F353222
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 240 | 143 | 240 | 307 |
Family's Representative Sequence
| Representative Sequence | 3300048910|Ga0496107_0067235|Ga0496107_0067235_23_1177 |
| Length | 352 |
| Sequence | MNADERRSDLRLPAKNLRLIFWNRLSGHACKAQTLPEEICMKLKYFLSLPVAIFLIAGMALAQEPANFSLLVDGGGFLGVYAENISRDNMGRYHMSQVRGVGVTQVIKDSPAEKAGLRKDDVILRIDGENVTSVRKLNRVVSELAPDQSVRVTVSRGGAEQEITATIGKRNNSNLVGDVLRGQPQIWKWEGDPKSFKLEGLDKFPNNGGDMTFFLGNSRRIGVSTMELTKQLADYFGIAGGKGVLVTSVTDDGPAAKAGVRAGDVITAIDGEAVDSPGDIARVINRKKDGDVTLTIIRNKSQQTIHVTPREGGFSGTWGQPQMGRRIVIPRIELPDIDTPRARILRGEQGPI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 29 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 35 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 36 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 38 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 39 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 40 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 41 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 42 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 43 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 44 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 45 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 46 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 47 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 49 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 50 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 51 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 52 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 54 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 103 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 106 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 107 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 108 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 109 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 110 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 111 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 112 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 113 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 114 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 115 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 116 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 117 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 118 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 124 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 125 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 126 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 127 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 128 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 129 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 130 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 131 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 132 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 133 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 134 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 135 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 136 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 137 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 138 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 139 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 140 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 141 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 142 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 143 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.92 |
| Rhizosphere | 96.67 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.42 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNAas_1000381 | 3300000532 | Bacteria | 4299 |
| 2 | JGI24751J29686_10000122 | 3300002459 | Bacteria | 39084 |
| 3 | JGI25406J46586_10018943 | 3300003203 | Unclassified | 2816 |
| 4 | rootH2_10104955 | 3300003320 | Unclassified | 2650 |
| 5 | Ga0065714_10064481 | 3300005288 | Bacteria | 54282 |
| 6 | Ga0065712_10000143 | 3300005290 | Bacteria | 54339 |
| 7 | Ga0065712_10007720 | 3300005290 | Bacteria | 2978 |
| 8 | Ga0065715_10003850 | 3300005293 | Bacteria | 6370 |
| 9 | Ga0065715_10093499 | 3300005293 | Bacteria | 4660 |
| 10 | Ga0065715_10101501 | 3300005293 | Bacteria | 3153 |
| 11 | Ga0065715_10114753 | 3300005293 | Bacteria | 2439 |
| 12 | Ga0065715_10206591 | 3300005293 | Bacteria | 1320 |
| 13 | Ga0065707_10001264 | 3300005295 | Bacteria | 7952 |
| 14 | Ga0070690_100066737 | 3300005330 | Bacteria | 2330 |
| 15 | Ga0070670_100000741 | 3300005331 | Bacteria | 25354 |
| 16 | Ga0070670_100135415 | 3300005331 | Bacteria | 2129 |
| 17 | Ga0070670_100464489 | 3300005331 | Unclassified | 1123 |
| 18 | Ga0068869_100162988 | 3300005334 | Unclassified | 1737 |
| 19 | Ga0070680_100000453 | 3300005336 | Bacteria | 27916 |
| 20 | Ga0070682_100000139 | 3300005337 | Bacteria | 58968 |
| 21 | Ga0070682_100001505 | 3300005337 | Bacteria | 13062 |
| 22 | Ga0070682_100257873 | 3300005337 | Unclassified | 1260 |
| 23 | Ga0070689_100000386 | 3300005340 | Bacteria | 25853 |
| 24 | Ga0070673_100154642 | 3300005364 | Bacteria | 1945 |
| 25 | Ga0070701_10022404 | 3300005438 | Bacteria | 3028 |
| 26 | Ga0070705_100051690 | 3300005440 | Unclassified | 2398 |
| 27 | Ga0070700_100000161 | 3300005441 | Bacteria | 38637 |
| 28 | Ga0070694_100013117 | 3300005444 | Bacteria | 5170 |
| 29 | Ga0070694_100037608 | 3300005444 | Bacteria | 3210 |
| 30 | Ga0070694_100153474 | 3300005444 | Bacteria | 1684 |
| 31 | Ga0070694_100227112 | 3300005444 | Unclassified | 1403 |
| 32 | Ga0070708_100000834 | 3300005445 | Bacteria | 23235 |
| 33 | Ga0070681_10001374 | 3300005458 | Bacteria | 21319 |
| 34 | Ga0070681_10140660 | 3300005458 | Bacteria | 2343 |
| 35 | Ga0070706_100000193 | 3300005467 | Bacteria | 76590 |
| 36 | Ga0070706_100013881 | 3300005467 | Bacteria | 7446 |
| 37 | Ga0070706_100059507 | 3300005467 | Bacteria | 3526 |
| 38 | Ga0070707_100035203 | 3300005468 | Bacteria | 4776 |
| 39 | Ga0070707_100078142 | 3300005468 | Bacteria | 3193 |
| 40 | Ga0070698_100009468 | 3300005471 | Bacteria | 10435 |
| 41 | Ga0070698_100010088 | 3300005471 | Bacteria | 10090 |
| 42 | Ga0070699_100003660 | 3300005518 | Bacteria | 13617 |
| 43 | Ga0070699_100004437 | 3300005518 | Bacteria | 12411 |
| 44 | Ga0070699_100031744 | 3300005518 | Bacteria | 4560 |
| 45 | Ga0070679_100071574 | 3300005530 | Bacteria | 3458 |
| 46 | Ga0070697_100048980 | 3300005536 | Unclassified | 3427 |
| 47 | Ga0068853_100050704 | 3300005539 | Bacteria | 3571 |
| 48 | Ga0068853_100529394 | 3300005539 | Bacteria | 1115 |
| 49 | Ga0070695_100105863 | 3300005545 | Bacteria | 1901 |
| 50 | Ga0070696_100016485 | 3300005546 | Bacteria | 4977 |
| 51 | Ga0070696_100053287 | 3300005546 | Bacteria | 2816 |
| 52 | Ga0070696_100111921 | 3300005546 | Bacteria | 1967 |
| 53 | Ga0070696_100113570 | 3300005546 | Bacteria | 1953 |
| 54 | Ga0070693_100140740 | 3300005547 | Bacteria | 1519 |
| 55 | Ga0070693_100169358 | 3300005547 | Bacteria | 1397 |
| 56 | Ga0070704_100044860 | 3300005549 | Bacteria | 3074 |
| 57 | Ga0070664_100088008 | 3300005564 | Bacteria | 2685 |
| 58 | Ga0068857_100106414 | 3300005577 | Bacteria | 2519 |
| 59 | Ga0068857_100400468 | 3300005577 | Unclassified | 1277 |
| 60 | Ga0068856_100007763 | 3300005614 | Bacteria | 10479 |
| 61 | Ga0070702_100032417 | 3300005615 | Bacteria | 2867 |
| 62 | Ga0068852_100384462 | 3300005616 | Bacteria | 1377 |
| 63 | Ga0068859_100003194 | 3300005617 | Bacteria | 16682 |
| 64 | Ga0068859_100021252 | 3300005617 | Bacteria | 6513 |
| 65 | Ga0068859_100095251 | 3300005617 | Bacteria | 3029 |
| 66 | Ga0068859_100107074 | 3300005617 | Bacteria | 2855 |
| 67 | Ga0068859_100128166 | 3300005617 | Bacteria | 2608 |
| 68 | Ga0068859_100328940 | 3300005617 | Unclassified | 1622 |
| 69 | Ga0068859_100332543 | 3300005617 | Bacteria | 1613 |
| 70 | Ga0068859_100717441 | 3300005617 | Bacteria | 1090 |
| 71 | Ga0068864_100032894 | 3300005618 | Bacteria | 4407 |
| 72 | Ga0068864_100157477 | 3300005618 | Unclassified | 2062 |
| 73 | Ga0068864_100417660 | 3300005618 | Bacteria | 1278 |
| 74 | Ga0068851_10000462 | 3300005834 | Bacteria | 17895 |
| 75 | Ga0068870_10006938 | 3300005840 | Bacteria | 5023 |
| 76 | Ga0068863_100226218 | 3300005841 | Bacteria | 1803 |
| 77 | Ga0068863_100499752 | 3300005841 | Unclassified | 1197 |
| 78 | Ga0068858_100021674 | 3300005842 | Bacteria | 6005 |
| 79 | Ga0068858_100500313 | 3300005842 | Unclassified | 1174 |
| 80 | Ga0068860_100120638 | 3300005843 | Bacteria | 2510 |
| 81 | Ga0068862_100025907 | 3300005844 | Bacteria | 4926 |
| 82 | Ga0068862_100206905 | 3300005844 | Unclassified | 1771 |
| 83 | Ga0081539_10003189 | 3300005985 | Bacteria | 20742 |
| 84 | Ga0097621_100000961 | 3300006237 | Bacteria | 20199 |
| 85 | Ga0068871_100011478 | 3300006358 | Bacteria | 6500 |
| 86 | Ga0075433_10012947 | 3300006852 | Bacteria | 6762 |
| 87 | Ga0075433_10013657 | 3300006852 | Bacteria | 6612 |
| 88 | Ga0075433_10026241 | 3300006852 | Bacteria | 4930 |
| 89 | Ga0075433_10101212 | 3300006852 | Bacteria | 2551 |
| 90 | Ga0075433_10253611 | 3300006852 | Bacteria | 1561 |
| 91 | Ga0075434_100212712 | 3300006871 | Bacteria | 1953 |
| 92 | Ga0068865_100263880 | 3300006881 | Unclassified | 1364 |
| 93 | Ga0097620_100003194 | 3300006931 | Bacteria | 16682 |
| 94 | Ga0097620_100021250 | 3300006931 | Bacteria | 6513 |
| 95 | Ga0097620_100095252 | 3300006931 | Bacteria | 3029 |
| 96 | Ga0097620_100107081 | 3300006931 | Bacteria | 2855 |
| 97 | Ga0097620_100128184 | 3300006931 | Bacteria | 2608 |
| 98 | Ga0097620_100328911 | 3300006931 | Unclassified | 1622 |
| 99 | Ga0097620_100332530 | 3300006931 | Bacteria | 1613 |
| 100 | Ga0097620_100717517 | 3300006931 | Bacteria | 1090 |
| 101 | Ga0075435_100011834 | 3300007076 | Bacteria | 6440 |
| 102 | Ga0075435_100178176 | 3300007076 | Bacteria | 1796 |
| 103 | Ga0105240_10113730 | 3300009093 | Bacteria | 3271 |
| 104 | Ga0111539_10002264 | 3300009094 | Bacteria | 25641 |
| 105 | Ga0111539_10011139 | 3300009094 | Bacteria | 11313 |
| 106 | Ga0105247_10012033 | 3300009101 | Bacteria | 5197 |
| 107 | Ga0105247_10211778 | 3300009101 | Unclassified | 1307 |
| 108 | Ga0114129_10002960 | 3300009147 | Bacteria | 23767 |
| 109 | Ga0114129_10057709 | 3300009147 | Bacteria | 5431 |
| 110 | Ga0114129_10116204 | 3300009147 | Bacteria | 3687 |
| 111 | Ga0114129_10151494 | 3300009147 | Bacteria | 3174 |
| 112 | Ga0114129_10159849 | 3300009147 | Bacteria | 3079 |
| 113 | Ga0114129_10223124 | 3300009147 | Bacteria | 2541 |
| 114 | Ga0114129_10590060 | 3300009147 | Bacteria | 1441 |
| 115 | Ga0105243_10003410 | 3300009148 | Bacteria | 12890 |
| 116 | Ga0105241_10114109 | 3300009174 | Bacteria | 2167 |
| 117 | Ga0105241_10224858 | 3300009174 | Bacteria | 1579 |
| 118 | Ga0105241_10272472 | 3300009174 | Unclassified | 1443 |
| 119 | Ga0105248_10056979 | 3300009177 | Bacteria | 4385 |
| 120 | Ga0105248_10059049 | 3300009177 | Bacteria | 4308 |
| 121 | Ga0105248_10131213 | 3300009177 | Bacteria | 2827 |
| 122 | Ga0105248_10355318 | 3300009177 | Bacteria | 1650 |
| 123 | Ga0105237_10000837 | 3300009545 | Bacteria | 42069 |
| 124 | Ga0105237_10090914 | 3300009545 | Bacteria | 3042 |
| 125 | Ga0105238_10006984 | 3300009551 | Bacteria | 11284 |
| 126 | Ga0105238_10012886 | 3300009551 | Bacteria | 8438 |
| 127 | Ga0105249_10194218 | 3300009553 | Bacteria | 1983 |
| 128 | Ga0105239_10081682 | 3300010375 | Bacteria | 3558 |
| 129 | Ga0105239_10313666 | 3300010375 | Bacteria | 1768 |
| 130 | Ga0105239_10413257 | 3300010375 | Bacteria | 1528 |
| 131 | Ga0105246_10031584 | 3300011119 | Bacteria | 3506 |
| 132 | Ga0105246_10149970 | 3300011119 | Bacteria | 1764 |
| 133 | Ga0157373_10006131 | 3300013100 | Bacteria | 8989 |
| 134 | Ga0157373_10010307 | 3300013100 | Bacteria | 6886 |
| 135 | Ga0163162_10113644 | 3300013306 | Bacteria | 2806 |
| 136 | Ga0157372_10004986 | 3300013307 | Bacteria | 14106 |
| 137 | Ga0157372_10242286 | 3300013307 | Bacteria | 2092 |
| 138 | Ga0157375_10006910 | 3300013308 | Bacteria | 9902 |
| 139 | Ga0163163_10003456 | 3300014325 | Bacteria | 13423 |
| 140 | Ga0157379_10127255 | 3300014968 | Bacteria | 2292 |
| 141 | Ga0157379_10241401 | 3300014968 | Unclassified | 1639 |
| 142 | Ga0207656_10013480 | 3300025321 | Unclassified | 3127 |
| 143 | Ga0207653_10006368 | 3300025885 | Bacteria | 3683 |
| 144 | Ga0207710_10003895 | 3300025900 | Bacteria | 6590 |
| 145 | Ga0207647_10018199 | 3300025904 | Bacteria | 4760 |
| 146 | Ga0207643_10014653 | 3300025908 | Bacteria | 4262 |
| 147 | Ga0207643_10134376 | 3300025908 | Bacteria | 1474 |
| 148 | Ga0207643_10141026 | 3300025908 | Bacteria | 1440 |
| 149 | Ga0207684_10000251 | 3300025910 | Bacteria | 80339 |
| 150 | Ga0207684_10158525 | 3300025910 | Bacteria | 1948 |
| 151 | Ga0207654_10066440 | 3300025911 | Bacteria | 2127 |
| 152 | Ga0207707_10000006 | 3300025912 | Bacteria | 374131 |
| 153 | Ga0207707_10123040 | 3300025912 | Bacteria | 2268 |
| 154 | Ga0207695_10038274 | 3300025913 | Bacteria | 5166 |
| 155 | Ga0207671_10001913 | 3300025914 | Bacteria | 23118 |
| 156 | Ga0207660_10004038 | 3300025917 | Bacteria | 9578 |
| 157 | Ga0207662_10047150 | 3300025918 | Bacteria | 2552 |
| 158 | Ga0207662_10083036 | 3300025918 | Bacteria | 1958 |
| 159 | Ga0207652_10014005 | 3300025921 | Bacteria | 6493 |
| 160 | Ga0207646_10028288 | 3300025922 | Bacteria | 5104 |
| 161 | Ga0207646_10175621 | 3300025922 | Bacteria | 1935 |
| 162 | Ga0207694_10004472 | 3300025924 | Bacteria | 10908 |
| 163 | Ga0207650_10000047 | 3300025925 | Bacteria | 175675 |
| 164 | Ga0207687_10078785 | 3300025927 | Unclassified | 2373 |
| 165 | Ga0207709_10001927 | 3300025935 | Bacteria | 13630 |
| 166 | Ga0207709_10266192 | 3300025935 | Bacteria | 1259 |
| 167 | Ga0207670_10000161 | 3300025936 | Bacteria | 44305 |
| 168 | Ga0207711_10044407 | 3300025941 | Bacteria | 3794 |
| 169 | Ga0207711_10291472 | 3300025941 | Unclassified | 1504 |
| 170 | Ga0207711_10301166 | 3300025941 | Bacteria | 1479 |
| 171 | Ga0207689_10229046 | 3300025942 | Unclassified | 1536 |
| 172 | Ga0207689_10245983 | 3300025942 | Unclassified | 1479 |
| 173 | Ga0207679_10310025 | 3300025945 | Unclassified | 1363 |
| 174 | Ga0207712_10005305 | 3300025961 | Bacteria | 8142 |
| 175 | Ga0207703_10031721 | 3300026035 | Unclassified | 4179 |
| 176 | Ga0207703_10067072 | 3300026035 | Unclassified | 2953 |
| 177 | Ga0207703_10171729 | 3300026035 | Bacteria | 1907 |
| 178 | Ga0207639_10323617 | 3300026041 | Bacteria | 1370 |
| 179 | Ga0207708_10000341 | 3300026075 | Bacteria | 36836 |
| 180 | Ga0207708_10013270 | 3300026075 | Bacteria | 6152 |
| 181 | Ga0207648_10119361 | 3300026089 | Bacteria | 2318 |
| 182 | Ga0207676_10015774 | 3300026095 | Bacteria | 5461 |
| 183 | Ga0207676_10088455 | 3300026095 | Bacteria | 2536 |
| 184 | Ga0207676_10160483 | 3300026095 | Bacteria | 1947 |
| 185 | Ga0207676_10210886 | 3300026095 | Bacteria | 1723 |
| 186 | Ga0207674_10128372 | 3300026116 | Bacteria | 2500 |
| 187 | Ga0207675_100145225 | 3300026118 | Bacteria | 2255 |
| 188 | Ga0207428_10003842 | 3300027907 | Bacteria | 14410 |
| 189 | Ga0207428_10241755 | 3300027907 | Bacteria | 1348 |
| 190 | Ga0268265_10031513 | 3300028380 | Bacteria | 3829 |
| 191 | Ga0268264_10103484 | 3300028381 | Bacteria | 2479 |
| 192 | Ga0307405_10054153 | 3300031731 | Unclassified | 2503 |
| 193 | Ga0307413_10126027 | 3300031824 | Unclassified | 1744 |
| 194 | Ga0307406_10004150 | 3300031901 | Bacteria | 7887 |
| 195 | Ga0307407_10237188 | 3300031903 | Bacteria | 1242 |
| 196 | Ga0307416_100036683 | 3300032002 | Unclassified | 3763 |
| 197 | Ga0307415_100128551 | 3300032126 | Unclassified | 1913 |
| 198 | Ga0373951_0000667 | 3300035091 | Bacteria | 9448 |
| 199 | Ga0373939_0024111 | 3300035114 | Unclassified | 1692 |
| 200 | Ga0395900_0073141 | 3300037418 | Bacteria | 3524 |
| 201 | Ga0395901_0095944 | 3300038443 | Bacteria | 3108 |
| 202 | Ga0242420_000576 | 3300038996 | Bacteria | 4254 |
| 203 | Ga0439448_0013059 | 3300042005 | Bacteria | 2493 |
| 204 | Ga0439458_0023870 | 3300042157 | Bacteria | 1427 |
| 205 | Ga0495663_0000155 | 3300046525 | Bacteria | 27877 |
| 206 | Ga0495598_0000395 | 3300046537 | Bacteria | 7840 |
| 207 | Ga0495621_0000020 | 3300046539 | Bacteria | 29844 |
| 208 | Ga0495656_0143117 | 3300046615 | Unclassified | 1148 |
| 209 | Ga0495672_0041632 | 3300047320 | Unclassified | 2776 |
| 210 | Ga0496102_0038971 | 3300048905 | Bacteria | 4292 |
| 211 | Ga0496103_0065845 | 3300048906 | Bacteria | 2261 |
| 212 | Ga0496104_0118478 | 3300048907 | Bacteria | 2542 |
| 213 | Ga0496106_0291556 | 3300048909 | Bacteria | 1308 |
| 214 | Ga0496107_0067235 | 3300048910 | Bacteria | 2600 |
| 215 | Ga0496109_0380755 | 3300048912 | Unclassified | 1333 |
| 216 | Ga0496112_0474277 | 3300048915 | Unclassified | 1188 |
| 217 | Ga0501298_000611 | 3300049521 | Bacteria | 4885 |
| 218 | Ga0501206_013349 | 3300049653 | Unclassified | 1122 |
| 219 | Ga0501223_017816 | 3300049663 | Bacteria | 1400 |
| 220 | Ga0501235_001297 | 3300049669 | Bacteria | 5291 |
| 221 | Ga0501253_015012 | 3300049683 | Bacteria | 1265 |
| 222 | Ga0501234_005247 | 3300049707 | Unclassified | 2027 |
| 223 | Ga0501268_011981 | 3300049765 | Bacteria | 1379 |
| 224 | Ga0501226_003674 | 3300049853 | Unclassified | 1806 |
| 225 | nmdc:mga05p37_21810_c1 | 3300050507 | Bacteria | 7759 |
| 226 | nmdc:mga05p37_233675_c1 | 3300050507 | Bacteria | 2214 |
| 227 | nmdc:mga05p37_279631_c1 | 3300050507 | Bacteria | 1991 |
| 228 | nmdc:mga06r32_200016_c1 | 3300050510 | Unclassified | 1986 |
| 229 | nmdc:mga08y16_1047_c1 | 3300050511 | Bacteria | 27143 |
| 230 | nmdc:mga08y16_36228_c1 | 3300050511 | Bacteria | 5181 |
| 231 | nmdc:mga0n895_125779_c1 | 3300050512 | Bacteria | 2587 |
| 232 | nmdc:mga0n895_205143_c1 | 3300050512 | Unclassified | 2002 |
| 233 | nmdc:mga0rr50_37232_c1 | 3300050513 | Bacteria | 3510 |
| 234 | nmdc:mga0a205_125270_c1 | 3300050515 | Bacteria | 2469 |
| 235 | nmdc:mga0a205_250677_c1 | 3300050515 | Bacteria | 1650 |
| 236 | nmdc:mga0a205_260659_c1 | 3300050515 | Unclassified | 1611 |
| 237 | nmdc:mga0a205_264044_c1 | 3300050515 | Bacteria | 1599 |
| 238 | nmdc:mga0a205_505620_c1 | 3300050515 | Unclassified | 1065 |
| 239 | nmdc:mga0a205_7034_c1 | 3300050515 | Bacteria | 5242 |
| 240 | nmdc:mga0a205_74011_c1 | 3300050515 | Unclassified | 3291 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026089 | Ga0207648_10119361 | Ga0207648_101193612 | 248 |
| 2 | 3300005617 | Ga0068859_100717441 | Ga0068859_1007174411 | 261 |
| 3 | 3300006931 | Ga0097620_100717517 | Ga0097620_1007175171 | 261 |
| 4 | 3300046615 | Ga0495656_0143117 | Ga0495656_0143117_132_1094 | 264 |
| 5 | 3300009147 | Ga0114129_10223124 | Ga0114129_102231243 | 269 |
| 6 | 3300050507 | nmdc:mga05p37_233675_c1 | nmdc:mga05p37_233675_c1_246_1286 | 269 |
| 7 | 3300009148 | Ga0105243_10003410 | Ga0105243_100034108 | 270 |
| 8 | 3300025935 | Ga0207709_10001927 | Ga0207709_100019276 | 270 |
| 9 | 3300005617 | Ga0068859_100003194 | Ga0068859_1000031947 | 272 |
| 10 | 3300005843 | Ga0068860_100120638 | Ga0068860_1001206383 | 272 |
| 11 | 3300006931 | Ga0097620_100003194 | Ga0097620_1000031947 | 272 |
| 12 | 3300014968 | Ga0157379_10241401 | Ga0157379_102414012 | 272 |
| 13 | 3300025942 | Ga0207689_10245983 | Ga0207689_102459831 | 272 |
| 14 | 3300028381 | Ga0268264_10103484 | Ga0268264_101034842 | 272 |
| 15 | 3300025908 | Ga0207643_10134376 | Ga0207643_101343762 | 274 |
| 16 | 3300049663 | Ga0501223_017816 | Ga0501223_017816_108_1082 | 275 |
| 17 | 3300050515 | nmdc:mga0a205_74011_c1 | nmdc:mga0a205_74011_c1_1566_2576 | 275 |
| 18 | 3300005331 | Ga0070670_100135415 | Ga0070670_1001354152 | 276 |
| 19 | 3300026095 | Ga0207676_10088455 | Ga0207676_100884552 | 276 |
| 20 | 3300005288 | Ga0065714_10064481 | Ga0065714_1006448117 | 277 |
| 21 | 3300005290 | Ga0065712_10000143 | Ga0065712_1000014317 | 277 |
| 22 | 3300005293 | Ga0065715_10093499 | Ga0065715_100934991 | 277 |
| 23 | 3300002459 | JGI24751J29686_10000122 | JGI24751J29686_1000012223 | 278 |
| 24 | 3300005290 | Ga0065712_10007720 | Ga0065712_100077203 | 278 |
| 25 | 3300005330 | Ga0070690_100066737 | Ga0070690_1000667371 | 278 |
| 26 | 3300005331 | Ga0070670_100000741 | Ga0070670_10000074111 | 278 |
| 27 | 3300005617 | Ga0068859_100107074 | Ga0068859_1001070743 | 278 |
| 28 | 3300006931 | Ga0097620_100107081 | Ga0097620_1001070813 | 278 |
| 29 | 3300014325 | Ga0163163_10003456 | Ga0163163_1000345612 | 278 |
| 30 | 3300025925 | Ga0207650_10000047 | Ga0207650_10000047138 | 278 |
| 31 | 3300026035 | Ga0207703_10171729 | Ga0207703_101717292 | 278 |
| 32 | 3300026041 | Ga0207639_10323617 | Ga0207639_103236172 | 278 |
| 33 | 3300050515 | nmdc:mga0a205_505620_c1 | nmdc:mga0a205_505620_c1_10_990 | 278 |
| 34 | 3300025935 | Ga0207709_10266192 | Ga0207709_102661921 | 279 |
| 35 | 3300025941 | Ga0207711_10291472 | Ga0207711_102914722 | 280 |
| 36 | 3300005293 | Ga0065715_10101501 | Ga0065715_101015012 | 281 |
| 37 | 3300005438 | Ga0070701_10022404 | Ga0070701_100224043 | 281 |
| 38 | 3300009101 | Ga0105247_10012033 | Ga0105247_100120333 | 281 |
| 39 | 3300009147 | Ga0114129_10151494 | Ga0114129_101514942 | 281 |
| 40 | 3300025900 | Ga0207710_10003895 | Ga0207710_100038954 | 281 |
| 41 | 3300005293 | Ga0065715_10206591 | Ga0065715_102065911 | 282 |
| 42 | 3300009147 | Ga0114129_10057709 | Ga0114129_100577092 | 282 |
| 43 | 3300009147 | Ga0114129_10116204 | Ga0114129_101162042 | 282 |
| 44 | 3300009147 | Ga0114129_10159849 | Ga0114129_101598493 | 282 |
| 45 | 3300025927 | Ga0207687_10078785 | Ga0207687_100787852 | 282 |
| 46 | 3300050507 | nmdc:mga05p37_279631_c1 | nmdc:mga05p37_279631_c1_910_1938 | 282 |
| 47 | 3300050515 | nmdc:mga0a205_250677_c1 | nmdc:mga0a205_250677_c1_559_1587 | 282 |
| 48 | 3300050515 | nmdc:mga0a205_260659_c1 | nmdc:mga0a205_260659_c1_140_1288 | 282 |
| 49 | 3300005337 | Ga0070682_100000139 | Ga0070682_10000013942 | 283 |
| 50 | 3300005617 | Ga0068859_100095251 | Ga0068859_1000952512 | 284 |
| 51 | 3300006931 | Ga0097620_100095252 | Ga0097620_1000952522 | 284 |
| 52 | 3300009101 | Ga0105247_10211778 | Ga0105247_102117781 | 284 |
| 53 | 3300009177 | Ga0105248_10059049 | Ga0105248_100590493 | 284 |
| 54 | 3300009551 | Ga0105238_10006984 | Ga0105238_100069845 | 284 |
| 55 | 3300013306 | Ga0163162_10113644 | Ga0163162_101136442 | 284 |
| 56 | 3300025918 | Ga0207662_10047150 | Ga0207662_100471505 | 284 |
| 57 | 3300025924 | Ga0207694_10004472 | Ga0207694_100044725 | 284 |
| 58 | 3300005844 | Ga0068862_100206905 | Ga0068862_1002069052 | 285 |
| 59 | 3300026118 | Ga0207675_100145225 | Ga0207675_1001452253 | 285 |
| 60 | 3300005444 | Ga0070694_100153474 | Ga0070694_1001534742 | 286 |
| 61 | 3300007076 | Ga0075435_100011834 | Ga0075435_1000118343 | 286 |
| 62 | 3300009177 | Ga0105248_10355318 | Ga0105248_103553181 | 286 |
| 63 | 3300014968 | Ga0157379_10127255 | Ga0157379_101272552 | 286 |
| 64 | 3300046525 | Ga0495663_0000155 | Ga0495663_0000155_4631_5722 | 286 |
| 65 | 3300046537 | Ga0495598_0000395 | Ga0495598_0000395_90_1181 | 286 |
| 66 | 3300046539 | Ga0495621_0000020 | Ga0495621_0000020_27629_28720 | 286 |
| 67 | 3300049521 | Ga0501298_000611 | Ga0501298_000611_3674_4729 | 286 |
| 68 | 3300049669 | Ga0501235_001297 | Ga0501235_001297_1406_2461 | 286 |
| 69 | 3300049765 | Ga0501268_011981 | Ga0501268_011981_31_1086 | 286 |
| 70 | 3300050513 | nmdc:mga0rr50_37232_c1 | nmdc:mga0rr50_37232_c1_441_1484 | 286 |
| 71 | 3300005518 | Ga0070699_100004437 | Ga0070699_1000044378 | 287 |
| 72 | 3300005564 | Ga0070664_100088008 | Ga0070664_1000880082 | 287 |
| 73 | 3300005577 | Ga0068857_100106414 | Ga0068857_1001064142 | 287 |
| 74 | 3300005617 | Ga0068859_100332543 | Ga0068859_1003325432 | 287 |
| 75 | 3300006852 | Ga0075433_10012947 | Ga0075433_100129476 | 287 |
| 76 | 3300006931 | Ga0097620_100332530 | Ga0097620_1003325302 | 287 |
| 77 | 3300025908 | Ga0207643_10141026 | Ga0207643_101410262 | 287 |
| 78 | 3300026095 | Ga0207676_10210886 | Ga0207676_102108862 | 287 |
| 79 | 3300026116 | Ga0207674_10128372 | Ga0207674_101283722 | 287 |
| 80 | 3300047320 | Ga0495672_0041632 | Ga0495672_0041632_84_1187 | 287 |
| 81 | 3300048915 | Ga0496112_0474277 | Ga0496112_0474277_41_1105 | 287 |
| 82 | 3300050512 | nmdc:mga0n895_125779_c1 | nmdc:mga0n895_125779_c1_723_1775 | 287 |
| 83 | 3300050515 | nmdc:mga0a205_125270_c1 | nmdc:mga0a205_125270_c1_818_1870 | 287 |
| 84 | 3300003320 | rootH2_10104955 | rootH2_101049551 | 288 |
| 85 | 3300005618 | Ga0068864_100417660 | Ga0068864_1004176601 | 288 |
| 86 | 3300009094 | Ga0111539_10011139 | Ga0111539_100111393 | 288 |
| 87 | 3300009553 | Ga0105249_10194218 | Ga0105249_101942182 | 288 |
| 88 | 3300025918 | Ga0207662_10083036 | Ga0207662_100830362 | 288 |
| 89 | 3300027907 | Ga0207428_10241755 | Ga0207428_102417551 | 288 |
| 90 | 3300038996 | Ga0242420_000576 | Ga0242420_000576_1208_2233 | 288 |
| 91 | 3300048912 | Ga0496109_0380755 | Ga0496109_0380755_248_1306 | 288 |
| 92 | 3300050511 | nmdc:mga08y16_36228_c1 | nmdc:mga08y16_36228_c1_2833_3909 | 288 |
| 93 | 3300005337 | Ga0070682_100001505 | Ga0070682_1000015054 | 289 |
| 94 | 3300005546 | Ga0070696_100111921 | Ga0070696_1001119212 | 289 |
| 95 | 3300005842 | Ga0068858_100021674 | Ga0068858_1000216745 | 289 |
| 96 | 3300009545 | Ga0105237_10000837 | Ga0105237_100008376 | 289 |
| 97 | 3300010375 | Ga0105239_10313666 | Ga0105239_103136662 | 289 |
| 98 | 3300025885 | Ga0207653_10006368 | Ga0207653_100063683 | 289 |
| 99 | 3300026035 | Ga0207703_10067072 | Ga0207703_100670722 | 289 |
| 100 | 3300005295 | Ga0065707_10001264 | Ga0065707_100012643 | 290 |
| 101 | 3300005340 | Ga0070689_100000386 | Ga0070689_1000003865 | 290 |
| 102 | 3300005444 | Ga0070694_100013117 | Ga0070694_1000131175 | 290 |
| 103 | 3300005617 | Ga0068859_100328940 | Ga0068859_1003289401 | 290 |
| 104 | 3300005834 | Ga0068851_10000462 | Ga0068851_1000046212 | 290 |
| 105 | 3300005841 | Ga0068863_100499752 | Ga0068863_1004997521 | 290 |
| 106 | 3300006852 | Ga0075433_10101212 | Ga0075433_101012122 | 290 |
| 107 | 3300006881 | Ga0068865_100263880 | Ga0068865_1002638801 | 290 |
| 108 | 3300006931 | Ga0097620_100328911 | Ga0097620_1003289111 | 290 |
| 109 | 3300009094 | Ga0111539_10002264 | Ga0111539_1000226422 | 290 |
| 110 | 3300009174 | Ga0105241_10272472 | Ga0105241_102724722 | 290 |
| 111 | 3300025321 | Ga0207656_10013480 | Ga0207656_100134803 | 290 |
| 112 | 3300025914 | Ga0207671_10001913 | Ga0207671_1000191313 | 290 |
| 113 | 3300025936 | Ga0207670_10000161 | Ga0207670_1000016123 | 290 |
| 114 | 3300025945 | Ga0207679_10310025 | Ga0207679_103100251 | 290 |
| 115 | 3300027907 | Ga0207428_10003842 | Ga0207428_100038424 | 290 |
| 116 | 3300037418 | Ga0395900_0073141 | Ga0395900_0073141_169_1239 | 290 |
| 117 | 3300050511 | nmdc:mga08y16_1047_c1 | nmdc:mga08y16_1047_c1_4417_5493 | 290 |
| 118 | 3300050515 | nmdc:mga0a205_264044_c1 | nmdc:mga0a205_264044_c1_262_1338 | 290 |
| 119 | 3300005364 | Ga0070673_100154642 | Ga0070673_1001546422 | 291 |
| 120 | 3300005549 | Ga0070704_100044860 | Ga0070704_1000448601 | 291 |
| 121 | 3300005617 | Ga0068859_100128166 | Ga0068859_1001281661 | 291 |
| 122 | 3300005841 | Ga0068863_100226218 | Ga0068863_1002262182 | 291 |
| 123 | 3300006931 | Ga0097620_100128184 | Ga0097620_1001281841 | 291 |
| 124 | 3300009177 | Ga0105248_10131213 | Ga0105248_101312132 | 291 |
| 125 | 3300010375 | Ga0105239_10081682 | Ga0105239_100816821 | 291 |
| 126 | 3300032126 | Ga0307415_100128551 | Ga0307415_1001285511 | 291 |
| 127 | 3300049653 | Ga0501206_013349 | Ga0501206_013349_34_1083 | 291 |
| 128 | 3300049707 | Ga0501234_005247 | Ga0501234_005247_372_1421 | 291 |
| 129 | 3300005336 | Ga0070680_100000453 | Ga0070680_1000004533 | 292 |
| 130 | 3300005458 | Ga0070681_10140660 | Ga0070681_101406601 | 292 |
| 131 | 3300005530 | Ga0070679_100071574 | Ga0070679_1000715742 | 292 |
| 132 | 3300005539 | Ga0068853_100529394 | Ga0068853_1005293941 | 292 |
| 133 | 3300005545 | Ga0070695_100105863 | Ga0070695_1001058631 | 292 |
| 134 | 3300005614 | Ga0068856_100007763 | Ga0068856_1000077634 | 292 |
| 135 | 3300005616 | Ga0068852_100384462 | Ga0068852_1003844622 | 292 |
| 136 | 3300006852 | Ga0075433_10026241 | Ga0075433_100262413 | 292 |
| 137 | 3300006852 | Ga0075433_10253611 | Ga0075433_102536112 | 292 |
| 138 | 3300006871 | Ga0075434_100212712 | Ga0075434_1002127122 | 292 |
| 139 | 3300007076 | Ga0075435_100178176 | Ga0075435_1001781762 | 292 |
| 140 | 3300009545 | Ga0105237_10090914 | Ga0105237_100909142 | 292 |
| 141 | 3300013100 | Ga0157373_10006131 | Ga0157373_100061315 | 292 |
| 142 | 3300013307 | Ga0157372_10242286 | Ga0157372_102422862 | 292 |
| 143 | 3300025908 | Ga0207643_10014653 | Ga0207643_100146534 | 292 |
| 144 | 3300025912 | Ga0207707_10000006 | Ga0207707_10000006225 | 292 |
| 145 | 3300025917 | Ga0207660_10004038 | Ga0207660_100040385 | 292 |
| 146 | 3300025921 | Ga0207652_10014005 | Ga0207652_100140053 | 292 |
| 147 | 3300025961 | Ga0207712_10005305 | Ga0207712_100053054 | 292 |
| 148 | 3300048905 | Ga0496102_0038971 | Ga0496102_0038971_1248_2273 | 292 |
| 149 | 3300048906 | Ga0496103_0065845 | Ga0496103_0065845_1222_2247 | 292 |
| 150 | 3300048907 | Ga0496104_0118478 | Ga0496104_0118478_1106_2131 | 292 |
| 151 | 3300048909 | Ga0496106_0291556 | Ga0496106_0291556_46_1071 | 292 |
| 152 | 3300050515 | nmdc:mga0a205_7034_c1 | nmdc:mga0a205_7034_c1_2218_3228 | 292 |
| 153 | 3300005293 | Ga0065715_10114753 | Ga0065715_101147532 | 293 |
| 154 | 3300005440 | Ga0070705_100051690 | Ga0070705_1000516902 | 293 |
| 155 | 3300005444 | Ga0070694_100227112 | Ga0070694_1002271122 | 293 |
| 156 | 3300005458 | Ga0070681_10001374 | Ga0070681_100013742 | 293 |
| 157 | 3300005467 | Ga0070706_100059507 | Ga0070706_1000595071 | 293 |
| 158 | 3300005546 | Ga0070696_100053287 | Ga0070696_1000532872 | 293 |
| 159 | 3300005618 | Ga0068864_100032894 | Ga0068864_1000328944 | 293 |
| 160 | 3300005840 | Ga0068870_10006938 | Ga0068870_100069383 | 293 |
| 161 | 3300006852 | Ga0075433_10013657 | Ga0075433_100136574 | 293 |
| 162 | 3300009174 | Ga0105241_10114109 | Ga0105241_101141092 | 293 |
| 163 | 3300010375 | Ga0105239_10413257 | Ga0105239_104132572 | 293 |
| 164 | 3300025911 | Ga0207654_10066440 | Ga0207654_100664402 | 293 |
| 165 | 3300025912 | Ga0207707_10123040 | Ga0207707_101230403 | 293 |
| 166 | 3300025913 | Ga0207695_10038274 | Ga0207695_100382741 | 293 |
| 167 | 3300025941 | Ga0207711_10301166 | Ga0207711_103011662 | 293 |
| 168 | 3300026095 | Ga0207676_10015774 | Ga0207676_100157744 | 293 |
| 169 | 3300026095 | Ga0207676_10160483 | Ga0207676_101604832 | 293 |
| 170 | 3300050512 | nmdc:mga0n895_205143_c1 | nmdc:mga0n895_205143_c1_870_1934 | 293 |
| 171 | 3300005547 | Ga0070693_100169358 | Ga0070693_1001693582 | 294 |
| 172 | 3300005618 | Ga0068864_100157477 | Ga0068864_1001574772 | 294 |
| 173 | 3300011119 | Ga0105246_10149970 | Ga0105246_101499702 | 294 |
| 174 | 3300005334 | Ga0068869_100162988 | Ga0068869_1001629881 | 295 |
| 175 | 3300009147 | Ga0114129_10002960 | Ga0114129_1000296010 | 295 |
| 176 | 3300009147 | Ga0114129_10590060 | Ga0114129_105900601 | 295 |
| 177 | 3300025942 | Ga0207689_10229046 | Ga0207689_102290461 | 295 |
| 178 | 3300035091 | Ga0373951_0000667 | Ga0373951_0000667_4012_5031 | 295 |
| 179 | 3300050507 | nmdc:mga05p37_21810_c1 | nmdc:mga05p37_21810_c1_311_1327 | 295 |
| 180 | 3300005577 | Ga0068857_100400468 | Ga0068857_1004004681 | 296 |
| 181 | 3300013308 | Ga0157375_10006910 | Ga0157375_100069105 | 296 |
| 182 | 3300042005 | Ga0439448_0013059 | Ga0439448_0013059_27_1100 | 296 |
| 183 | 3300042157 | Ga0439458_0023870 | Ga0439458_0023870_251_1324 | 296 |
| 184 | 3300048910 | Ga0496107_0067235 | Ga0496107_0067235_23_1177 | 296 |
| 185 | 3300005546 | Ga0070696_100113570 | Ga0070696_1001135701 | 297 |
| 186 | 3300035114 | Ga0373939_0024111 | Ga0373939_0024111_510_1586 | 297 |
| 187 | 3300050510 | nmdc:mga06r32_200016_c1 | nmdc:mga06r32_200016_c1_727_1788 | 297 |
| 188 | 3300003203 | JGI25406J46586_10018943 | JGI25406J46586_100189433 | 298 |
| 189 | 3300005468 | Ga0070707_100078142 | Ga0070707_1000781422 | 298 |
| 190 | 3300005471 | Ga0070698_100009468 | Ga0070698_1000094682 | 298 |
| 191 | 3300005518 | Ga0070699_100031744 | Ga0070699_1000317445 | 298 |
| 192 | 3300005985 | Ga0081539_10003189 | Ga0081539_100031897 | 298 |
| 193 | 3300013307 | Ga0157372_10004986 | Ga0157372_100049866 | 298 |
| 194 | 3300025922 | Ga0207646_10175621 | Ga0207646_101756212 | 298 |
| 195 | 3300005293 | Ga0065715_10003850 | Ga0065715_100038501 | 299 |
| 196 | 3300005337 | Ga0070682_100257873 | Ga0070682_1002578731 | 299 |
| 197 | 3300005539 | Ga0068853_100050704 | Ga0068853_1000507043 | 299 |
| 198 | 3300006237 | Ga0097621_100000961 | Ga0097621_10000096116 | 299 |
| 199 | 3300006358 | Ga0068871_100011478 | Ga0068871_1000114784 | 299 |
| 200 | 3300009174 | Ga0105241_10224858 | Ga0105241_102248582 | 299 |
| 201 | 3300009551 | Ga0105238_10012886 | Ga0105238_100128867 | 299 |
| 202 | 3300025904 | Ga0207647_10018199 | Ga0207647_100181995 | 299 |
| 203 | 3300026035 | Ga0207703_10031721 | Ga0207703_100317215 | 299 |
| 204 | 3300026075 | Ga0207708_10013270 | Ga0207708_100132702 | 299 |
| 205 | 3300005445 | Ga0070708_100000834 | Ga0070708_10000083420 | 300 |
| 206 | 3300005467 | Ga0070706_100013881 | Ga0070706_1000138812 | 300 |
| 207 | 3300005468 | Ga0070707_100035203 | Ga0070707_1000352035 | 300 |
| 208 | 3300005471 | Ga0070698_100010088 | Ga0070698_1000100884 | 300 |
| 209 | 3300005518 | Ga0070699_100003660 | Ga0070699_1000036607 | 300 |
| 210 | 3300005536 | Ga0070697_100048980 | Ga0070697_1000489802 | 300 |
| 211 | 3300025910 | Ga0207684_10158525 | Ga0207684_101585252 | 300 |
| 212 | 3300025922 | Ga0207646_10028288 | Ga0207646_100282881 | 300 |
| 213 | 3300005331 | Ga0070670_100464489 | Ga0070670_1004644891 | 301 |
| 214 | 3300005844 | Ga0068862_100025907 | Ga0068862_1000259075 | 301 |
| 215 | 3300009093 | Ga0105240_10113730 | Ga0105240_101137303 | 301 |
| 216 | 3300011119 | Ga0105246_10031584 | Ga0105246_100315843 | 301 |
| 217 | 3300013100 | Ga0157373_10010307 | Ga0157373_100103074 | 301 |
| 218 | 3300028380 | Ga0268265_10031513 | Ga0268265_100315133 | 301 |
| 219 | 3300005615 | Ga0070702_100032417 | Ga0070702_1000324172 | 302 |
| 220 | 3300005547 | Ga0070693_100140740 | Ga0070693_1001407401 | 303 |
| 221 | 3300005441 | Ga0070700_100000161 | Ga0070700_10000016112 | 304 |
| 222 | 3300005444 | Ga0070694_100037608 | Ga0070694_1000376082 | 304 |
| 223 | 3300005546 | Ga0070696_100016485 | Ga0070696_1000164853 | 304 |
| 224 | 3300005617 | Ga0068859_100021252 | Ga0068859_1000212523 | 304 |
| 225 | 3300006931 | Ga0097620_100021250 | Ga0097620_1000212503 | 304 |
| 226 | 3300009177 | Ga0105248_10056979 | Ga0105248_100569792 | 304 |
| 227 | 3300025941 | Ga0207711_10044407 | Ga0207711_100444071 | 304 |
| 228 | 3300026075 | Ga0207708_10000341 | Ga0207708_1000034128 | 304 |
| 229 | 3300005467 | Ga0070706_100000193 | Ga0070706_10000019331 | 305 |
| 230 | 3300025910 | Ga0207684_10000251 | Ga0207684_1000025141 | 305 |
| 231 | 3300031731 | Ga0307405_10054153 | Ga0307405_100541532 | 305 |
| 232 | 3300031824 | Ga0307413_10126027 | Ga0307413_101260272 | 305 |
| 233 | 3300031901 | Ga0307406_10004150 | Ga0307406_100041505 | 305 |
| 234 | 3300031903 | Ga0307407_10237188 | Ga0307407_102371881 | 305 |
| 235 | 3300032002 | Ga0307416_100036683 | Ga0307416_1000366833 | 305 |
| 236 | 3300038443 | Ga0395901_0095944 | Ga0395901_0095944_1997_3055 | 305 |
| 237 | 3300049683 | Ga0501253_015012 | Ga0501253_015012_35_1111 | 305 |
| 238 | 3300049853 | Ga0501226_003674 | Ga0501226_003674_669_1745 | 305 |
| 239 | 3300000532 | CNAas_1000381 | CNAas_10003814 | 306 |
| 240 | 3300005842 | Ga0068858_100500313 | Ga0068858_1005003131 | 306 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar