F353196

General Info

Members Datasets Scaffolds Average Seq Length
240 164 480 185

Family's Representative Sequence

Representative Sequence 3300046665|Ga0495661_0020834|Ga0495661_0020834_1928_2575
Length 215
Sequence MIWSGAAGASVFRPRTRSFNESPTKRSRVMSQYQIAVVVGSLRKESFNRQLANAIARLAPPEFSFKQLEIGDLPLYNQDDDAQPSAQVVRLKAEIKAAQGLLFVTPEYNRSIPGVLKNALDHASRPYGQNAWAGKPAGVLGASIGAVGTAVAQQHLRTVLAYLDVPTLGQPEAFIQAKEGLFDGAGNIGPNSQAFLQGWMDKYVAWVKQHAKQTS

Samples

Sample ID Description Type Environment
1 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
23 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
24 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
25 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
27 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
28 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
71 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
72 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
73 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
74 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
75 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
76 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
77 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
78 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
79 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
80 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
81 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
82 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
83 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
84 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
85 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
86 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
87 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
88 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
89 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
90 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
91 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
92 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
93 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
97 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
98 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
99 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
100 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
101 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
102 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
103 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
104 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
105 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
106 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
107 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
108 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
109 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
110 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
111 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
112 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
113 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
114 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
115 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
116 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
117 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
118 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
119 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
120 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
121 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
122 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
123 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
124 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
125 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
126 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
141 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
142 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
143 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
144 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
145 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
146 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
147 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
148 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
149 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
150 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
151 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
154 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
155 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
156 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
157 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
158 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
159 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
160 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
161 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
162 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
163 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
164 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.75
Metatranscriptomes 0
Isolates 1.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.08
Nodule 0
Rhizoplane 6.67
Rhizosphere 86.25
Stem 0
Stem Tuber 0
Unclassified 2.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495661_0020834 3300046665 Bacteria 4275
2 rootH1_10002779 3300003323 Bacteria 12665
3 Ga0065707_10082038 3300005295 Bacteria 23916
4 Ga0070683_100000051 3300005329 Bacteria 90543
5 Ga0070670_100059761 3300005331 Bacteria 3272
6 Ga0070682_100152937 3300005337 Bacteria 1585
7 Ga0070661_100197250 3300005344 Bacteria 1537
8 Ga0070674_100077532 3300005356 Bacteria 2366
9 Ga0070673_100733386 3300005364 Bacteria 909
10 Ga0070659_101191672 3300005366 Unclassified 673
11 Ga0070667_100197804 3300005367 Bacteria 1783
12 Ga0070714_100013769 3300005435 Bacteria 6485
13 Ga0070694_100081417 3300005444 Bacteria 2252
14 Ga0070684_100002158 3300005535 Bacteria 14525
15 Ga0070672_101329064 3300005543 Bacteria 642
16 Ga0068855_100143535 3300005563 Bacteria 2719
17 Ga0070664_100016267 3300005564 Bacteria 6098
18 Ga0068856_100079525 3300005614 Bacteria 3251
19 Ga0068856_100852807 3300005614 Unclassified 930
20 Ga0068866_10107889 3300005718 Bacteria 1548
21 Ga0068861_100058072 3300005719 Bacteria 2958
22 Ga0068863_100218349 3300005841 Bacteria 1836
23 Ga0068863_101874220 3300005841 Bacteria 609
24 Ga0075432_10024187 3300006058 Bacteria 2081
25 Ga0070715_10286057 3300006163 Bacteria 876
26 Ga0075366_10001588 3300006195 Bacteria 11368
27 Ga0075366_10162357 3300006195 Bacteria 1354
28 Ga0097621_101609848 3300006237 Bacteria 617
29 Ga0097621_101609851 3300006237 Bacteria 617
30 Ga0068871_101575864 3300006358 Bacteria 621
31 Ga0075430_100006606 3300006846 Bacteria 9774
32 Ga0068865_100033303 3300006881 Bacteria 3449
33 Ga0097620_100179668 3300006931 Bacteria 2199
34 Ga0111539_11091500 3300009094 Bacteria 927
35 Ga0111539_11165420 3300009094 Bacteria 895
36 Ga0105247_10185700 3300009101 Bacteria 1390
37 Ga0105243_10142711 3300009148 Bacteria 2045
38 Ga0105241_10193943 3300009174 Bacteria 1692
39 Ga0105242_10151962 3300009176 Bacteria 2019
40 Ga0105237_10017719 3300009545 Bacteria 7383
41 Ga0105238_10026162 3300009551 Bacteria 5946
42 Ga0105239_10016756 3300010375 Bacteria 8101
43 Ga0157373_10108101 3300013100 Bacteria 1956
44 Ga0157370_10013495 3300013104 Bacteria 8413
45 Ga0157370_11111647 3300013104 Bacteria 714
46 Ga0157374_10115468 3300013296 Bacteria 2586
47 Ga0157378_10732843 3300013297 Bacteria 1010
48 Ga0163162_10160945 3300013306 Bacteria 2366
49 Ga0157375_10375029 3300013308 Bacteria 1589
50 Ga0157375_10969900 3300013308 Bacteria 991
51 Ga0163163_10007057 3300014325 Bacteria 9874
52 Ga0157380_10102331 3300014326 Bacteria 2388
53 Ga0182008_10035989 3300014497 Bacteria 2478
54 Ga0157376_10203216 3300014969 Bacteria 1824
55 Ga0157376_10745142 3300014969 Bacteria 988
56 Ga0157376_12006058 3300014969 Bacteria 616
57 Ga0163161_10368202 3300017792 Bacteria 1146
58 Ga0207654_10117372 3300025911 Bacteria 1665
59 Ga0207671_10028243 3300025914 Bacteria 4193
60 Ga0207660_10571581 3300025917 Bacteria 920
61 Ga0207649_10272416 3300025920 Bacteria 1227
62 Ga0207694_10086938 3300025924 Bacteria 2462
63 Ga0207694_10501049 3300025924 Bacteria 1017
64 Ga0207659_10740509 3300025926 Bacteria 843
65 Ga0207644_10369777 3300025931 Bacteria 1168
66 Ga0207709_10253803 3300025935 Bacteria 1286
67 Ga0207669_10094258 3300025937 Bacteria 1958
68 Ga0207669_10317501 3300025937 Bacteria 1191
69 Ga0207704_10169969 3300025938 Bacteria 1562
70 Ga0207691_10052492 3300025940 Bacteria 3723
71 Ga0207711_10330880 3300025941 Bacteria 1409
72 Ga0207689_10012703 3300025942 Bacteria 7193
73 Ga0207661_10000046 3300025944 Bacteria 107171
74 Ga0207667_10108090 3300025949 Bacteria 2870
75 Ga0207667_10185129 3300025949 Bacteria 2138
76 Ga0207668_10158489 3300025972 Bacteria 1761
77 Ga0207658_10024670 3300025986 Bacteria 4209
78 Ga0207678_10086336 3300026067 Bacteria 2682
79 Ga0207702_10025582 3300026078 Bacteria 4900
80 Ga0207702_10028563 3300026078 Bacteria 4637
81 Ga0207641_10145805 3300026088 Bacteria 2140
82 Ga0207675_100098602 3300026118 Bacteria 2752
83 Ga0265322_10031042 3300028654 Bacteria 1525
84 Ga0307517_10138772 3300028786 Bacteria 1716
85 Ga0265332_10000037 3300031238 Bacteria 134250
86 Ga0265328_10008112 3300031239 Bacteria 4347
87 Ga0265320_10007202 3300031240 Bacteria 6925
88 Ga0265325_10007171 3300031241 Bacteria 6703
89 Ga0265331_10017211 3300031250 Bacteria 3775
90 Ga0265327_10000968 3300031251 Bacteria 41105
91 Ga0265327_10011854 3300031251 Bacteria 5955
92 Ga0265327_10045783 3300031251 Bacteria 2322
93 Ga0265316_10456396 3300031344 Bacteria 916
94 Ga0307509_10000125 3300031507 Bacteria 112804
95 Ga0307509_10006676 3300031507 Bacteria 15395
96 Ga0307509_10050311 3300031507 Bacteria 4462
97 Ga0307509_10057721 3300031507 Bacteria 4114
98 Ga0307408_100416454 3300031548 Bacteria 1157
99 Ga0265313_10035062 3300031595 Bacteria 2531
100 Ga0265314_10005917 3300031711 Bacteria 10939
101 Ga0307516_10087675 3300031730 Bacteria 2946
102 Ga0307516_10354258 3300031730 Bacteria 1133
103 Ga0307405_10022064 3300031731 Bacteria 3593
104 Ga0307413_10035553 3300031824 Bacteria 2859
105 Ga0307413_10144808 3300031824 Bacteria 1647
106 Ga0307410_10001398 3300031852 Bacteria 10865
107 Ga0307406_10128781 3300031901 Bacteria 1773
108 Ga0307406_10222536 3300031901 Bacteria 1404
109 Ga0307407_10015880 3300031903 Bacteria 3736
110 Ga0307407_10257739 3300031903 Bacteria 1198
111 Ga0307409_100052096 3300031995 Bacteria 3136
112 Ga0307416_100029332 3300032002 Bacteria 4108
113 Ga0307414_10084501 3300032004 Bacteria 2335
114 Ga0307414_10859288 3300032004 Bacteria 830
115 Ga0307411_10003512 3300032005 Bacteria 7288
116 Ga0307411_10081689 3300032005 Bacteria 2226
117 Ga0307415_100029815 3300032126 Bacteria 3492
118 Ga0307415_100348439 3300032126 Bacteria 1246
119 Ga0395900_0232528 3300037418 Bacteria 1853
120 Ga0395900_0742851 3300037418 Unclassified 912
121 Ga0395901_0912958 3300038443 Bacteria 859
122 Ga0451797_0978253 3300041453 Bacteria 1182
123 Ga0451802_0149978 3300041460 Bacteria 1311
124 Ga0451807_0572241 3300041486 Bacteria 1240
125 Ga0451833_1028582 3300041491 Bacteria 814
126 Ga0439449_0034522 3300042007 Bacteria 1884
127 Ga0451577_0096025 3300042876 Bacteria 2646
128 Ga0453683_0000236 3300044673 Bacteria 73105
129 Ga0453683_0001779 3300044673 Bacteria 17852
130 Ga0466965_0006533 3300044683 Bacteria 5305
131 Ga0453684_0013569 3300044712 Bacteria 13213
132 Ga0453684_0055602 3300044712 Bacteria 5144
133 Ga0466960_0467106 3300044901 Bacteria 735
134 Ga0451576_0002682 3300045051 Bacteria 25918
135 Ga0451576_0606496 3300045051 Bacteria 1150
136 Ga0495638_0099538 3300046460 Bacteria 1740
137 Ga0495638_0308260 3300046460 Bacteria 850
138 Ga0495584_0316731 3300046491 Bacteria 792
139 Ga0495644_0022542 3300046523 Bacteria 2400
140 Ga0495668_0031491 3300046616 Bacteria 2989
141 Ga0495625_0085696 3300046660 Bacteria 2186
142 Ga0495660_0024404 3300046810 Bacteria 3445
143 Ga0495672_0000022 3300047320 Bacteria 420632
144 Ga0495681_0132680 3300047470 Bacteria 1059
145 Ga0495686_0000573 3300047472 Bacteria 52364
146 Ga0495626_0222199 3300048091 Bacteria 767
147 Ga0496104_0295435 3300048907 Bacteria 1533
148 Ga0496105_0685759 3300048908 Bacteria 788
149 Ga0496106_0329280 3300048909 Bacteria 1226
150 Ga0496108_0036118 3300048911 Bacteria 4110
151 Ga0496108_0788657 3300048911 Bacteria 820
152 Ga0496109_0267698 3300048912 Bacteria 1610
153 Ga0496109_0395201 3300048912 Bacteria 1306
154 Ga0496110_0586413 3300048913 Bacteria 1012
155 Ga0496110_1282469 3300048913 Unclassified 642
156 Ga0496112_0235927 3300048915 Bacteria 1783
157 Ga0496112_0811801 3300048915 Unclassified 860
158 Ga0496114_0042629 3300048917 Bacteria 3762
159 Ga0496114_0307033 3300048917 Bacteria 1401
160 Ga0496121_0081305 3300048924 Bacteria 2565
161 Ga0501031_0001609 3300049568 Bacteria 14118
162 Ga0501031_0016224 3300049568 Bacteria 4838
163 Ga0501031_0103752 3300049568 Bacteria 1855
164 Ga0501032_0003991 3300049569 Bacteria 11196
165 Ga0501032_0008237 3300049569 Bacteria 7601
166 Ga0501033_0004365 3300049570 Bacteria 11335
167 Ga0501033_0005359 3300049570 Bacteria 10164
168 Ga0501033_0039889 3300049570 Bacteria 3507
169 Ga0501034_0145128 3300049571 Bacteria 2351
170 Ga0501034_0171982 3300049571 Bacteria 2133
171 Ga0501034_0246515 3300049571 Bacteria 1731
172 Ga0501036_0001964 3300049572 Bacteria 15954
173 Ga0501036_0002890 3300049572 Bacteria 13623
174 Ga0501037_0024585 3300049573 Bacteria 4454
175 Ga0501037_0099352 3300049573 Bacteria 2102
176 Ga0501037_0112718 3300049573 Bacteria 1958
177 Ga0501037_0203504 3300049573 Bacteria 1398
178 Ga0501037_0293307 3300049573 Bacteria 1131
179 Ga0501038_0003382 3300049574 Bacteria 14871
180 Ga0501038_0037941 3300049574 Bacteria 4220
181 Ga0501038_0278758 3300049574 Bacteria 1317
182 Ga0501038_0285721 3300049574 Bacteria 1297
183 Ga0501038_0518750 3300049574 Bacteria 909
184 Ga0501039_0002628 3300049575 Bacteria 13412
185 Ga0501039_0005148 3300049575 Bacteria 9908
186 Ga0501039_0170327 3300049575 Bacteria 1712
187 Ga0501039_0172278 3300049575 Bacteria 1701
188 Ga0501040_0006958 3300049576 Bacteria 7326
189 Ga0501042_0011572 3300049578 Bacteria 5957
190 Ga0501043_0004582 3300049579 Bacteria 11213
191 Ga0501043_0048420 3300049579 Bacteria 3341
192 Ga0501043_0157231 3300049579 Bacteria 1777
193 Ga0501046_0018811 3300049580 Bacteria 5738
194 Ga0501046_0144242 3300049580 Bacteria 1799
195 Ga0501046_0252922 3300049580 Bacteria 1296
196 Ga0501047_0012019 3300049581 Bacteria 8193
197 Ga0501047_0048967 3300049581 Bacteria 4080
198 Ga0501047_1078585 3300049581 Bacteria 616
199 Ga0501048_0011364 3300049582 Bacteria 6640
200 Ga0501048_0149411 3300049582 Bacteria 1652
201 Ga0501048_0412225 3300049582 Bacteria 966
202 Ga0501067_0006383 3300049583 Bacteria 6531
203 Ga0501067_0116689 3300049583 Bacteria 1485
204 Ga0501068_0000787 3300049584 Bacteria 16398
205 Ga0501068_0016150 3300049584 Bacteria 4300
206 Ga0501070_0002152 3300049586 Bacteria 17311
207 Ga0501070_0101340 3300049586 Bacteria 2382
208 Ga0501071_0005532 3300049587 Bacteria 8135
209 Ga0501072_0025141 3300049588 Bacteria 4637
210 Ga0501073_0002449 3300049589 Bacteria 13864
211 Ga0501074_0040847 3300049590 Bacteria 3358
212 Ga0501075_0222312 3300049591 Bacteria 1440
213 Ga0501079_0000699 3300049741 Bacteria 22677
214 Ga0501080_0000307 3300049742 Bacteria 37435
215 Ga0501080_0124860 3300049742 Bacteria 2384
216 Ga0501083_0033114 3300049744 Bacteria 3540
217 Ga0501035_0001690 3300049822 Bacteria 22335
218 Ga0501035_0013232 3300049822 Bacteria 7615
219 Ga0501035_0054471 3300049822 Bacteria 3574
220 Ga0501035_0069163 3300049822 Bacteria 3130
221 Ga0501035_0266271 3300049822 Bacteria 1451
222 Ga0501044_0009758 3300049823 Bacteria 10443
223 Ga0501044_0014008 3300049823 Bacteria 8660
224 Ga0501044_0042697 3300049823 Bacteria 4714
225 Ga0501044_0283747 3300049823 Bacteria 1588
226 Ga0501044_0548358 3300049823 Bacteria 1053
227 Ga0501044_1250614 3300049823 Bacteria 609
228 Ga0501045_0002353 3300049824 Bacteria 12838
229 nmdc:mga0k408_272_c2 3300050493 Bacteria 26650
230 nmdc:mga0qj67_2095_c1 3300050509 Bacteria 14218
231 Ga0500651_0000439 3300053093 Bacteria 22227
232 Ga0500625_001090 3300053729 Bacteria 8797
233 Ga0501084_0006605 3300054114 Bacteria 9535
234 Ga0501084_0519076 3300054114 Bacteria 1007
235 Ga0590071_096159 3300059421 Bacteria 744
236 Ga0590075_022096 3300059424 Bacteria 1590
237 Ga0501082_0006116 3300060353 Bacteria 10449
238 2739612499 2739367655 Bacteria 4051151
239 2842722096 2842718218 Bacteria 4560148
240 2881928619 2881927736 Bacteria 3993927
241 Ga0495661_0020834
242 rootH1_10002779
243 Ga0065707_10082038
244 Ga0070683_100000051
245 Ga0070670_100059761
246 Ga0070682_100152937
247 Ga0070661_100197250
248 Ga0070674_100077532
249 Ga0070673_100733386
250 Ga0070659_101191672
251 Ga0070667_100197804
252 Ga0070714_100013769
253 Ga0070694_100081417
254 Ga0070684_100002158
255 Ga0070672_101329064
256 Ga0068855_100143535
257 Ga0070664_100016267
258 Ga0068856_100079525
259 Ga0068856_100852807
260 Ga0068866_10107889
261 Ga0068861_100058072
262 Ga0068863_100218349
263 Ga0068863_101874220
264 Ga0075432_10024187
265 Ga0070715_10286057
266 Ga0075366_10001588
267 Ga0075366_10162357
268 Ga0097621_101609848
269 Ga0097621_101609851
270 Ga0068871_101575864
271 Ga0075430_100006606
272 Ga0068865_100033303
273 Ga0097620_100179668
274 Ga0111539_11091500
275 Ga0111539_11165420
276 Ga0105247_10185700
277 Ga0105243_10142711
278 Ga0105241_10193943
279 Ga0105242_10151962
280 Ga0105237_10017719
281 Ga0105238_10026162
282 Ga0105239_10016756
283 Ga0157373_10108101
284 Ga0157370_10013495
285 Ga0157370_11111647
286 Ga0157374_10115468
287 Ga0157378_10732843
288 Ga0163162_10160945
289 Ga0157375_10375029
290 Ga0157375_10969900
291 Ga0163163_10007057
292 Ga0157380_10102331
293 Ga0182008_10035989
294 Ga0157376_10203216
295 Ga0157376_10745142
296 Ga0157376_12006058
297 Ga0163161_10368202
298 Ga0207654_10117372
299 Ga0207671_10028243
300 Ga0207660_10571581
301 Ga0207649_10272416
302 Ga0207694_10086938
303 Ga0207694_10501049
304 Ga0207659_10740509
305 Ga0207644_10369777
306 Ga0207709_10253803
307 Ga0207669_10094258
308 Ga0207669_10317501
309 Ga0207704_10169969
310 Ga0207691_10052492
311 Ga0207711_10330880
312 Ga0207689_10012703
313 Ga0207661_10000046
314 Ga0207667_10108090
315 Ga0207667_10185129
316 Ga0207668_10158489
317 Ga0207658_10024670
318 Ga0207678_10086336
319 Ga0207702_10025582
320 Ga0207702_10028563
321 Ga0207641_10145805
322 Ga0207675_100098602
323 Ga0265322_10031042
324 Ga0307517_10138772
325 Ga0265332_10000037
326 Ga0265328_10008112
327 Ga0265320_10007202
328 Ga0265325_10007171
329 Ga0265331_10017211
330 Ga0265327_10000968
331 Ga0265327_10011854
332 Ga0265327_10045783
333 Ga0265316_10456396
334 Ga0307509_10000125
335 Ga0307509_10006676
336 Ga0307509_10050311
337 Ga0307509_10057721
338 Ga0307408_100416454
339 Ga0265313_10035062
340 Ga0265314_10005917
341 Ga0307516_10087675
342 Ga0307516_10354258
343 Ga0307405_10022064
344 Ga0307413_10035553
345 Ga0307413_10144808
346 Ga0307410_10001398
347 Ga0307406_10128781
348 Ga0307406_10222536
349 Ga0307407_10015880
350 Ga0307407_10257739
351 Ga0307409_100052096
352 Ga0307416_100029332
353 Ga0307414_10084501
354 Ga0307414_10859288
355 Ga0307411_10003512
356 Ga0307411_10081689
357 Ga0307415_100029815
358 Ga0307415_100348439
359 Ga0395900_0232528
360 Ga0395900_0742851
361 Ga0395901_0912958
362 Ga0451797_0978253
363 Ga0451802_0149978
364 Ga0451807_0572241
365 Ga0451833_1028582
366 Ga0439449_0034522
367 Ga0451577_0096025
368 Ga0453683_0000236
369 Ga0453683_0001779
370 Ga0466965_0006533
371 Ga0453684_0013569
372 Ga0453684_0055602
373 Ga0466960_0467106
374 Ga0451576_0002682
375 Ga0451576_0606496
376 Ga0495638_0099538
377 Ga0495638_0308260
378 Ga0495584_0316731
379 Ga0495644_0022542
380 Ga0495668_0031491
381 Ga0495625_0085696
382 Ga0495660_0024404
383 Ga0495672_0000022
384 Ga0495681_0132680
385 Ga0495686_0000573
386 Ga0495626_0222199
387 Ga0496104_0295435
388 Ga0496105_0685759
389 Ga0496106_0329280
390 Ga0496108_0036118
391 Ga0496108_0788657
392 Ga0496109_0267698
393 Ga0496109_0395201
394 Ga0496110_0586413
395 Ga0496110_1282469
396 Ga0496112_0235927
397 Ga0496112_0811801
398 Ga0496114_0042629
399 Ga0496114_0307033
400 Ga0496121_0081305
401 Ga0501031_0001609
402 Ga0501031_0016224
403 Ga0501031_0103752
404 Ga0501032_0003991
405 Ga0501032_0008237
406 Ga0501033_0004365
407 Ga0501033_0005359
408 Ga0501033_0039889
409 Ga0501034_0145128
410 Ga0501034_0171982
411 Ga0501034_0246515
412 Ga0501036_0001964
413 Ga0501036_0002890
414 Ga0501037_0024585
415 Ga0501037_0099352
416 Ga0501037_0112718
417 Ga0501037_0203504
418 Ga0501037_0293307
419 Ga0501038_0003382
420 Ga0501038_0037941
421 Ga0501038_0278758
422 Ga0501038_0285721
423 Ga0501038_0518750
424 Ga0501039_0002628
425 Ga0501039_0005148
426 Ga0501039_0170327
427 Ga0501039_0172278
428 Ga0501040_0006958
429 Ga0501042_0011572
430 Ga0501043_0004582
431 Ga0501043_0048420
432 Ga0501043_0157231
433 Ga0501046_0018811
434 Ga0501046_0144242
435 Ga0501046_0252922
436 Ga0501047_0012019
437 Ga0501047_0048967
438 Ga0501047_1078585
439 Ga0501048_0011364
440 Ga0501048_0149411
441 Ga0501048_0412225
442 Ga0501067_0006383
443 Ga0501067_0116689
444 Ga0501068_0000787
445 Ga0501068_0016150
446 Ga0501070_0002152
447 Ga0501070_0101340
448 Ga0501071_0005532
449 Ga0501072_0025141
450 Ga0501073_0002449
451 Ga0501074_0040847
452 Ga0501075_0222312
453 Ga0501079_0000699
454 Ga0501080_0000307
455 Ga0501080_0124860
456 Ga0501083_0033114
457 Ga0501035_0001690
458 Ga0501035_0013232
459 Ga0501035_0054471
460 Ga0501035_0069163
461 Ga0501035_0266271
462 Ga0501044_0009758
463 Ga0501044_0014008
464 Ga0501044_0042697
465 Ga0501044_0283747
466 Ga0501044_0548358
467 Ga0501044_1250614
468 Ga0501045_0002353
469 nmdc:mga0k408_272_c2
470 nmdc:mga0qj67_2095_c1
471 Ga0500651_0000439
472 Ga0500625_001090
473 Ga0501084_0006605
474 Ga0501084_0519076
475 Ga0590071_096159
476 Ga0590075_022096
477 Ga0501082_0006116
478 2739612499
479 2842722096
480 2881928619

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03358

FMN_red

NADPH-dependent FMN reductase

33

180

0.95

PF02525

Flavodoxin_2

Flavodoxin-like fold

34

169

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
3u7r-assembly1.cif.gz_A ferb - flavoenzyme nad(p)h:(acceptor) oxidoreductase (ferb) from paracoccus denitrificans 0.9078 4 181
3svl-assembly1.cif.gz_B structural basis of the improvement of chrr - a multi-purpose enzyme 0.9031 3 179
3u7r-assembly1.cif.gz_A ferb - flavoenzyme nad(p)h:(acceptor) oxidoreductase (ferb) from paracoccus denitrificans 0.884 4 181
3svl-assembly1.cif.gz_B structural basis of the improvement of chrr - a multi-purpose enzyme 0.8751 3 179
3s2y-assembly1.cif.gz_A crystal structure of a chromate/uranium reductase from gluconacetobacter hansenii 0.8728 2 180
ID Description Score Start End Superfamily
3u7rB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8823 6 181 3.40.50.360
3svlA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.868 3 179 3.40.50.360
3u7rB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8585 6 181 3.40.50.360
af_P95105_3_183_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8511 2 174 3.40.50.360
1x77B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8459 5 175 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A1I3LNV2-F1-model_v4 Chromate reductase 0.9996 1 77 GO:0005829
GO:0010181
GO:0016491
AF-A0A257PSN8-F1-model_v4 NADPH-dependent FMN reductase 0.9788 1 116 GO:0005829
GO:0010181
GO:0016491
AF-A0A4Q3T1V4-F1-model_v4 NAD(P)H-dependent oxidoreductase 0.9717 1 119 GO:0005829
GO:0010181
GO:0016491
AF-A0A848QE11-F1-model_v4 deleted 0.971 1 112
AF-A0A257PSN8-F1-model_v4 NADPH-dependent FMN reductase 0.9706 1 116 GO:0005829
GO:0010181
GO:0016491

Map