO:0005829
AF-A0A538E3I9-F1-model_v4 methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.987 1 175 GO:0004479
GO:0005829
AF-A0A829PS12-F1-model_v4 methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9859 51 298 GO:0004479
GO:0005829

Map