F352957

General Info

Members Datasets Scaffolds Average Seq Length
240 149 480 203

Family's Representative Sequence

Representative Sequence 3300026078|Ga0207702_10118657|Ga0207702_101186572
Length 208
Sequence MAFLPAELVIAGWTGRDEAALKKHIRELEALGVKPPKTTPIFYRVAATLFTYANEIQVSGPDTSGEVEFVLLQTKDGLRVAVGSDHTDRKAETIGVTLSKQLCAKPVSAESWAYEEVKPHWNRLVLRSFIEEKGKRVLYQEGTVDAMRSPEDLLSRYPLKPNRAMFCGTFAAKGGIRPSTRFEMELEDPVLKRRLSHQYAIRELPVEG

Samples

Sample ID Description Type Environment
1 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
8 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
9 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
10 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
40 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
52 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
60 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
61 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
62 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
63 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
64 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
65 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
66 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
67 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
68 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
69 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
70 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
71 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
72 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
73 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
74 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
75 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
76 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
77 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
78 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
79 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
80 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
81 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
82 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
83 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
84 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
85 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
86 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
87 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
88 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
89 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
90 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
91 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
92 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
93 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
94 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
95 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
96 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
97 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
98 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
99 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
100 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
101 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
102 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
103 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
104 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
105 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
106 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
107 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
108 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
109 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
122 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
123 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
124 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
125 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
126 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
127 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
128 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
129 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
130 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
131 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
132 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
133 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
136 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
137 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
138 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
139 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
140 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
141 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
142 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
143 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
144 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
145 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
146 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
147 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
148 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
149 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.42
Rhizosphere 99.58
Stem 0
Stem Tuber 0
Unclassified 2.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207702_10118657 3300026078 Bacteria 2364
2 Ga0070683_100124529 3300005329 Bacteria 2436
3 Ga0070690_100057938 3300005330 Bacteria 2487
4 Ga0070680_100169838 3300005336 Bacteria 1835
5 Ga0070680_100717252 3300005336 Bacteria 861
6 Ga0070687_100305071 3300005343 Bacteria 1011
7 Ga0070673_100905955 3300005364 Bacteria 818
8 Ga0070705_100039764 3300005440 Bacteria 2670
9 Ga0070705_100261244 3300005440 Bacteria 1221
10 Ga0070681_10056601 3300005458 Bacteria 3902
11 Ga0070681_10407658 3300005458 Unclassified 1271
12 Ga0070681_10991095 3300005458 Bacteria 760
13 Ga0068867_100338452 3300005459 Bacteria 1252
14 Ga0070685_10132422 3300005466 Bacteria 1561
15 Ga0070706_100857481 3300005467 Bacteria 840
16 Ga0070707_100666998 3300005468 Bacteria 1003
17 Ga0070699_100005634 3300005518 Bacteria 10978
18 Ga0070679_100054507 3300005530 Bacteria 3981
19 Ga0070697_100033664 3300005536 Bacteria 4128
20 Ga0070697_100043493 3300005536 Bacteria 3637
21 Ga0070686_100045311 3300005544 Bacteria 2770
22 Ga0070686_100424736 3300005544 Bacteria 1016
23 Ga0070695_100005735 3300005545 Bacteria 7314
24 Ga0070695_100218615 3300005545 Bacteria 1371
25 Ga0070696_100006117 3300005546 Bacteria 8038
26 Ga0070696_100097247 3300005546 Unclassified 2105
27 Ga0070696_100161593 3300005546 Bacteria 1650
28 Ga0070696_100604279 3300005546 Bacteria 885
29 Ga0070704_100458906 3300005549 Bacteria 1099
30 Ga0070704_100469570 3300005549 Bacteria 1087
31 Ga0070702_100031160 3300005615 Bacteria 2915
32 Ga0068864_100145538 3300005618 Bacteria 2142
33 Ga0068861_100316147 3300005719 Bacteria 1358
34 Ga0068863_101014125 3300005841 Bacteria 833
35 Ga0081538_10072441 3300005981 Bacteria 1889
36 Ga0081539_10000332 3300005985 Bacteria 104677
37 Ga0097621_100024276 3300006237 Bacteria 4733
38 Ga0068871_100003199 3300006358 Bacteria 11236
39 Ga0075428_100006591 3300006844 Bacteria 12915
40 Ga0075430_100002352 3300006846 Bacteria 15715
41 Ga0075430_100002769 3300006846 Bacteria 14650
42 Ga0075430_100007753 3300006846 Bacteria 9070
43 Ga0075430_100217689 3300006846 Bacteria 1585
44 Ga0075431_100057298 3300006847 Bacteria 4019
45 Ga0075431_100071904 3300006847 Bacteria 3569
46 Ga0075433_10041419 3300006852 Bacteria 3990
47 Ga0075433_10279846 3300006852 Bacteria 1478
48 Ga0075433_10352484 3300006852 Bacteria 1300
49 Ga0075434_100000283 3300006871 Bacteria 36124
50 Ga0075434_100038791 3300006871 Bacteria 4720
51 Ga0075434_100170792 3300006871 Bacteria 2194
52 Ga0075429_100025168 3300006880 Bacteria 5166
53 Ga0075436_100001164 3300006914 Bacteria 17802
54 Ga0075436_100014023 3300006914 Bacteria 5485
55 Ga0075436_100123812 3300006914 Bacteria 1811
56 Ga0075436_100143229 3300006914 Bacteria 1680
57 Ga0075435_100019686 3300007076 Bacteria 5160
58 Ga0075435_100101570 3300007076 Bacteria 2383
59 Ga0075435_100216218 3300007076 Bacteria 1627
60 Ga0099794_10023529 3300007265 Bacteria 2819
61 Ga0111539_10095674 3300009094 Bacteria 3488
62 Ga0111539_10098698 3300009094 Bacteria 3430
63 Ga0111539_10141437 3300009094 Bacteria 2817
64 Ga0114129_10078122 3300009147 Bacteria 4604
65 Ga0114129_10734325 3300009147 Bacteria 1266
66 Ga0157376_10161967 3300014969 Bacteria 2029
67 Ga0207684_10450089 3300025910 Bacteria 1105
68 Ga0207707_10117600 3300025912 Bacteria 2324
69 Ga0207660_10397394 3300025917 Bacteria 1110
70 Ga0207662_10181233 3300025918 Bacteria 1355
71 Ga0207662_10342801 3300025918 Bacteria 1002
72 Ga0207652_10125240 3300025921 Bacteria 2288
73 Ga0207661_10076617 3300025944 Bacteria 2747
74 Ga0207708_10074902 3300026075 Bacteria 2595
75 Ga0207648_10419552 3300026089 Bacteria 1215
76 Ga0207676_10225603 3300026095 Bacteria 1672
77 Ga0207674_10492209 3300026116 Bacteria 1185
78 Ga0207675_100487992 3300026118 Bacteria 1225
79 Ga0209967_1002484 3300027364 Bacteria 2390
80 Ga0209981_1000152 3300027378 Bacteria 8445
81 Ga0210000_1009068 3300027462 Bacteria 1462
82 Ga0209995_1007920 3300027471 Bacteria 1713
83 Ga0209968_1013158 3300027526 Bacteria 1295
84 Ga0209999_1000569 3300027543 Bacteria 5806
85 Ga0209588_1115089 3300027671 Unclassified 863
86 Ga0209974_10102035 3300027876 Bacteria 1003
87 Ga0207428_10106773 3300027907 Bacteria 2158
88 Ga0307405_10404152 3300031731 Bacteria 1070
89 Ga0307416_100736800 3300032002 Bacteria 1077
90 Ga0373948_0087970 3300034817 Unclassified 717
91 Ga0373938_0046023 3300034957 Bacteria 984
92 Ga0373929_0049356 3300035085 Unclassified 958
93 Ga0373940_0055448 3300035088 Bacteria 1122
94 Ga0373952_0007638 3300035092 Bacteria 2033
95 Ga0373923_0037115 3300035111 Bacteria 1992
96 Ga0373954_0000071 3300035118 Bacteria 36140
97 Ga0373960_0012592 3300035121 Bacteria 2105
98 Ga0373960_0017677 3300035121 Bacteria 1850
99 Ga0373955_0021382 3300035172 Bacteria 3265
100 Ga0373924_0051972 3300035410 Bacteria 1700
101 Ga0373931_0067409 3300035691 Bacteria 1945
102 Ga0373933_0016099 3300035724 Bacteria 4177
103 Ga0373937_0000282 3300036401 Bacteria 48656
104 Ga0373937_0097681 3300036401 Bacteria 2724
105 Ga0373937_0308547 3300036401 Bacteria 1496
106 Ga0439461_0023050 3300041410 Bacteria 1251
107 Ga0451807_2171944 3300041486 Bacteria 768
108 Ga0439441_000544 3300042001 Bacteria 4169
109 Ga0439446_0020091 3300042156 Bacteria 1879
110 Ga0439435_0004448 3300042436 Bacteria 3019
111 Ga0439460_0001182 3300042461 Bacteria 6135
112 Ga0466963_0117141 3300044694 Bacteria 1831
113 Ga0451576_0399350 3300045051 Bacteria 1441
114 Ga0466967_0003087 3300045976 Bacteria 10707
115 Ga0495592_0025781 3300046454 Bacteria 4462
116 Ga0495651_0080378 3300046462 Bacteria 2463
117 Ga0495651_0218924 3300046462 Bacteria 1319
118 Ga0495653_0188135 3300046463 Bacteria 1411
119 Ga0495639_0219096 3300046475 Bacteria 935
120 Ga0495662_0014215 3300046476 Bacteria 3873
121 Ga0495662_0025784 3300046476 Bacteria 2839
122 Ga0495584_0294685 3300046491 Bacteria 824
123 Ga0495608_0001761 3300046511 Bacteria 15451
124 Ga0495608_0077206 3300046511 Bacteria 2168
125 Ga0495618_0172006 3300046514 Bacteria 1378
126 Ga0495628_0067713 3300046516 Bacteria 2787
127 Ga0495630_0005087 3300046517 Bacteria 9246
128 Ga0495630_0028237 3300046517 Bacteria 4169
129 Ga0495652_0455301 3300046529 Bacteria 895
130 Ga0495640_0008726 3300046533 Bacteria 7943
131 Ga0495640_0033674 3300046533 Bacteria 3639
132 Ga0495587_0028064 3300046536 Bacteria 3427
133 Ga0495634_0008271 3300046642 Bacteria 7756
134 Ga0495634_0238571 3300046642 Bacteria 1116
135 Ga0495635_0039287 3300046663 Bacteria 3274
136 Ga0495657_0317538 3300046675 Bacteria 926
137 Ga0495658_0041085 3300046683 Bacteria 2574
138 Ga0495658_0071173 3300046683 Bacteria 2020
139 Ga0495669_0057862 3300046684 Bacteria 1749
140 Ga0495613_0145665 3300046689 Bacteria 1690
141 Ga0495624_0059847 3300046690 Bacteria 2389
142 Ga0495600_0009770 3300046809 Bacteria 5932
143 Ga0495604_0051744 3300047317 Bacteria 3182
144 Ga0495604_0294306 3300047317 Bacteria 1092
145 Ga0495680_0033882 3300047322 Bacteria 4131
146 Ga0495602_0201306 3300048088 Bacteria 1519
147 Ga0501291_041930 3300049514 Bacteria 807
148 Ga0501031_0133495 3300049568 Bacteria 1622
149 Ga0501032_0046821 3300049569 Bacteria 2922
150 Ga0501033_0193222 3300049570 Bacteria 1456
151 Ga0501033_0697477 3300049570 Bacteria 691
152 Ga0501036_0002503 3300049572 Bacteria 14414
153 Ga0501036_0127486 3300049572 Bacteria 2149
154 Ga0501038_0006655 3300049574 Bacteria 10683
155 Ga0501038_0731122 3300049574 Unclassified 739
156 Ga0501039_0019409 3300049575 Bacteria 5211
157 Ga0501039_0081197 3300049575 Bacteria 2524
158 Ga0501040_0106279 3300049576 Bacteria 1961
159 Ga0501040_0128690 3300049576 Bacteria 1779
160 Ga0501040_0144770 3300049576 Bacteria 1675
161 Ga0501040_0278841 3300049576 Bacteria 1194
162 Ga0501041_0000398 3300049577 Bacteria 21891
163 Ga0501041_0035237 3300049577 Bacteria 3032
164 Ga0501041_0096120 3300049577 Bacteria 1831
165 Ga0501041_0142812 3300049577 Bacteria 1493
166 Ga0501041_0194534 3300049577 Bacteria 1270
167 Ga0501042_0012409 3300049578 Bacteria 5772
168 Ga0501042_0132164 3300049578 Bacteria 1799
169 Ga0501043_0006920 3300049579 Bacteria 9046
170 Ga0501046_0000393 3300049580 Bacteria 43715
171 Ga0501046_0142619 3300049580 Bacteria 1812
172 Ga0501048_0000181 3300049582 Bacteria 39855
173 Ga0501048_0156276 3300049582 Bacteria 1613
174 Ga0501067_0390574 3300049583 Bacteria 776
175 Ga0501068_0003002 3300049584 Bacteria 8994
176 Ga0501068_0598624 3300049584 Bacteria 718
177 Ga0501069_0149534 3300049585 Bacteria 1342
178 Ga0501071_0057201 3300049587 Bacteria 2818
179 Ga0501071_0095171 3300049587 Bacteria 2191
180 Ga0501072_0001849 3300049588 Bacteria 15752
181 Ga0501072_0037216 3300049588 Bacteria 3816
182 Ga0501072_0058210 3300049588 Bacteria 3046
183 Ga0501072_0462579 3300049588 Bacteria 1004
184 Ga0501074_0033418 3300049590 Bacteria 3727
185 Ga0501074_0177520 3300049590 Bacteria 1520
186 Ga0501075_0000242 3300049591 Bacteria 29265
187 Ga0501075_0028430 3300049591 Bacteria 4127
188 Ga0501076_0001073 3300049592 Bacteria 17968
189 Ga0501076_0072274 3300049592 Bacteria 2760
190 Ga0501076_0221206 3300049592 Bacteria 1547
191 Ga0501077_0002349 3300049593 Bacteria 11401
192 Ga0501079_0053212 3300049741 Bacteria 3123
193 Ga0501079_0395932 3300049741 Bacteria 1083
194 Ga0501080_0002206 3300049742 Bacteria 16926
195 Ga0501081_0000938 3300049743 Bacteria 17301
196 Ga0501081_0025257 3300049743 Bacteria 3995
197 Ga0501081_0075449 3300049743 Bacteria 2354
198 Ga0501035_0003028 3300049822 Bacteria 16113
199 Ga0501035_0449013 3300049822 Bacteria 1067
200 Ga0501044_0073394 3300049823 Bacteria 3478
201 Ga0501045_0069481 3300049824 Bacteria 2589
202 Ga0501045_0171286 3300049824 Bacteria 1617
203 Ga0501045_0173022 3300049824 Bacteria 1608
204 Ga0501045_0201235 3300049824 Bacteria 1484
205 Ga0501045_0232471 3300049824 Bacteria 1372
206 nmdc:mga05p37_778149_c1 3300050507 Bacteria 1050
207 nmdc:mga05p37_92563_c1 3300050507 Bacteria 3725
208 nmdc:mga05p37_976947_c1 3300050507 Bacteria 903
209 nmdc:mga09592_26209_c1 3300050508 Bacteria 4829
210 nmdc:mga0qj67_2300_c1 3300050509 Bacteria 13583
211 nmdc:mga0qj67_2525_c1 3300050509 Bacteria 13071
212 nmdc:mga0qj67_413113_c1 3300050509 Bacteria 1088
213 nmdc:mga0qj67_9364_c1 3300050509 Bacteria 7285
214 nmdc:mga06r32_117703_c1 3300050510 Bacteria 2619
215 nmdc:mga06r32_124120_c1 3300050510 Bacteria 2549
216 nmdc:mga06r32_31457_c1 3300050510 Bacteria 4984
217 nmdc:mga08y16_137212_c1 3300050511 Bacteria 2543
218 nmdc:mga08y16_19731_c1 3300050511 Bacteria 7108
219 nmdc:mga08y16_555358_c1 3300050511 Bacteria 1162
220 nmdc:mga0n895_380515_c1 3300050512 Bacteria 1428
221 nmdc:mga0n895_464425_c1 3300050512 Bacteria 1277
222 nmdc:mga0n895_56649_c1 3300050512 Bacteria 3862
223 nmdc:mga0rr50_151909_c1 3300050513 Bacteria 1872
224 nmdc:mga0rr50_4174_c1 3300050513 Bacteria 8448
225 nmdc:mga08x19_139058_c1 3300050514 Bacteria 1639
226 nmdc:mga08x19_154800_c1 3300050514 Bacteria 1554
227 nmdc:mga08x19_1750_c1 3300050514 Bacteria 13388
228 nmdc:mga08x19_399945_c1 3300050514 Bacteria 963
229 nmdc:mga08x19_8651_c2 3300050514 Bacteria 5621
230 nmdc:mga0a205_161346_c1 3300050515 Bacteria 1661
231 nmdc:mga0a205_618321_c1 3300050515 Bacteria 936
232 nmdc:mga0a205_7705_c1 3300050515 Bacteria 9768
233 Ga0495601_0067952 3300053077 Bacteria 2271
234 Ga0501084_0002815 3300054114 Bacteria 14041
235 Ga0501084_0356964 3300054114 Bacteria 1235
236 Ga0590077_006478 3300059426 Bacteria 2398
237 Ga0501082_0000358 3300060353 Bacteria 40322
238 Ga0501082_0188670 3300060353 Bacteria 1793
239 Ga0530510_0002277 3300061734 Bacteria 13168
240 Ga0530510_0021917 3300061734 Bacteria 4547
241 Ga0207702_10118657
242 Ga0070683_100124529
243 Ga0070690_100057938
244 Ga0070680_100169838
245 Ga0070680_100717252
246 Ga0070687_100305071
247 Ga0070673_100905955
248 Ga0070705_100039764
249 Ga0070705_100261244
250 Ga0070681_10056601
251 Ga0070681_10407658
252 Ga0070681_10991095
253 Ga0068867_100338452
254 Ga0070685_10132422
255 Ga0070706_100857481
256 Ga0070707_100666998
257 Ga0070699_100005634
258 Ga0070679_100054507
259 Ga0070697_100033664
260 Ga0070697_100043493
261 Ga0070686_100045311
262 Ga0070686_100424736
263 Ga0070695_100005735
264 Ga0070695_100218615
265 Ga0070696_100006117
266 Ga0070696_100097247
267 Ga0070696_100161593
268 Ga0070696_100604279
269 Ga0070704_100458906
270 Ga0070704_100469570
271 Ga0070702_100031160
272 Ga0068864_100145538
273 Ga0068861_100316147
274 Ga0068863_101014125
275 Ga0081538_10072441
276 Ga0081539_10000332
277 Ga0097621_100024276
278 Ga0068871_100003199
279 Ga0075428_100006591
280 Ga0075430_100002352
281 Ga0075430_100002769
282 Ga0075430_100007753
283 Ga0075430_100217689
284 Ga0075431_100057298
285 Ga0075431_100071904
286 Ga0075433_10041419
287 Ga0075433_10279846
288 Ga0075433_10352484
289 Ga0075434_100000283
290 Ga0075434_100038791
291 Ga0075434_100170792
292 Ga0075429_100025168
293 Ga0075436_100001164
294 Ga0075436_100014023
295 Ga0075436_100123812
296 Ga0075436_100143229
297 Ga0075435_100019686
298 Ga0075435_100101570
299 Ga0075435_100216218
300 Ga0099794_10023529
301 Ga0111539_10095674
302 Ga0111539_10098698
303 Ga0111539_10141437
304 Ga0114129_10078122
305 Ga0114129_10734325
306 Ga0157376_10161967
307 Ga0207684_10450089
308 Ga0207707_10117600
309 Ga0207660_10397394
310 Ga0207662_10181233
311 Ga0207662_10342801
312 Ga0207652_10125240
313 Ga0207661_10076617
314 Ga0207708_10074902
315 Ga0207648_10419552
316 Ga0207676_10225603
317 Ga0207674_10492209
318 Ga0207675_100487992
319 Ga0209967_1002484
320 Ga0209981_1000152
321 Ga0210000_1009068
322 Ga0209995_1007920
323 Ga0209968_1013158
324 Ga0209999_1000569
325 Ga0209588_1115089
326 Ga0209974_10102035
327 Ga0207428_10106773
328 Ga0307405_10404152
329 Ga0307416_100736800
330 Ga0373948_0087970
331 Ga0373938_0046023
332 Ga0373929_0049356
333 Ga0373940_0055448
334 Ga0373952_0007638
335 Ga0373923_0037115
336 Ga0373954_0000071
337 Ga0373960_0012592
338 Ga0373960_0017677
339 Ga0373955_0021382
340 Ga0373924_0051972
341 Ga0373931_0067409
342 Ga0373933_0016099
343 Ga0373937_0000282
344 Ga0373937_0097681
345 Ga0373937_0308547
346 Ga0439461_0023050
347 Ga0451807_2171944
348 Ga0439441_000544
349 Ga0439446_0020091
350 Ga0439435_0004448
351 Ga0439460_0001182
352 Ga0466963_0117141
353 Ga0451576_0399350
354 Ga0466967_0003087
355 Ga0495592_0025781
356 Ga0495651_0080378
357 Ga0495651_0218924
358 Ga0495653_0188135
359 Ga0495639_0219096
360 Ga0495662_0014215
361 Ga0495662_0025784
362 Ga0495584_0294685
363 Ga0495608_0001761
364 Ga0495608_0077206
365 Ga0495618_0172006
366 Ga0495628_0067713
367 Ga0495630_0005087
368 Ga0495630_0028237
369 Ga0495652_0455301
370 Ga0495640_0008726
371 Ga0495640_0033674
372 Ga0495587_0028064
373 Ga0495634_0008271
374 Ga0495634_0238571
375 Ga0495635_0039287
376 Ga0495657_0317538
377 Ga0495658_0041085
378 Ga0495658_0071173
379 Ga0495669_0057862
380 Ga0495613_0145665
381 Ga0495624_0059847
382 Ga0495600_0009770
383 Ga0495604_0051744
384 Ga0495604_0294306
385 Ga0495680_0033882
386 Ga0495602_0201306
387 Ga0501291_041930
388 Ga0501031_0133495
389 Ga0501032_0046821
390 Ga0501033_0193222
391 Ga0501033_0697477
392 Ga0501036_0002503
393 Ga0501036_0127486
394 Ga0501038_0006655
395 Ga0501038_0731122
396 Ga0501039_0019409
397 Ga0501039_0081197
398 Ga0501040_0106279
399 Ga0501040_0128690
400 Ga0501040_0144770
401 Ga0501040_0278841
402 Ga0501041_0000398
403 Ga0501041_0035237
404 Ga0501041_0096120
405 Ga0501041_0142812
406 Ga0501041_0194534
407 Ga0501042_0012409
408 Ga0501042_0132164
409 Ga0501043_0006920
410 Ga0501046_0000393
411 Ga0501046_0142619
412 Ga0501048_0000181
413 Ga0501048_0156276
414 Ga0501067_0390574
415 Ga0501068_0003002
416 Ga0501068_0598624
417 Ga0501069_0149534
418 Ga0501071_0057201
419 Ga0501071_0095171
420 Ga0501072_0001849
421 Ga0501072_0037216
422 Ga0501072_0058210
423 Ga0501072_0462579
424 Ga0501074_0033418
425 Ga0501074_0177520
426 Ga0501075_0000242
427 Ga0501075_0028430
428 Ga0501076_0001073
429 Ga0501076_0072274
430 Ga0501076_0221206
431 Ga0501077_0002349
432 Ga0501079_0053212
433 Ga0501079_0395932
434 Ga0501080_0002206
435 Ga0501081_0000938
436 Ga0501081_0025257
437 Ga0501081_0075449
438 Ga0501035_0003028
439 Ga0501035_0449013
440 Ga0501044_0073394
441 Ga0501045_0069481
442 Ga0501045_0171286
443 Ga0501045_0173022
444 Ga0501045_0201235
445 Ga0501045_0232471
446 nmdc:mga05p37_778149_c1
447 nmdc:mga05p37_92563_c1
448 nmdc:mga05p37_976947_c1
449 nmdc:mga09592_26209_c1
450 nmdc:mga0qj67_2300_c1
451 nmdc:mga0qj67_2525_c1
452 nmdc:mga0qj67_413113_c1
453 nmdc:mga0qj67_9364_c1
454 nmdc:mga06r32_117703_c1
455 nmdc:mga06r32_124120_c1
456 nmdc:mga06r32_31457_c1
457 nmdc:mga08y16_137212_c1
458 nmdc:mga08y16_19731_c1
459 nmdc:mga08y16_555358_c1
460 nmdc:mga0n895_380515_c1
461 nmdc:mga0n895_464425_c1
462 nmdc:mga0n895_56649_c1
463 nmdc:mga0rr50_151909_c1
464 nmdc:mga0rr50_4174_c1
465 nmdc:mga08x19_139058_c1
466 nmdc:mga08x19_154800_c1
467 nmdc:mga08x19_1750_c1
468 nmdc:mga08x19_399945_c1
469 nmdc:mga08x19_8651_c2
470 nmdc:mga0a205_161346_c1
471 nmdc:mga0a205_618321_c1
472 nmdc:mga0a205_7705_c1
473 Ga0495601_0067952
474 Ga0501084_0002815
475 Ga0501084_0356964
476 Ga0590077_006478
477 Ga0501082_0000358
478 Ga0501082_0188670
479 Ga0530510_0002277
480 Ga0530510_0021917

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11010

DUF2848

Protein of unknown function (DUF2848)

11

199

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8gst-assembly2.cif.gz_D crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (pyruvate bound-form) 0.7461 5 201
6fog-assembly4.cif.gz_D x-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate at 1.94a resolution. 0.7417 6 201
8sut-assembly1.cif.gz_B crystal structure of yisk from bacillus subtilis in complex with reaction product 4-hydroxy-2-oxoglutaric acid 0.7401 3 201
1nkq-assembly1.cif.gz_A crystal structure of yeast ynq8, a fumarylacetoacetate hydrolase family protein 0.7374 4 205
8suu-assembly1.cif.gz_A crystal structure of yisk from bacillus subtilis in apo form 0.7362 3 199
ID Description Score Start End Superfamily
af_Q9P7L4_1_220_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.7611 5 201 3.90.850.10
af_A0A0R4IWE1_56_289_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.745 3 199 3.90.850.10
af_Q54BF3_56_305_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.7408 3 199 3.90.850.10
3l53F00 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.7383 5 199 3.90.850.10
4maqA00 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.734 3 202 3.90.850.10
ID Description Score Start End GO Terms
AF-A0A6P1BX04-F1-model_v4 DUF2848 domain-containing protein 0.9728 33 205 GO:0003824
AF-A0A3M1G6R0-F1-model_v4 DUF2848 domain-containing protein 0.972 3 205 GO:0003824
AF-A0A646IIL2-F1-model_v4 DUF2848 domain-containing protein 0.971 40 179 GO:0003824
AF-A0A4R5IS60-F1-model_v4 DUF2848 domain-containing protein 0.9697 3 205 GO:0003824
AF-A0A158I0M9-F1-model_v4 DUF2848 domain-containing protein 0.9688 3 205 GO:0003824

Map