F353222

General Info

Members Datasets Scaffolds Average Seq Length
240 143 240 307

Family's Representative Sequence

Representative Sequence 3300048910|Ga0496107_0067235|Ga0496107_0067235_23_1177
Length 352
Sequence MNADERRSDLRLPAKNLRLIFWNRLSGHACKAQTLPEEICMKLKYFLSLPVAIFLIAGMALAQEPANFSLLVDGGGFLGVYAENISRDNMGRYHMSQVRGVGVTQVIKDSPAEKAGLRKDDVILRIDGENVTSVRKLNRVVSELAPDQSVRVTVSRGGAEQEITATIGKRNNSNLVGDVLRGQPQIWKWEGDPKSFKLEGLDKFPNNGGDMTFFLGNSRRIGVSTMELTKQLADYFGIAGGKGVLVTSVTDDGPAAKAGVRAGDVITAIDGEAVDSPGDIARVINRKKDGDVTLTIIRNKSQQTIHVTPREGGFSGTWGQPQMGRRIVIPRIELPDIDTPRARILRGEQGPI

Samples

Sample ID Description Type Environment
1 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
106 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
107 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
108 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
111 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
112 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
116 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
117 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
118 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
119 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
120 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
121 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
122 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
123 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
124 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
125 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
126 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
127 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
128 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
129 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
130 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
131 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
132 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
133 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
134 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
135 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
136 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
137 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
138 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
139 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
140 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
141 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
142 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
143 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.92
Rhizosphere 96.67
Stem 0
Stem Tuber 0
Unclassified 0.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNAas_1000381 3300000532 Bacteria 4299
2 JGI24751J29686_10000122 3300002459 Bacteria 39084
3 JGI25406J46586_10018943 3300003203 Unclassified 2816
4 rootH2_10104955 3300003320 Unclassified 2650
5 Ga0065714_10064481 3300005288 Bacteria 54282
6 Ga0065712_10000143 3300005290 Bacteria 54339
7 Ga0065712_10007720 3300005290 Bacteria 2978
8 Ga0065715_10003850 3300005293 Bacteria 6370
9 Ga0065715_10093499 3300005293 Bacteria 4660
10 Ga0065715_10101501 3300005293 Bacteria 3153
11 Ga0065715_10114753 3300005293 Bacteria 2439
12 Ga0065715_10206591 3300005293 Bacteria 1320
13 Ga0065707_10001264 3300005295 Bacteria 7952
14 Ga0070690_100066737 3300005330 Bacteria 2330
15 Ga0070670_100000741 3300005331 Bacteria 25354
16 Ga0070670_100135415 3300005331 Bacteria 2129
17 Ga0070670_100464489 3300005331 Unclassified 1123
18 Ga0068869_100162988 3300005334 Unclassified 1737
19 Ga0070680_100000453 3300005336 Bacteria 27916
20 Ga0070682_100000139 3300005337 Bacteria 58968
21 Ga0070682_100001505 3300005337 Bacteria 13062
22 Ga0070682_100257873 3300005337 Unclassified 1260
23 Ga0070689_100000386 3300005340 Bacteria 25853
24 Ga0070673_100154642 3300005364 Bacteria 1945
25 Ga0070701_10022404 3300005438 Bacteria 3028
26 Ga0070705_100051690 3300005440 Unclassified 2398
27 Ga0070700_100000161 3300005441 Bacteria 38637
28 Ga0070694_100013117 3300005444 Bacteria 5170
29 Ga0070694_100037608 3300005444 Bacteria 3210
30 Ga0070694_100153474 3300005444 Bacteria 1684
31 Ga0070694_100227112 3300005444 Unclassified 1403
32 Ga0070708_100000834 3300005445 Bacteria 23235
33 Ga0070681_10001374 3300005458 Bacteria 21319
34 Ga0070681_10140660 3300005458 Bacteria 2343
35 Ga0070706_100000193 3300005467 Bacteria 76590
36 Ga0070706_100013881 3300005467 Bacteria 7446
37 Ga0070706_100059507 3300005467 Bacteria 3526
38 Ga0070707_100035203 3300005468 Bacteria 4776
39 Ga0070707_100078142 3300005468 Bacteria 3193
40 Ga0070698_100009468 3300005471 Bacteria 10435
41 Ga0070698_100010088 3300005471 Bacteria 10090
42 Ga0070699_100003660 3300005518 Bacteria 13617
43 Ga0070699_100004437 3300005518 Bacteria 12411
44 Ga0070699_100031744 3300005518 Bacteria 4560
45 Ga0070679_100071574 3300005530 Bacteria 3458
46 Ga0070697_100048980 3300005536 Unclassified 3427
47 Ga0068853_100050704 3300005539 Bacteria 3571
48 Ga0068853_100529394 3300005539 Bacteria 1115
49 Ga0070695_100105863 3300005545 Bacteria 1901
50 Ga0070696_100016485 3300005546 Bacteria 4977
51 Ga0070696_100053287 3300005546 Bacteria 2816
52 Ga0070696_100111921 3300005546 Bacteria 1967
53 Ga0070696_100113570 3300005546 Bacteria 1953
54 Ga0070693_100140740 3300005547 Bacteria 1519
55 Ga0070693_100169358 3300005547 Bacteria 1397
56 Ga0070704_100044860 3300005549 Bacteria 3074
57 Ga0070664_100088008 3300005564 Bacteria 2685
58 Ga0068857_100106414 3300005577 Bacteria 2519
59 Ga0068857_100400468 3300005577 Unclassified 1277
60 Ga0068856_100007763 3300005614 Bacteria 10479
61 Ga0070702_100032417 3300005615 Bacteria 2867
62 Ga0068852_100384462 3300005616 Bacteria 1377
63 Ga0068859_100003194 3300005617 Bacteria 16682
64 Ga0068859_100021252 3300005617 Bacteria 6513
65 Ga0068859_100095251 3300005617 Bacteria 3029
66 Ga0068859_100107074 3300005617 Bacteria 2855
67 Ga0068859_100128166 3300005617 Bacteria 2608
68 Ga0068859_100328940 3300005617 Unclassified 1622
69 Ga0068859_100332543 3300005617 Bacteria 1613
70 Ga0068859_100717441 3300005617 Bacteria 1090
71 Ga0068864_100032894 3300005618 Bacteria 4407
72 Ga0068864_100157477 3300005618 Unclassified 2062
73 Ga0068864_100417660 3300005618 Bacteria 1278
74 Ga0068851_10000462 3300005834 Bacteria 17895
75 Ga0068870_10006938 3300005840 Bacteria 5023
76 Ga0068863_100226218 3300005841 Bacteria 1803
77 Ga0068863_100499752 3300005841 Unclassified 1197
78 Ga0068858_100021674 3300005842 Bacteria 6005
79 Ga0068858_100500313 3300005842 Unclassified 1174
80 Ga0068860_100120638 3300005843 Bacteria 2510
81 Ga0068862_100025907 3300005844 Bacteria 4926
82 Ga0068862_100206905 3300005844 Unclassified 1771
83 Ga0081539_10003189 3300005985 Bacteria 20742
84 Ga0097621_100000961 3300006237 Bacteria 20199
85 Ga0068871_100011478 3300006358 Bacteria 6500
86 Ga0075433_10012947 3300006852 Bacteria 6762
87 Ga0075433_10013657 3300006852 Bacteria 6612
88 Ga0075433_10026241 3300006852 Bacteria 4930
89 Ga0075433_10101212 3300006852 Bacteria 2551
90 Ga0075433_10253611 3300006852 Bacteria 1561
91 Ga0075434_100212712 3300006871 Bacteria 1953
92 Ga0068865_100263880 3300006881 Unclassified 1364
93 Ga0097620_100003194 3300006931 Bacteria 16682
94 Ga0097620_100021250 3300006931 Bacteria 6513
95 Ga0097620_100095252 3300006931 Bacteria 3029
96 Ga0097620_100107081 3300006931 Bacteria 2855
97 Ga0097620_100128184 3300006931 Bacteria 2608
98 Ga0097620_100328911 3300006931 Unclassified 1622
99 Ga0097620_100332530 3300006931 Bacteria 1613
100 Ga0097620_100717517 3300006931 Bacteria 1090
101 Ga0075435_100011834 3300007076 Bacteria 6440
102 Ga0075435_100178176 3300007076 Bacteria 1796
103 Ga0105240_10113730 3300009093 Bacteria 3271
104 Ga0111539_10002264 3300009094 Bacteria 25641
105 Ga0111539_10011139 3300009094 Bacteria 11313
106 Ga0105247_10012033 3300009101 Bacteria 5197
107 Ga0105247_10211778 3300009101 Unclassified 1307
108 Ga0114129_10002960 3300009147 Bacteria 23767
109 Ga0114129_10057709 3300009147 Bacteria 5431
110 Ga0114129_10116204 3300009147 Bacteria 3687
111 Ga0114129_10151494 3300009147 Bacteria 3174
112 Ga0114129_10159849 3300009147 Bacteria 3079
113 Ga0114129_10223124 3300009147 Bacteria 2541
114 Ga0114129_10590060 3300009147 Bacteria 1441
115 Ga0105243_10003410 3300009148 Bacteria 12890
116 Ga0105241_10114109 3300009174 Bacteria 2167
117 Ga0105241_10224858 3300009174 Bacteria 1579
118 Ga0105241_10272472 3300009174 Unclassified 1443
119 Ga0105248_10056979 3300009177 Bacteria 4385
120 Ga0105248_10059049 3300009177 Bacteria 4308
121 Ga0105248_10131213 3300009177 Bacteria 2827
122 Ga0105248_10355318 3300009177 Bacteria 1650
123 Ga0105237_10000837 3300009545 Bacteria 42069
124 Ga0105237_10090914 3300009545 Bacteria 3042
125 Ga0105238_10006984 3300009551 Bacteria 11284
126 Ga0105238_10012886 3300009551 Bacteria 8438
127 Ga0105249_10194218 3300009553 Bacteria 1983
128 Ga0105239_10081682 3300010375 Bacteria 3558
129 Ga0105239_10313666 3300010375 Bacteria 1768
130 Ga0105239_10413257 3300010375 Bacteria 1528
131 Ga0105246_10031584 3300011119 Bacteria 3506
132 Ga0105246_10149970 3300011119 Bacteria 1764
133 Ga0157373_10006131 3300013100 Bacteria 8989
134 Ga0157373_10010307 3300013100 Bacteria 6886
135 Ga0163162_10113644 3300013306 Bacteria 2806
136 Ga0157372_10004986 3300013307 Bacteria 14106
137 Ga0157372_10242286 3300013307 Bacteria 2092
138 Ga0157375_10006910 3300013308 Bacteria 9902
139 Ga0163163_10003456 3300014325 Bacteria 13423
140 Ga0157379_10127255 3300014968 Bacteria 2292
141 Ga0157379_10241401 3300014968 Unclassified 1639
142 Ga0207656_10013480 3300025321 Unclassified 3127
143 Ga0207653_10006368 3300025885 Bacteria 3683
144 Ga0207710_10003895 3300025900 Bacteria 6590
145 Ga0207647_10018199 3300025904 Bacteria 4760
146 Ga0207643_10014653 3300025908 Bacteria 4262
147 Ga0207643_10134376 3300025908 Bacteria 1474
148 Ga0207643_10141026 3300025908 Bacteria 1440
149 Ga0207684_10000251 3300025910 Bacteria 80339
150 Ga0207684_10158525 3300025910 Bacteria 1948
151 Ga0207654_10066440 3300025911 Bacteria 2127
152 Ga0207707_10000006 3300025912 Bacteria 374131
153 Ga0207707_10123040 3300025912 Bacteria 2268
154 Ga0207695_10038274 3300025913 Bacteria 5166
155 Ga0207671_10001913 3300025914 Bacteria 23118
156 Ga0207660_10004038 3300025917 Bacteria 9578
157 Ga0207662_10047150 3300025918 Bacteria 2552
158 Ga0207662_10083036 3300025918 Bacteria 1958
159 Ga0207652_10014005 3300025921 Bacteria 6493
160 Ga0207646_10028288 3300025922 Bacteria 5104
161 Ga0207646_10175621 3300025922 Bacteria 1935
162 Ga0207694_10004472 3300025924 Bacteria 10908
163 Ga0207650_10000047 3300025925 Bacteria 175675
164 Ga0207687_10078785 3300025927 Unclassified 2373
165 Ga0207709_10001927 3300025935 Bacteria 13630
166 Ga0207709_10266192 3300025935 Bacteria 1259
167 Ga0207670_10000161 3300025936 Bacteria 44305
168 Ga0207711_10044407 3300025941 Bacteria 3794
169 Ga0207711_10291472 3300025941 Unclassified 1504
170 Ga0207711_10301166 3300025941 Bacteria 1479
171 Ga0207689_10229046 3300025942 Unclassified 1536
172 Ga0207689_10245983 3300025942 Unclassified 1479
173 Ga0207679_10310025 3300025945 Unclassified 1363
174 Ga0207712_10005305 3300025961 Bacteria 8142
175 Ga0207703_10031721 3300026035 Unclassified 4179
176 Ga0207703_10067072 3300026035 Unclassified 2953
177 Ga0207703_10171729 3300026035 Bacteria 1907
178 Ga0207639_10323617 3300026041 Bacteria 1370
179 Ga0207708_10000341 3300026075 Bacteria 36836
180 Ga0207708_10013270 3300026075 Bacteria 6152
181 Ga0207648_10119361 3300026089 Bacteria 2318
182 Ga0207676_10015774 3300026095 Bacteria 5461
183 Ga0207676_10088455 3300026095 Bacteria 2536
184 Ga0207676_10160483 3300026095 Bacteria 1947
185 Ga0207676_10210886 3300026095 Bacteria 1723
186 Ga0207674_10128372 3300026116 Bacteria 2500
187 Ga0207675_100145225 3300026118 Bacteria 2255
188 Ga0207428_10003842 3300027907 Bacteria 14410
189 Ga0207428_10241755 3300027907 Bacteria 1348
190 Ga0268265_10031513 3300028380 Bacteria 3829
191 Ga0268264_10103484 3300028381 Bacteria 2479
192 Ga0307405_10054153 3300031731 Unclassified 2503
193 Ga0307413_10126027 3300031824 Unclassified 1744
194 Ga0307406_10004150 3300031901 Bacteria 7887
195 Ga0307407_10237188 3300031903 Bacteria 1242
196 Ga0307416_100036683 3300032002 Unclassified 3763
197 Ga0307415_100128551 3300032126 Unclassified 1913
198 Ga0373951_0000667 3300035091 Bacteria 9448
199 Ga0373939_0024111 3300035114 Unclassified 1692
200 Ga0395900_0073141 3300037418 Bacteria 3524
201 Ga0395901_0095944 3300038443 Bacteria 3108
202 Ga0242420_000576 3300038996 Bacteria 4254
203 Ga0439448_0013059 3300042005 Bacteria 2493
204 Ga0439458_0023870 3300042157 Bacteria 1427
205 Ga0495663_0000155 3300046525 Bacteria 27877
206 Ga0495598_0000395 3300046537 Bacteria 7840
207 Ga0495621_0000020 3300046539 Bacteria 29844
208 Ga0495656_0143117 3300046615 Unclassified 1148
209 Ga0495672_0041632 3300047320 Unclassified 2776
210 Ga0496102_0038971 3300048905 Bacteria 4292
211 Ga0496103_0065845 3300048906 Bacteria 2261
212 Ga0496104_0118478 3300048907 Bacteria 2542
213 Ga0496106_0291556 3300048909 Bacteria 1308
214 Ga0496107_0067235 3300048910 Bacteria 2600
215 Ga0496109_0380755 3300048912 Unclassified 1333
216 Ga0496112_0474277 3300048915 Unclassified 1188
217 Ga0501298_000611 3300049521 Bacteria 4885
218 Ga0501206_013349 3300049653 Unclassified 1122
219 Ga0501223_017816 3300049663 Bacteria 1400
220 Ga0501235_001297 3300049669 Bacteria 5291
221 Ga0501253_015012 3300049683 Bacteria 1265
222 Ga0501234_005247 3300049707 Unclassified 2027
223 Ga0501268_011981 3300049765 Bacteria 1379
224 Ga0501226_003674 3300049853 Unclassified 1806
225 nmdc:mga05p37_21810_c1 3300050507 Bacteria 7759
226 nmdc:mga05p37_233675_c1 3300050507 Bacteria 2214
227 nmdc:mga05p37_279631_c1 3300050507 Bacteria 1991
228 nmdc:mga06r32_200016_c1 3300050510 Unclassified 1986
229 nmdc:mga08y16_1047_c1 3300050511 Bacteria 27143
230 nmdc:mga08y16_36228_c1 3300050511 Bacteria 5181
231 nmdc:mga0n895_125779_c1 3300050512 Bacteria 2587
232 nmdc:mga0n895_205143_c1 3300050512 Unclassified 2002
233 nmdc:mga0rr50_37232_c1 3300050513 Bacteria 3510
234 nmdc:mga0a205_125270_c1 3300050515 Bacteria 2469
235 nmdc:mga0a205_250677_c1 3300050515 Bacteria 1650
236 nmdc:mga0a205_260659_c1 3300050515 Unclassified 1611
237 nmdc:mga0a205_264044_c1 3300050515 Bacteria 1599
238 nmdc:mga0a205_505620_c1 3300050515 Unclassified 1065
239 nmdc:mga0a205_7034_c1 3300050515 Bacteria 5242
240 nmdc:mga0a205_74011_c1 3300050515 Unclassified 3291

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026089 Ga0207648_10119361 Ga0207648_101193612 248
2 3300005617 Ga0068859_100717441 Ga0068859_1007174411 261
3 3300006931 Ga0097620_100717517 Ga0097620_1007175171 261
4 3300046615 Ga0495656_0143117 Ga0495656_0143117_132_1094 264
5 3300009147 Ga0114129_10223124 Ga0114129_102231243 269
6 3300050507 nmdc:mga05p37_233675_c1 nmdc:mga05p37_233675_c1_246_1286 269
7 3300009148 Ga0105243_10003410 Ga0105243_100034108 270
8 3300025935 Ga0207709_10001927 Ga0207709_100019276 270
9 3300005617 Ga0068859_100003194 Ga0068859_1000031947 272
10 3300005843 Ga0068860_100120638 Ga0068860_1001206383 272
11 3300006931 Ga0097620_100003194 Ga0097620_1000031947 272
12 3300014968 Ga0157379_10241401 Ga0157379_102414012 272
13 3300025942 Ga0207689_10245983 Ga0207689_102459831 272
14 3300028381 Ga0268264_10103484 Ga0268264_101034842 272
15 3300025908 Ga0207643_10134376 Ga0207643_101343762 274
16 3300049663 Ga0501223_017816 Ga0501223_017816_108_1082 275
17 3300050515 nmdc:mga0a205_74011_c1 nmdc:mga0a205_74011_c1_1566_2576 275
18 3300005331 Ga0070670_100135415 Ga0070670_1001354152 276
19 3300026095 Ga0207676_10088455 Ga0207676_100884552 276
20 3300005288 Ga0065714_10064481 Ga0065714_1006448117 277
21 3300005290 Ga0065712_10000143 Ga0065712_1000014317 277
22 3300005293 Ga0065715_10093499 Ga0065715_100934991 277
23 3300002459 JGI24751J29686_10000122 JGI24751J29686_1000012223 278
24 3300005290 Ga0065712_10007720 Ga0065712_100077203 278
25 3300005330 Ga0070690_100066737 Ga0070690_1000667371 278
26 3300005331 Ga0070670_100000741 Ga0070670_10000074111 278
27 3300005617 Ga0068859_100107074 Ga0068859_1001070743 278
28 3300006931 Ga0097620_100107081 Ga0097620_1001070813 278
29 3300014325 Ga0163163_10003456 Ga0163163_1000345612 278
30 3300025925 Ga0207650_10000047 Ga0207650_10000047138 278
31 3300026035 Ga0207703_10171729 Ga0207703_101717292 278
32 3300026041 Ga0207639_10323617 Ga0207639_103236172 278
33 3300050515 nmdc:mga0a205_505620_c1 nmdc:mga0a205_505620_c1_10_990 278
34 3300025935 Ga0207709_10266192 Ga0207709_102661921 279
35 3300025941 Ga0207711_10291472 Ga0207711_102914722 280
36 3300005293 Ga0065715_10101501 Ga0065715_101015012 281
37 3300005438 Ga0070701_10022404 Ga0070701_100224043 281
38 3300009101 Ga0105247_10012033 Ga0105247_100120333 281
39 3300009147 Ga0114129_10151494 Ga0114129_101514942 281
40 3300025900 Ga0207710_10003895 Ga0207710_100038954 281
41 3300005293 Ga0065715_10206591 Ga0065715_102065911 282
42 3300009147 Ga0114129_10057709 Ga0114129_100577092 282
43 3300009147 Ga0114129_10116204 Ga0114129_101162042 282
44 3300009147 Ga0114129_10159849 Ga0114129_101598493 282
45 3300025927 Ga0207687_10078785 Ga0207687_100787852 282
46 3300050507 nmdc:mga05p37_279631_c1 nmdc:mga05p37_279631_c1_910_1938 282
47 3300050515 nmdc:mga0a205_250677_c1 nmdc:mga0a205_250677_c1_559_1587 282
48 3300050515 nmdc:mga0a205_260659_c1 nmdc:mga0a205_260659_c1_140_1288 282
49 3300005337 Ga0070682_100000139 Ga0070682_10000013942 283
50 3300005617 Ga0068859_100095251 Ga0068859_1000952512 284
51 3300006931 Ga0097620_100095252 Ga0097620_1000952522 284
52 3300009101 Ga0105247_10211778 Ga0105247_102117781 284
53 3300009177 Ga0105248_10059049 Ga0105248_100590493 284
54 3300009551 Ga0105238_10006984 Ga0105238_100069845 284
55 3300013306 Ga0163162_10113644 Ga0163162_101136442 284
56 3300025918 Ga0207662_10047150 Ga0207662_100471505 284
57 3300025924 Ga0207694_10004472 Ga0207694_100044725 284
58 3300005844 Ga0068862_100206905 Ga0068862_1002069052 285
59 3300026118 Ga0207675_100145225 Ga0207675_1001452253 285
60 3300005444 Ga0070694_100153474 Ga0070694_1001534742 286
61 3300007076 Ga0075435_100011834 Ga0075435_1000118343 286
62 3300009177 Ga0105248_10355318 Ga0105248_103553181 286
63 3300014968 Ga0157379_10127255 Ga0157379_101272552 286
64 3300046525 Ga0495663_0000155 Ga0495663_0000155_4631_5722 286
65 3300046537 Ga0495598_0000395 Ga0495598_0000395_90_1181 286
66 3300046539 Ga0495621_0000020 Ga0495621_0000020_27629_28720 286
67 3300049521 Ga0501298_000611 Ga0501298_000611_3674_4729 286
68 3300049669 Ga0501235_001297 Ga0501235_001297_1406_2461 286
69 3300049765 Ga0501268_011981 Ga0501268_011981_31_1086 286
70 3300050513 nmdc:mga0rr50_37232_c1 nmdc:mga0rr50_37232_c1_441_1484 286
71 3300005518 Ga0070699_100004437 Ga0070699_1000044378 287
72 3300005564 Ga0070664_100088008 Ga0070664_1000880082 287
73 3300005577 Ga0068857_100106414 Ga0068857_1001064142 287
74 3300005617 Ga0068859_100332543 Ga0068859_1003325432 287
75 3300006852 Ga0075433_10012947 Ga0075433_100129476 287
76 3300006931 Ga0097620_100332530 Ga0097620_1003325302 287
77 3300025908 Ga0207643_10141026 Ga0207643_101410262 287
78 3300026095 Ga0207676_10210886 Ga0207676_102108862 287
79 3300026116 Ga0207674_10128372 Ga0207674_101283722 287
80 3300047320 Ga0495672_0041632 Ga0495672_0041632_84_1187 287
81 3300048915 Ga0496112_0474277 Ga0496112_0474277_41_1105 287
82 3300050512 nmdc:mga0n895_125779_c1 nmdc:mga0n895_125779_c1_723_1775 287
83 3300050515 nmdc:mga0a205_125270_c1 nmdc:mga0a205_125270_c1_818_1870 287
84 3300003320 rootH2_10104955 rootH2_101049551 288
85 3300005618 Ga0068864_100417660 Ga0068864_1004176601 288
86 3300009094 Ga0111539_10011139 Ga0111539_100111393 288
87 3300009553 Ga0105249_10194218 Ga0105249_101942182 288
88 3300025918 Ga0207662_10083036 Ga0207662_100830362 288
89 3300027907 Ga0207428_10241755 Ga0207428_102417551 288
90 3300038996 Ga0242420_000576 Ga0242420_000576_1208_2233 288
91 3300048912 Ga0496109_0380755 Ga0496109_0380755_248_1306 288
92 3300050511 nmdc:mga08y16_36228_c1 nmdc:mga08y16_36228_c1_2833_3909 288
93 3300005337 Ga0070682_100001505 Ga0070682_1000015054 289
94 3300005546 Ga0070696_100111921 Ga0070696_1001119212 289
95 3300005842 Ga0068858_100021674 Ga0068858_1000216745 289
96 3300009545 Ga0105237_10000837 Ga0105237_100008376 289
97 3300010375 Ga0105239_10313666 Ga0105239_103136662 289
98 3300025885 Ga0207653_10006368 Ga0207653_100063683 289
99 3300026035 Ga0207703_10067072 Ga0207703_100670722 289
100 3300005295 Ga0065707_10001264 Ga0065707_100012643 290
101 3300005340 Ga0070689_100000386 Ga0070689_1000003865 290
102 3300005444 Ga0070694_100013117 Ga0070694_1000131175 290
103 3300005617 Ga0068859_100328940 Ga0068859_1003289401 290
104 3300005834 Ga0068851_10000462 Ga0068851_1000046212 290
105 3300005841 Ga0068863_100499752 Ga0068863_1004997521 290
106 3300006852 Ga0075433_10101212 Ga0075433_101012122 290
107 3300006881 Ga0068865_100263880 Ga0068865_1002638801 290
108 3300006931 Ga0097620_100328911 Ga0097620_1003289111 290
109 3300009094 Ga0111539_10002264 Ga0111539_1000226422 290
110 3300009174 Ga0105241_10272472 Ga0105241_102724722 290
111 3300025321 Ga0207656_10013480 Ga0207656_100134803 290
112 3300025914 Ga0207671_10001913 Ga0207671_1000191313 290
113 3300025936 Ga0207670_10000161 Ga0207670_1000016123 290
114 3300025945 Ga0207679_10310025 Ga0207679_103100251 290
115 3300027907 Ga0207428_10003842 Ga0207428_100038424 290
116 3300037418 Ga0395900_0073141 Ga0395900_0073141_169_1239 290
117 3300050511 nmdc:mga08y16_1047_c1 nmdc:mga08y16_1047_c1_4417_5493 290
118 3300050515 nmdc:mga0a205_264044_c1 nmdc:mga0a205_264044_c1_262_1338 290
119 3300005364 Ga0070673_100154642 Ga0070673_1001546422 291
120 3300005549 Ga0070704_100044860 Ga0070704_1000448601 291
121 3300005617 Ga0068859_100128166 Ga0068859_1001281661 291
122 3300005841 Ga0068863_100226218 Ga0068863_1002262182 291
123 3300006931 Ga0097620_100128184 Ga0097620_1001281841 291
124 3300009177 Ga0105248_10131213 Ga0105248_101312132 291
125 3300010375 Ga0105239_10081682 Ga0105239_100816821 291
126 3300032126 Ga0307415_100128551 Ga0307415_1001285511 291
127 3300049653 Ga0501206_013349 Ga0501206_013349_34_1083 291
128 3300049707 Ga0501234_005247 Ga0501234_005247_372_1421 291
129 3300005336 Ga0070680_100000453 Ga0070680_1000004533 292
130 3300005458 Ga0070681_10140660 Ga0070681_101406601 292
131 3300005530 Ga0070679_100071574 Ga0070679_1000715742 292
132 3300005539 Ga0068853_100529394 Ga0068853_1005293941 292
133 3300005545 Ga0070695_100105863 Ga0070695_1001058631 292
134 3300005614 Ga0068856_100007763 Ga0068856_1000077634 292
135 3300005616 Ga0068852_100384462 Ga0068852_1003844622 292
136 3300006852 Ga0075433_10026241 Ga0075433_100262413 292
137 3300006852 Ga0075433_10253611 Ga0075433_102536112 292
138 3300006871 Ga0075434_100212712 Ga0075434_1002127122 292
139 3300007076 Ga0075435_100178176 Ga0075435_1001781762 292
140 3300009545 Ga0105237_10090914 Ga0105237_100909142 292
141 3300013100 Ga0157373_10006131 Ga0157373_100061315 292
142 3300013307 Ga0157372_10242286 Ga0157372_102422862 292
143 3300025908 Ga0207643_10014653 Ga0207643_100146534 292
144 3300025912 Ga0207707_10000006 Ga0207707_10000006225 292
145 3300025917 Ga0207660_10004038 Ga0207660_100040385 292
146 3300025921 Ga0207652_10014005 Ga0207652_100140053 292
147 3300025961 Ga0207712_10005305 Ga0207712_100053054 292
148 3300048905 Ga0496102_0038971 Ga0496102_0038971_1248_2273 292
149 3300048906 Ga0496103_0065845 Ga0496103_0065845_1222_2247 292
150 3300048907 Ga0496104_0118478 Ga0496104_0118478_1106_2131 292
151 3300048909 Ga0496106_0291556 Ga0496106_0291556_46_1071 292
152 3300050515 nmdc:mga0a205_7034_c1 nmdc:mga0a205_7034_c1_2218_3228 292
153 3300005293 Ga0065715_10114753 Ga0065715_101147532 293
154 3300005440 Ga0070705_100051690 Ga0070705_1000516902 293
155 3300005444 Ga0070694_100227112 Ga0070694_1002271122 293
156 3300005458 Ga0070681_10001374 Ga0070681_100013742 293
157 3300005467 Ga0070706_100059507 Ga0070706_1000595071 293
158 3300005546 Ga0070696_100053287 Ga0070696_1000532872 293
159 3300005618 Ga0068864_100032894 Ga0068864_1000328944 293
160 3300005840 Ga0068870_10006938 Ga0068870_100069383 293
161 3300006852 Ga0075433_10013657 Ga0075433_100136574 293
162 3300009174 Ga0105241_10114109 Ga0105241_101141092 293
163 3300010375 Ga0105239_10413257 Ga0105239_104132572 293
164 3300025911 Ga0207654_10066440 Ga0207654_100664402 293
165 3300025912 Ga0207707_10123040 Ga0207707_101230403 293
166 3300025913 Ga0207695_10038274 Ga0207695_100382741 293
167 3300025941 Ga0207711_10301166 Ga0207711_103011662 293
168 3300026095 Ga0207676_10015774 Ga0207676_100157744 293
169 3300026095 Ga0207676_10160483 Ga0207676_101604832 293
170 3300050512 nmdc:mga0n895_205143_c1 nmdc:mga0n895_205143_c1_870_1934 293
171 3300005547 Ga0070693_100169358 Ga0070693_1001693582 294
172 3300005618 Ga0068864_100157477 Ga0068864_1001574772 294
173 3300011119 Ga0105246_10149970 Ga0105246_101499702 294
174 3300005334 Ga0068869_100162988 Ga0068869_1001629881 295
175 3300009147 Ga0114129_10002960 Ga0114129_1000296010 295
176 3300009147 Ga0114129_10590060 Ga0114129_105900601 295
177 3300025942 Ga0207689_10229046 Ga0207689_102290461 295
178 3300035091 Ga0373951_0000667 Ga0373951_0000667_4012_5031 295
179 3300050507 nmdc:mga05p37_21810_c1 nmdc:mga05p37_21810_c1_311_1327 295
180 3300005577 Ga0068857_100400468 Ga0068857_1004004681 296
181 3300013308 Ga0157375_10006910 Ga0157375_100069105 296
182 3300042005 Ga0439448_0013059 Ga0439448_0013059_27_1100 296
183 3300042157 Ga0439458_0023870 Ga0439458_0023870_251_1324 296
184 3300048910 Ga0496107_0067235 Ga0496107_0067235_23_1177 296
185 3300005546 Ga0070696_100113570 Ga0070696_1001135701 297
186 3300035114 Ga0373939_0024111 Ga0373939_0024111_510_1586 297
187 3300050510 nmdc:mga06r32_200016_c1 nmdc:mga06r32_200016_c1_727_1788 297
188 3300003203 JGI25406J46586_10018943 JGI25406J46586_100189433 298
189 3300005468 Ga0070707_100078142 Ga0070707_1000781422 298
190 3300005471 Ga0070698_100009468 Ga0070698_1000094682 298
191 3300005518 Ga0070699_100031744 Ga0070699_1000317445 298
192 3300005985 Ga0081539_10003189 Ga0081539_100031897 298
193 3300013307 Ga0157372_10004986 Ga0157372_100049866 298
194 3300025922 Ga0207646_10175621 Ga0207646_101756212 298
195 3300005293 Ga0065715_10003850 Ga0065715_100038501 299
196 3300005337 Ga0070682_100257873 Ga0070682_1002578731 299
197 3300005539 Ga0068853_100050704 Ga0068853_1000507043 299
198 3300006237 Ga0097621_100000961 Ga0097621_10000096116 299
199 3300006358 Ga0068871_100011478 Ga0068871_1000114784 299
200 3300009174 Ga0105241_10224858 Ga0105241_102248582 299
201 3300009551 Ga0105238_10012886 Ga0105238_100128867 299
202 3300025904 Ga0207647_10018199 Ga0207647_100181995 299
203 3300026035 Ga0207703_10031721 Ga0207703_100317215 299
204 3300026075 Ga0207708_10013270 Ga0207708_100132702 299
205 3300005445 Ga0070708_100000834 Ga0070708_10000083420 300
206 3300005467 Ga0070706_100013881 Ga0070706_1000138812 300
207 3300005468 Ga0070707_100035203 Ga0070707_1000352035 300
208 3300005471 Ga0070698_100010088 Ga0070698_1000100884 300
209 3300005518 Ga0070699_100003660 Ga0070699_1000036607 300
210 3300005536 Ga0070697_100048980 Ga0070697_1000489802 300
211 3300025910 Ga0207684_10158525 Ga0207684_101585252 300
212 3300025922 Ga0207646_10028288 Ga0207646_100282881 300
213 3300005331 Ga0070670_100464489 Ga0070670_1004644891 301
214 3300005844 Ga0068862_100025907 Ga0068862_1000259075 301
215 3300009093 Ga0105240_10113730 Ga0105240_101137303 301
216 3300011119 Ga0105246_10031584 Ga0105246_100315843 301
217 3300013100 Ga0157373_10010307 Ga0157373_100103074 301
218 3300028380 Ga0268265_10031513 Ga0268265_100315133 301
219 3300005615 Ga0070702_100032417 Ga0070702_1000324172 302
220 3300005547 Ga0070693_100140740 Ga0070693_1001407401 303
221 3300005441 Ga0070700_100000161 Ga0070700_10000016112 304
222 3300005444 Ga0070694_100037608 Ga0070694_1000376082 304
223 3300005546 Ga0070696_100016485 Ga0070696_1000164853 304
224 3300005617 Ga0068859_100021252 Ga0068859_1000212523 304
225 3300006931 Ga0097620_100021250 Ga0097620_1000212503 304
226 3300009177 Ga0105248_10056979 Ga0105248_100569792 304
227 3300025941 Ga0207711_10044407 Ga0207711_100444071 304
228 3300026075 Ga0207708_10000341 Ga0207708_1000034128 304
229 3300005467 Ga0070706_100000193 Ga0070706_10000019331 305
230 3300025910 Ga0207684_10000251 Ga0207684_1000025141 305
231 3300031731 Ga0307405_10054153 Ga0307405_100541532 305
232 3300031824 Ga0307413_10126027 Ga0307413_101260272 305
233 3300031901 Ga0307406_10004150 Ga0307406_100041505 305
234 3300031903 Ga0307407_10237188 Ga0307407_102371881 305
235 3300032002 Ga0307416_100036683 Ga0307416_1000366833 305
236 3300038443 Ga0395901_0095944 Ga0395901_0095944_1997_3055 305
237 3300049683 Ga0501253_015012 Ga0501253_015012_35_1111 305
238 3300049853 Ga0501226_003674 Ga0501226_003674_669_1745 305
239 3300000532 CNAas_1000381 CNAas_10003814 306
240 3300005842 Ga0068858_100500313 Ga0068858_1005003131 306

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17820

PDZ_6

PDZ domain

245

298

0.97

PF13180

PDZ_2

PDZ domain

220

308

0.94

PF13180

PDZ_2

PDZ domain

76

167

0.91

PF17820

PDZ_6

PDZ domain

102

156

0.91

PF14685

Tricorn_PDZ

Tricorn protease PDZ domain

243

308

0.87

PF00595

PDZ

PDZ domain

211

297

0.75

PF00595

PDZ

PDZ domain

70

155

0.73

Feature Viewer

pLDDT pTM Quality
66.31 0.38 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map