F353011

General Info

Members Datasets Scaffolds Average Seq Length
240 152 231 130

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_101932203|Ga0307409_1019322031
Length 138
Sequence MRLTGGMTIELSDHFARILAAPAFGHLGTVRPHGSVQVNPMWFEFDGEAGVIRFTHTTKRAKYRNLQKNPNMTLEVVDPENPMKYVEVRGRLAEVIPDPEGSFYVHLGQRYGDPDTQAPADKPDRVILVMKIEKVTGR

Samples

Sample ID Description Type Environment
1 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
2 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
3 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
4 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
5 2919069694 Microbacterium sp. 1154 Isolate Unclassified
6 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
7 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
8 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
28 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
32 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
36 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
48 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
69 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
70 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
71 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
72 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
73 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
74 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
75 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
76 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
77 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
78 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
79 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
80 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
81 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
82 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
83 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
84 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
85 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
86 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
87 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
88 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
89 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
90 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
91 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
92 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
93 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
94 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
95 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
96 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
97 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
98 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
99 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
100 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
101 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
102 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
103 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
104 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
105 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
106 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
107 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
108 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
109 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
110 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
111 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
112 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
113 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
114 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
115 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
116 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
117 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
118 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
119 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
120 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
134 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
135 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
136 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
137 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
138 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
139 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
140 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
141 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
142 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
143 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
146 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
147 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
148 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
149 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
150 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
151 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
152 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.25
Metatranscriptomes 0
Isolates 3.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.25
Nodule 0
Rhizoplane 9.17
Rhizosphere 78.75
Stem 0
Stem Tuber 0
Unclassified 10.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10000104 3300005327 Bacteria 75381
2 Ga0070683_100282656 3300005329 Bacteria 1578
3 Ga0070683_100948286 3300005329 Bacteria 826
4 Ga0070682_100864492 3300005337 Bacteria 740
5 Ga0068868_102356749 3300005338 Bacteria 508
6 Ga0070660_100120573 3300005339 Bacteria 2093
7 Ga0070660_100511026 3300005339 Bacteria 1000
8 Ga0070668_100172409 3300005347 Bacteria 1762
9 Ga0070659_100071097 3300005366 Bacteria 2766
10 Ga0070659_100390935 3300005366 Bacteria 1173
11 Ga0070714_101213519 3300005435 Bacteria 736
12 Ga0070710_10580194 3300005437 Bacteria 778
13 Ga0070663_100060849 3300005455 Bacteria 2718
14 Ga0070663_100372521 3300005455 Bacteria 1161
15 Ga0070663_101341698 3300005455 Bacteria 632
16 Ga0070662_100454309 3300005457 Bacteria 1064
17 Ga0070681_10317194 3300005458 Bacteria 1468
18 Ga0070684_100354099 3300005535 Bacteria 1350
19 Ga0070684_101245691 3300005535 Bacteria 700
20 Ga0070684_101379669 3300005535 Bacteria 664
21 Ga0068853_100459571 3300005539 Bacteria 1198
22 Ga0068853_101959721 3300005539 Bacteria 568
23 Ga0070665_100002822 3300005548 Bacteria 18813
24 Ga0068855_100191354 3300005563 Bacteria 2307
25 Ga0068852_100698871 3300005616 Bacteria 1024
26 Ga0068852_101668349 3300005616 Bacteria 660
27 Ga0068861_101282316 3300005719 Bacteria 712
28 Ga0068865_101198518 3300006881 Bacteria 672
29 Ga0105244_10066732 3300009036 Bacteria 1801
30 Ga0105245_10467386 3300009098 Bacteria 1273
31 Ga0105245_11143117 3300009098 Bacteria 826
32 Ga0105243_11046227 3300009148 Bacteria 822
33 Ga0105241_11992425 3300009174 Bacteria 571
34 Ga0105242_11500993 3300009176 Bacteria 705
35 Ga0105242_11965350 3300009176 Bacteria 626
36 Ga0105237_11457361 3300009545 Bacteria 691
37 Ga0105249_10428561 3300009553 Bacteria 1358
38 Ga0105246_12143317 3300011119 Bacteria 543
39 Ga0157371_10330847 3300013102 Bacteria 1107
40 Ga0157370_10037262 3300013104 Bacteria 4714
41 Ga0157369_10639052 3300013105 Bacteria 1098
42 Ga0163162_11403746 3300013306 Bacteria 794
43 Ga0157372_10992541 3300013307 Bacteria 973
44 Ga0157375_10503613 3300013308 Bacteria 1375
45 Ga0157375_11725257 3300013308 Bacteria 742
46 Ga0157375_12378480 3300013308 Bacteria 632
47 Ga0163163_10669625 3300014325 Bacteria 1101
48 Ga0163163_11440849 3300014325 Bacteria 750
49 Ga0157380_10129241 3300014326 Bacteria 2153
50 Ga0157380_11640559 3300014326 Bacteria 699
51 Ga0157380_13097040 3300014326 Bacteria 530
52 Ga0182008_10537798 3300014497 Bacteria 647
53 Ga0157379_11227929 3300014968 Bacteria 722
54 Ga0157376_10477789 3300014969 Bacteria 1221
55 Ga0163161_10540771 3300017792 Bacteria 954
56 Ga0163161_10663852 3300017792 Bacteria 865
57 Ga0207692_10501902 3300025898 Bacteria 770
58 Ga0207705_10000001 3300025909 Bacteria 2061880
59 Ga0207707_10677212 3300025912 Bacteria 868
60 Ga0207671_10814727 3300025914 Bacteria 740
61 Ga0207671_11144522 3300025914 Bacteria 610
62 Ga0207663_11291091 3300025916 Bacteria 588
63 Ga0207657_10052656 3300025919 Bacteria 3531
64 Ga0207681_10534108 3300025923 Bacteria 964
65 Ga0207644_10875071 3300025931 Bacteria 753
66 Ga0207690_10033774 3300025932 Bacteria 3292
67 Ga0207706_10621539 3300025933 Bacteria 927
68 Ga0207661_11200334 3300025944 Bacteria 698
69 Ga0207679_10372570 3300025945 Bacteria 1250
70 Ga0207667_10456687 3300025949 Bacteria 1298
71 Ga0207668_10220848 3300025972 Bacteria 1522
72 Ga0207677_11696169 3300026023 Bacteria 586
73 Ga0207639_10618349 3300026041 Bacteria 1000
74 Ga0207678_10015100 3300026067 Bacteria 6794
75 Ga0207683_10931732 3300026121 Bacteria 807
76 Ga0207698_11723100 3300026142 Bacteria 642
77 Ga0207698_12269343 3300026142 Bacteria 555
78 Ga0268266_10032997 3300028379 Bacteria 4401
79 Ga0307406_11813129 3300031901 Bacteria 543
80 Ga0307409_101932203 3300031995 Bacteria 620
81 Ga0307416_101354965 3300032002 Bacteria 817
82 Ga0395901_0575784 3300038443 Bacteria 1138
83 Ga0451843_0245688 3300041509 Bacteria 685
84 Ga0466969_0080957 3300044656 Bacteria 1550
85 Ga0466965_0807951 3300044683 Bacteria 543
86 Ga0466961_0205982 3300044693 Bacteria 1215
87 Ga0466961_0457453 3300044693 Bacteria 772
88 Ga0466963_0038003 3300044694 Bacteria 3147
89 Ga0466963_0073534 3300044694 Bacteria 2304
90 Ga0466963_0100925 3300044694 Bacteria 1975
91 Ga0466963_0209047 3300044694 Bacteria 1365
92 Ga0466963_0237569 3300044694 Bacteria 1277
93 Ga0466963_0370429 3300044694 Bacteria 1009
94 Ga0466964_0009219 3300044706 Bacteria 3711
95 Ga0466964_0061185 3300044706 Bacteria 1567
96 Ga0466964_0190601 3300044706 Bacteria 978
97 Ga0466964_0615395 3300044706 Bacteria 597
98 Ga0466971_0181404 3300044719 Bacteria 990
99 Ga0466957_0154064 3300044842 Bacteria 1488
100 Ga0466957_0186128 3300044842 Bacteria 1358
101 Ga0466957_0589540 3300044842 Bacteria 777
102 Ga0466957_0936500 3300044842 Bacteria 620
103 Ga0466960_0028546 3300044901 Bacteria 2554
104 Ga0466960_0315125 3300044901 Bacteria 885
105 Ga0466958_1110280 3300045836 Bacteria 516
106 Ga0466967_0009970 3300045976 Bacteria 7091
107 Ga0466967_0077084 3300045976 Bacteria 3000
108 Ga0466967_0081245 3300045976 Bacteria 2927
109 Ga0466967_0117491 3300045976 Bacteria 2452
110 Ga0466967_0157229 3300045976 Bacteria 2130
111 Ga0466967_0195223 3300045976 Bacteria 1915
112 Ga0466967_0814611 3300045976 Bacteria 927
113 Ga0466967_0863543 3300045976 Bacteria 899
114 Ga0495603_0160394 3300046455 Bacteria 1305
115 Ga0495638_0017339 3300046460 Bacteria 4804
116 Ga0495641_0309898 3300046461 Unclassified 712
117 Ga0495653_0474153 3300046463 Unclassified 784
118 Ga0495582_0212112 3300046473 Bacteria 1107
119 Ga0495668_0492886 3300046616 Bacteria 675
120 Ga0495588_0331902 3300046674 Bacteria 800
121 Ga0495646_0372813 3300046680 Bacteria 745
122 Ga0495646_0548010 3300046680 Bacteria 591
123 Ga0495658_0213375 3300046683 Unclassified 1207
124 Ga0495670_0619219 3300046691 Bacteria 590
125 Ga0495589_0303397 3300046794 Bacteria 740
126 Ga0495600_0107243 3300046809 Bacteria 1820
127 Ga0495600_0449630 3300046809 Bacteria 797
128 Ga0495674_0293825 3300047319 Unclassified 1328
129 Ga0495674_0328575 3300047319 Bacteria 1244
130 Ga0495680_0207974 3300047322 Bacteria 1402
131 Ga0496102_0017699 3300048905 Bacteria 6247
132 Ga0496102_0042522 3300048905 Bacteria 4118
133 Ga0496102_1808776 3300048905 Bacteria 528
134 Ga0496103_0257798 3300048906 Bacteria 1122
135 Ga0496104_0002656 3300048907 Bacteria 15385
136 Ga0496105_0007043 3300048908 Bacteria 8665
137 Ga0496106_0542992 3300048909 Bacteria 933
138 Ga0496107_1344361 3300048910 Bacteria 510
139 Ga0496108_0004367 3300048911 Bacteria 11372
140 Ga0496108_0422674 3300048911 Unclassified 1164
141 Ga0496108_0835364 3300048911 Bacteria 793
142 Ga0496108_0941848 3300048911 Bacteria 740
143 Ga0496108_1012208 3300048911 Bacteria 709
144 Ga0496109_0064320 3300048912 Bacteria 3356
145 Ga0496109_1390874 3300048912 Bacteria 637
146 Ga0496110_0031211 3300048913 Bacteria 4596
147 Ga0496111_0003180 3300048914 Bacteria 10120
148 Ga0496112_0184500 3300048915 Bacteria 2050
149 Ga0496114_0031383 3300048917 Bacteria 4373
150 Ga0496114_0169378 3300048917 Bacteria 1903
151 Ga0496114_1041910 3300048917 Bacteria 702
152 Ga0496115_0882466 3300048918 Bacteria 691
153 Ga0496116_0316720 3300048919 Bacteria 733
154 Ga0496117_0000232 3300048920 Bacteria 105479
155 Ga0496117_0040725 3300048920 Bacteria 3412
156 Ga0496117_0151341 3300048920 Bacteria 1373
157 Ga0496118_0136377 3300048921 Bacteria 1565
158 Ga0496119_0002020 3300048922 Bacteria 22984
159 Ga0496119_0006922 3300048922 Bacteria 10343
160 Ga0496120_0002501 3300048923 Bacteria 18438
161 Ga0496120_0005629 3300048923 Bacteria 9925
162 Ga0496122_0005995 3300048925 Bacteria 14196
163 Ga0496122_0147187 3300048925 Bacteria 1461
164 Ga0496123_0002368 3300048926 Bacteria 23643
165 Ga0496123_0343756 3300048926 Bacteria 696
166 Ga0496124_0005016 3300048927 Bacteria 15139
167 Ga0496124_0067062 3300048927 Bacteria 2987
168 Ga0496125_0004593 3300048928 Bacteria 15782
169 Ga0496125_0085742 3300048928 Bacteria 2385
170 Ga0496126_0001194 3300048929 Bacteria 42334
171 Ga0496126_1298954 3300048929 Bacteria 530
172 Ga0496126_1326687 3300048929 Bacteria 523
173 Ga0501031_0005313 3300049568 Bacteria 8388
174 Ga0501031_0053837 3300049568 Bacteria 2623
175 Ga0501032_0006540 3300049569 Bacteria 8558
176 Ga0501032_0451479 3300049569 Bacteria 823
177 Ga0501033_0010823 3300049570 Bacteria 6995
178 Ga0501033_0214069 3300049570 Bacteria 1373
179 Ga0501033_0699071 3300049570 Bacteria 690
180 Ga0501034_0018321 3300049571 Bacteria 7183
181 Ga0501034_0029943 3300049571 Bacteria 5533
182 Ga0501034_0140873 3300049571 Bacteria 2391
183 Ga0501036_0263709 3300049572 Bacteria 1443
184 Ga0501036_1212212 3300049572 Bacteria 615
185 Ga0501037_0040200 3300049573 Bacteria 3441
186 Ga0501037_0331318 3300049573 Bacteria 1053
187 Ga0501038_0080073 3300049574 Bacteria 2754
188 Ga0501038_0154457 3300049574 Bacteria 1869
189 Ga0501039_0042881 3300049575 Bacteria 3495
190 Ga0501039_0060233 3300049575 Bacteria 2940
191 Ga0501042_0179848 3300049578 Bacteria 1526
192 Ga0501042_0606996 3300049578 Bacteria 795
193 Ga0501043_0014032 3300049579 Bacteria 6270
194 Ga0501046_0048320 3300049580 Bacteria 3370
195 Ga0501046_0065410 3300049580 Bacteria 2836
196 Ga0501047_0008208 3300049581 Bacteria 9860
197 Ga0501047_0093524 3300049581 Bacteria 2885
198 Ga0501047_0628792 3300049581 Bacteria 894
199 Ga0501048_0004529 3300049582 Bacteria 10579
200 Ga0501048_0865499 3300049582 Bacteria 650
201 Ga0501067_0409975 3300049583 Bacteria 756
202 Ga0501069_0373304 3300049585 Bacteria 842
203 Ga0501069_1034876 3300049585 Bacteria 502
204 Ga0501070_0017700 3300049586 Bacteria 5983
205 Ga0501070_0069464 3300049586 Bacteria 2916
206 Ga0501071_0112506 3300049587 Bacteria 2013
207 Ga0501072_0219716 3300049588 Bacteria 1514
208 Ga0501073_0037733 3300049589 Bacteria 3429
209 Ga0501073_0062473 3300049589 Bacteria 2598
210 Ga0501074_0203469 3300049590 Bacteria 1411
211 Ga0501074_0228934 3300049590 Bacteria 1323
212 Ga0501079_0102129 3300049741 Bacteria 2224
213 Ga0501080_0087281 3300049742 Bacteria 2898
214 Ga0501080_0129474 3300049742 Bacteria 2336
215 Ga0501080_0745369 3300049742 Bacteria 862
216 Ga0501083_0000047 3300049744 Bacteria 88014
217 Ga0501083_0373377 3300049744 Bacteria 927
218 Ga0501035_0026908 3300049822 Bacteria 5258
219 Ga0501035_0040709 3300049822 Bacteria 4198
220 Ga0501035_0173673 3300049822 Bacteria 1860
221 Ga0501044_0036639 3300049823 Bacteria 5130
222 Ga0501044_0194764 3300049823 Bacteria 1987
223 Ga0501044_1162464 3300049823 Bacteria 640
224 Ga0501045_0463756 3300049824 Bacteria 941
225 Ga0500573_0070730 3300053140 Bacteria 1990
226 Ga0500573_0073970 3300053140 Bacteria 1941
227 Ga0500645_002509 3300053730 Bacteria 8120
228 Ga0501084_0271691 3300054114 Bacteria 1431
229 Ga0501082_1301087 3300060353 Bacteria 635
230 Ga0466962_0392023 3300061719 Bacteria 695
231 Ga0530510_0220701 3300061734 Bacteria 1409

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2757320536 2758227263 123
2 iso_pu_bacteria 2773857758 2774381666 123
3 iso_pu_bacteria 2908678064 2908681324 123
4 iso_pu_bacteria 2919069694 2919071488 123
5 iso_pu_bacteria 2974294766 2974297696 123
6 iso_pu_bacteria 2974324384 2974326069 123
7 iso_pu_bacteria 8016254467 8016257865 123
8 3300005329 Ga0070683_100282656 Ga0070683_1002826562 125
9 3300005435 Ga0070714_101213519 Ga0070714_1012135191 125
10 3300005437 Ga0070710_10580194 Ga0070710_105801942 125
11 3300005458 Ga0070681_10317194 Ga0070681_103171942 125
12 3300005535 Ga0070684_100354099 Ga0070684_1003540991 125
13 3300025898 Ga0207692_10501902 Ga0207692_105019022 125
14 3300025912 Ga0207707_10677212 Ga0207707_106772122 125
15 3300025916 Ga0207663_11291091 Ga0207663_112910912 125
16 3300025944 Ga0207661_11200334 Ga0207661_112003341 125
17 3300044683 Ga0466965_0807951 Ga0466965_0807951_108_485 125
18 3300044693 Ga0466961_0457453 Ga0466961_0457453_111_488 125
19 3300044694 Ga0466963_0038003 Ga0466963_0038003_774_1151 125
20 3300044694 Ga0466963_0073534 Ga0466963_0073534_1261_1638 125
21 3300044694 Ga0466963_0100925 Ga0466963_0100925_1365_1742 125
22 3300044694 Ga0466963_0209047 Ga0466963_0209047_551_928 125
23 3300044694 Ga0466963_0237569 Ga0466963_0237569_777_1154 125
24 3300044706 Ga0466964_0061185 Ga0466964_0061185_393_770 125
25 3300044706 Ga0466964_0190601 Ga0466964_0190601_493_870 125
26 3300044706 Ga0466964_0615395 Ga0466964_0615395_118_495 125
27 3300044719 Ga0466971_0181404 Ga0466971_0181404_342_719 125
28 3300044842 Ga0466957_0154064 Ga0466957_0154064_850_1227 125
29 3300044842 Ga0466957_0589540 Ga0466957_0589540_179_556 125
30 3300044842 Ga0466957_0936500 Ga0466957_0936500_190_567 125
31 3300045836 Ga0466958_1110280 Ga0466958_1110280_63_440 125
32 3300045976 Ga0466967_0009970 Ga0466967_0009970_2791_3168 125
33 3300045976 Ga0466967_0081245 Ga0466967_0081245_878_1255 125
34 3300045976 Ga0466967_0157229 Ga0466967_0157229_681_1058 125
35 3300045976 Ga0466967_0814611 Ga0466967_0814611_231_608 125
36 3300045976 Ga0466967_0863543 Ga0466967_0863543_134_511 125
37 3300048915 Ga0496112_0184500 Ga0496112_0184500_495_872 125
38 iso_pu_bacteria 2721755702 2723640885 126
39 iso_pu_bacteria 2939660829 2939662048 126
40 3300005455 Ga0070663_101341698 Ga0070663_1013416981 127
41 3300005616 Ga0068852_100698871 Ga0068852_1006988712 127
42 3300009036 Ga0105244_10066732 Ga0105244_100667322 127
43 3300009174 Ga0105241_11992425 Ga0105241_119924252 127
44 3300013307 Ga0157372_10992541 Ga0157372_109925413 127
45 3300013308 Ga0157375_11725257 Ga0157375_117252571 127
46 3300025914 Ga0207671_11144522 Ga0207671_111445221 127
47 3300046461 Ga0495641_0309898 Ga0495641_0309898_69_452 127
48 3300046463 Ga0495653_0474153 Ga0495653_0474153_152_535 127
49 3300046674 Ga0495588_0331902 Ga0495588_0331902_327_710 127
50 3300046680 Ga0495646_0372813 Ga0495646_0372813_241_624 127
51 3300046680 Ga0495646_0548010 Ga0495646_0548010_16_399 127
52 3300046683 Ga0495658_0213375 Ga0495658_0213375_288_671 127
53 3300046809 Ga0495600_0449630 Ga0495600_0449630_142_525 127
54 3300047319 Ga0495674_0293825 Ga0495674_0293825_725_1108 127
55 3300048905 Ga0496102_0017699 Ga0496102_0017699_4001_4384 127
56 3300048905 Ga0496102_1808776 Ga0496102_1808776_12_395 127
57 3300048906 Ga0496103_0257798 Ga0496103_0257798_586_969 127
58 3300048907 Ga0496104_0002656 Ga0496104_0002656_9076_9459 127
59 3300048908 Ga0496105_0007043 Ga0496105_0007043_3051_3434 127
60 3300048909 Ga0496106_0542992 Ga0496106_0542992_378_761 127
61 3300048911 Ga0496108_0004367 Ga0496108_0004367_3484_3867 127
62 3300048911 Ga0496108_0422674 Ga0496108_0422674_25_408 127
63 3300048912 Ga0496109_0064320 Ga0496109_0064320_2303_2686 127
64 3300048913 Ga0496110_0031211 Ga0496110_0031211_3671_4054 127
65 3300048914 Ga0496111_0003180 Ga0496111_0003180_4151_4534 127
66 3300048917 Ga0496114_0031383 Ga0496114_0031383_2035_2418 127
67 3300048917 Ga0496114_1041910 Ga0496114_1041910_60_443 127
68 3300048918 Ga0496115_0882466 Ga0496115_0882466_94_477 127
69 3300048920 Ga0496117_0000232 Ga0496117_0000232_66232_66615 127
70 3300048920 Ga0496117_0040725 Ga0496117_0040725_1493_1876 127
71 3300048920 Ga0496117_0151341 Ga0496117_0151341_387_770 127
72 3300048921 Ga0496118_0136377 Ga0496118_0136377_788_1171 127
73 3300048922 Ga0496119_0002020 Ga0496119_0002020_9380_9763 127
74 3300048922 Ga0496119_0006922 Ga0496119_0006922_7657_8040 127
75 3300048923 Ga0496120_0002501 Ga0496120_0002501_4859_5242 127
76 3300048923 Ga0496120_0005629 Ga0496120_0005629_4624_5007 127
77 3300048925 Ga0496122_0005995 Ga0496122_0005995_4638_5021 127
78 3300048925 Ga0496122_0147187 Ga0496122_0147187_106_489 127
79 3300048926 Ga0496123_0002368 Ga0496123_0002368_9200_9583 127
80 3300048926 Ga0496123_0343756 Ga0496123_0343756_75_458 127
81 3300048927 Ga0496124_0005016 Ga0496124_0005016_1160_1543 127
82 3300048927 Ga0496124_0067062 Ga0496124_0067062_438_821 127
83 3300048928 Ga0496125_0004593 Ga0496125_0004593_2775_3158 127
84 3300048928 Ga0496125_0085742 Ga0496125_0085742_694_1077 127
85 3300048929 Ga0496126_0001194 Ga0496126_0001194_9157_9540 127
86 3300005616 Ga0068852_101668349 Ga0068852_1016683492 128
87 3300014968 Ga0157379_11227929 Ga0157379_112279292 128
88 3300044694 Ga0466963_0370429 Ga0466963_0370429_604_993 129
89 3300044842 Ga0466957_0186128 Ga0466957_0186128_220_609 129
90 3300005338 Ga0068868_102356749 Ga0068868_1023567491 130
91 3300005339 Ga0070660_100511026 Ga0070660_1005110261 130
92 3300005366 Ga0070659_100390935 Ga0070659_1003909352 130
93 3300005457 Ga0070662_100454309 Ga0070662_1004543092 130
94 3300005539 Ga0068853_101959721 Ga0068853_1019597211 130
95 3300005719 Ga0068861_101282316 Ga0068861_1012823162 130
96 3300006881 Ga0068865_101198518 Ga0068865_1011985182 130
97 3300009098 Ga0105245_10467386 Ga0105245_104673862 130
98 3300009148 Ga0105243_11046227 Ga0105243_110462272 130
99 3300009176 Ga0105242_11965350 Ga0105242_119653502 130
100 3300009553 Ga0105249_10428561 Ga0105249_104285613 130
101 3300013306 Ga0163162_11403746 Ga0163162_114037462 130
102 3300013308 Ga0157375_10503613 Ga0157375_105036131 130
103 3300014325 Ga0163163_10669625 Ga0163163_106696252 130
104 3300014326 Ga0157380_10129241 Ga0157380_101292413 130
105 3300014326 Ga0157380_11640559 Ga0157380_116405592 130
106 3300014497 Ga0182008_10537798 Ga0182008_105377982 130
107 3300025914 Ga0207671_10814727 Ga0207671_108147271 130
108 3300025923 Ga0207681_10534108 Ga0207681_105341082 130
109 3300025931 Ga0207644_10875071 Ga0207644_108750711 130
110 3300025933 Ga0207706_10621539 Ga0207706_106215392 130
111 3300025945 Ga0207679_10372570 Ga0207679_103725702 130
112 3300026041 Ga0207639_10618349 Ga0207639_106183492 130
113 3300031901 Ga0307406_11813129 Ga0307406_118131291 130
114 3300031995 Ga0307409_101932203 Ga0307409_1019322031 130
115 3300032002 Ga0307416_101354965 Ga0307416_1013549652 130
116 3300041509 Ga0451843_0245688 Ga0451843_0245688_16_408 130
117 3300044656 Ga0466969_0080957 Ga0466969_0080957_321_713 130
118 3300044693 Ga0466961_0205982 Ga0466961_0205982_63_455 130
119 3300044706 Ga0466964_0009219 Ga0466964_0009219_1271_1663 130
120 3300044901 Ga0466960_0028546 Ga0466960_0028546_1370_1762 130
121 3300044901 Ga0466960_0315125 Ga0466960_0315125_10_402 130
122 3300045976 Ga0466967_0077084 Ga0466967_0077084_1617_2009 130
123 3300045976 Ga0466967_0117491 Ga0466967_0117491_575_967 130
124 3300045976 Ga0466967_0195223 Ga0466967_0195223_64_522 130
125 3300046460 Ga0495638_0017339 Ga0495638_0017339_2921_3319 130
126 3300046691 Ga0495670_0619219 Ga0495670_0619219_172_570 130
127 3300046794 Ga0495589_0303397 Ga0495589_0303397_265_657 130
128 3300048905 Ga0496102_0042522 Ga0496102_0042522_3038_3436 130
129 3300048910 Ga0496107_1344361 Ga0496107_1344361_74_472 130
130 3300048911 Ga0496108_1012208 Ga0496108_1012208_63_455 130
131 3300048919 Ga0496116_0316720 Ga0496116_0316720_23_421 130
132 3300048929 Ga0496126_1298954 Ga0496126_1298954_34_426 130
133 3300048929 Ga0496126_1326687 Ga0496126_1326687_96_488 130
134 3300049568 Ga0501031_0053837 Ga0501031_0053837_492_884 130
135 3300049569 Ga0501032_0451479 Ga0501032_0451479_138_530 130
136 3300049572 Ga0501036_1212212 Ga0501036_1212212_37_429 130
137 3300049573 Ga0501037_0331318 Ga0501037_0331318_569_961 130
138 3300049574 Ga0501038_0080073 Ga0501038_0080073_2237_2629 130
139 3300049575 Ga0501039_0060233 Ga0501039_0060233_2491_2883 130
140 3300049578 Ga0501042_0606996 Ga0501042_0606996_123_515 130
141 3300049587 Ga0501071_0112506 Ga0501071_0112506_285_677 130
142 3300049588 Ga0501072_0219716 Ga0501072_0219716_168_560 130
143 3300049590 Ga0501074_0203469 Ga0501074_0203469_67_459 130
144 3300049741 Ga0501079_0102129 Ga0501079_0102129_1245_1637 130
145 3300049742 Ga0501080_0745369 Ga0501080_0745369_190_582 130
146 3300049822 Ga0501035_0040709 Ga0501035_0040709_3653_4045 130
147 3300053140 Ga0500573_0070730 Ga0500573_0070730_1143_1535 130
148 3300053140 Ga0500573_0073970 Ga0500573_0073970_1222_1614 130
149 3300054114 Ga0501084_0271691 Ga0501084_0271691_125_517 130
150 3300061734 Ga0530510_0220701 Ga0530510_0220701_97_489 130
151 3300005329 Ga0070683_100948286 Ga0070683_1009482862 131
152 3300005337 Ga0070682_100864492 Ga0070682_1008644922 131
153 3300005347 Ga0070668_100172409 Ga0070668_1001724092 131
154 3300005455 Ga0070663_100372521 Ga0070663_1003725212 131
155 3300005535 Ga0070684_101245691 Ga0070684_1012456911 131
156 3300005535 Ga0070684_101379669 Ga0070684_1013796691 131
157 3300005548 Ga0070665_100002822 Ga0070665_10000282219 131
158 3300009098 Ga0105245_11143117 Ga0105245_111431172 131
159 3300011119 Ga0105246_12143317 Ga0105246_121433171 131
160 3300013105 Ga0157369_10639052 Ga0157369_106390522 131
161 3300013308 Ga0157375_12378480 Ga0157375_123784801 131
162 3300014325 Ga0163163_11440849 Ga0163163_114408492 131
163 3300017792 Ga0163161_10663852 Ga0163161_106638522 131
164 3300025972 Ga0207668_10220848 Ga0207668_102208482 131
165 3300026023 Ga0207677_11696169 Ga0207677_116961691 131
166 3300026142 Ga0207698_11723100 Ga0207698_117231002 131
167 3300028379 Ga0268266_10032997 Ga0268266_100329973 131
168 3300046616 Ga0495668_0492886 Ga0495668_0492886_22_417 131
169 3300048911 Ga0496108_0835364 Ga0496108_0835364_100_495 131
170 3300048911 Ga0496108_0941848 Ga0496108_0941848_210_605 131
171 3300049585 Ga0501069_1034876 Ga0501069_1034876_13_408 131
172 3300053730 Ga0500645_002509 Ga0500645_002509_4993_5388 131
173 3300014326 Ga0157380_13097040 Ga0157380_130970402 132
174 3300026142 Ga0207698_12269343 Ga0207698_122693432 132
175 3300038443 Ga0395901_0575784 Ga0395901_0575784_82_480 132
176 3300049568 Ga0501031_0005313 Ga0501031_0005313_2393_2791 132
177 3300049569 Ga0501032_0006540 Ga0501032_0006540_1460_1858 132
178 3300049570 Ga0501033_0010823 Ga0501033_0010823_999_1397 132
179 3300049570 Ga0501033_0214069 Ga0501033_0214069_294_692 132
180 3300049570 Ga0501033_0699071 Ga0501033_0699071_187_585 132
181 3300049571 Ga0501034_0018321 Ga0501034_0018321_5182_5580 132
182 3300049571 Ga0501034_0029943 Ga0501034_0029943_1511_1909 132
183 3300049571 Ga0501034_0140873 Ga0501034_0140873_1072_1470 132
184 3300049572 Ga0501036_0263709 Ga0501036_0263709_783_1181 132
185 3300049573 Ga0501037_0040200 Ga0501037_0040200_1118_1516 132
186 3300049574 Ga0501038_0154457 Ga0501038_0154457_1060_1458 132
187 3300049575 Ga0501039_0042881 Ga0501039_0042881_1068_1466 132
188 3300049578 Ga0501042_0179848 Ga0501042_0179848_328_726 132
189 3300049579 Ga0501043_0014032 Ga0501043_0014032_4080_4478 132
190 3300049580 Ga0501046_0048320 Ga0501046_0048320_1710_2108 132
191 3300049580 Ga0501046_0065410 Ga0501046_0065410_704_1102 132
192 3300049581 Ga0501047_0008208 Ga0501047_0008208_7941_8339 132
193 3300049581 Ga0501047_0093524 Ga0501047_0093524_965_1363 132
194 3300049581 Ga0501047_0628792 Ga0501047_0628792_60_458 132
195 3300049582 Ga0501048_0004529 Ga0501048_0004529_5218_5616 132
196 3300049582 Ga0501048_0865499 Ga0501048_0865499_152_550 132
197 3300049583 Ga0501067_0409975 Ga0501067_0409975_131_529 132
198 3300049585 Ga0501069_0373304 Ga0501069_0373304_236_634 132
199 3300049586 Ga0501070_0017700 Ga0501070_0017700_701_1099 132
200 3300049586 Ga0501070_0069464 Ga0501070_0069464_1484_1882 132
201 3300049589 Ga0501073_0037733 Ga0501073_0037733_1927_2325 132
202 3300049589 Ga0501073_0062473 Ga0501073_0062473_698_1096 132
203 3300049590 Ga0501074_0228934 Ga0501074_0228934_57_455 132
204 3300049742 Ga0501080_0087281 Ga0501080_0087281_57_455 132
205 3300049742 Ga0501080_0129474 Ga0501080_0129474_552_950 132
206 3300049744 Ga0501083_0000047 Ga0501083_0000047_84719_85117 132
207 3300049744 Ga0501083_0373377 Ga0501083_0373377_215_613 132
208 3300049822 Ga0501035_0026908 Ga0501035_0026908_3203_3601 132
209 3300049822 Ga0501035_0173673 Ga0501035_0173673_210_608 132
210 3300049823 Ga0501044_0036639 Ga0501044_0036639_3211_3609 132
211 3300049823 Ga0501044_0194764 Ga0501044_0194764_79_477 132
212 3300049823 Ga0501044_1162464 Ga0501044_1162464_122_520 132
213 3300049824 Ga0501045_0463756 Ga0501045_0463756_311_709 132
214 3300060353 Ga0501082_1301087 Ga0501082_1301087_205_603 132
215 3300061719 Ga0466962_0392023 Ga0466962_0392023_15_413 132
216 3300005327 Ga0070658_10000104 Ga0070658_1000010433 133
217 3300005339 Ga0070660_100120573 Ga0070660_1001205732 133
218 3300005366 Ga0070659_100071097 Ga0070659_1000710974 133
219 3300005455 Ga0070663_100060849 Ga0070663_1000608493 133
220 3300005539 Ga0068853_100459571 Ga0068853_1004595712 133
221 3300005563 Ga0068855_100191354 Ga0068855_1001913544 133
222 3300009176 Ga0105242_11500993 Ga0105242_115009931 133
223 3300009545 Ga0105237_11457361 Ga0105237_114573611 133
224 3300013102 Ga0157371_10330847 Ga0157371_103308472 133
225 3300013104 Ga0157370_10037262 Ga0157370_100372623 133
226 3300014969 Ga0157376_10477789 Ga0157376_104777891 133
227 3300017792 Ga0163161_10540771 Ga0163161_105407711 133
228 3300025909 Ga0207705_10000001 Ga0207705_100000011959 133
229 3300025919 Ga0207657_10052656 Ga0207657_100526562 133
230 3300025932 Ga0207690_10033774 Ga0207690_100337743 133
231 3300025949 Ga0207667_10456687 Ga0207667_104566872 133
232 3300026067 Ga0207678_10015100 Ga0207678_100151002 133
233 3300026121 Ga0207683_10931732 Ga0207683_109317322 133
234 3300046455 Ga0495603_0160394 Ga0495603_0160394_307_723 133
235 3300046473 Ga0495582_0212112 Ga0495582_0212112_323_739 133
236 3300046809 Ga0495600_0107243 Ga0495600_0107243_258_674 133
237 3300047319 Ga0495674_0328575 Ga0495674_0328575_20_436 133
238 3300047322 Ga0495680_0207974 Ga0495680_0207974_212_628 133
239 3300048912 Ga0496109_1390874 Ga0496109_1390874_185_589 133
240 3300048917 Ga0496114_0169378 Ga0496114_0169378_1248_1652 133

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01243

Putative_PNPOx

Pyridoxamine 5'-phosphate oxidase

11

100

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f7e-assembly1.cif.gz_B msmeg_3380 f420 reductase 0.9717 8 131
3f7e-assembly1.cif.gz_B msmeg_3380 f420 reductase 0.9492 8 131
3ec6-assembly1.cif.gz_A-2 crystal structure of the general stress protein 26 from bacillus anthracis str. sterne 0.8091 10 132
2q9k-assembly1.cif.gz_A-2 crystal structure of a putative oxidoreductase (exig_1997) from exiguobacterium sibiricum 255-15 at 1.59 a resolution 0.8055 8 132
5jab-assembly1.cif.gz_B structure of the biliverdin reductase rv2074 from mycobacterium tuberculosis in complex with f420 0.7945 7 132
ID Description Score Start End Superfamily
3f7eB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9711 8 131 2.30.110.10
3f7eB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9482 8 131 2.30.110.10
af_P95144_3_116_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8369 17 69 2.30.110.10
af_O50398_10_140_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8246 6 131 2.30.110.10
3ec6A00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8047 10 132 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A397LTV0-F1-model_v4 deleted 0.9939 8 131
AF-A0A147F0Z1-F1-model_v4 F420-dependent protein 0.9935 7 133 GO:0005829
GO:0016627
GO:0070967
AF-M0QDL1-F1-model_v4 Pyridoxamine 5'-phosphate oxidase N-terminal domain-containing protein 0.9863 4 133 GO:0005829
GO:0016627
GO:0070967
AF-A0A147F0Z1-F1-model_v4 F420-dependent protein 0.9857 7 133 GO:0005829
GO:0016627
GO:0070967
AF-A0A7C6HS75-F1-model_v4 Pyridoxamine 5'-phosphate oxidase N-terminal domain-containing protein 0.9829 46 133

Feature Viewer

pLDDT pTM Quality
94.2 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map