F352918

General Info

Members Datasets Scaffolds Average Seq Length
240 190 481 277

Family's Representative Sequence

Representative Sequence 3300025904|Ga0207647_10002247|Ga0207647_100022473
Length 309
Sequence MGASSSRSVTCFTRMENYQHWAISAHDRYEQGTYVRRMSTSQQLLTSVQVARFVAQGFLRLDGVVPREINERAVVALTEGLPEVSYGTPLGKAFAPDTFVHELLALPVVAGAVESLVGPEPTVDHQAVHVREPHEGQAQPLHGDAIIDVRPDAFDIQLMYYPHEVTAEMGGTLSVPGSHLRRINETDVGRVQNLRGQTRLTCPAGTVVLVHHGIWHGGRRNDTADRRYMYKLRLNPTVPQVRLWDVSDLHDPAVTAELNTYFPWYEQATARLEIYNRVLLWRALTGDESFDVEYWVTRVSNRPTLRSHA

Samples

Sample ID Description Type Environment
1 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
25 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
26 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
27 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
28 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
29 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
30 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
31 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
32 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
34 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
36 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
45 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
46 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
47 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
48 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
49 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
50 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
51 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
52 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
53 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
54 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
55 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
56 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
57 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
58 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
59 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
60 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
61 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
62 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
63 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
64 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
65 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
66 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
67 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
68 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
69 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
70 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
71 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
72 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
73 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
74 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
75 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
76 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
77 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
78 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
79 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
80 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
81 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
82 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
83 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
84 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
85 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
86 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
87 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
88 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
89 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
90 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
91 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
92 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
93 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
94 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
95 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
96 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
97 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
98 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
99 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
100 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
101 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
102 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
103 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
104 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
105 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
106 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
107 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
108 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
109 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
110 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
111 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
112 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
113 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
114 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
115 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
116 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
117 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
118 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
119 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
120 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
121 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
122 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
123 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
124 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
138 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
139 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
140 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
141 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
142 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
143 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
144 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
146 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
147 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
148 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
149 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
150 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
151 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
152 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
153 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
154 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
155 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
156 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
157 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
158 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
159 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
160 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
161 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
162 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
163 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
164 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
165 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
166 2643221548 Streptomyces sp. Root55 Isolate Unclassified
167 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
168 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
169 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
170 2643221714 Streptomyces sp. Root264 Isolate Unclassified
171 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
172 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
173 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
174 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
175 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
176 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
177 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
178 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
179 2862574272 Streptomyces sp. AcE210 Isolate Nodule
180 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
181 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
182 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
183 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
184 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
185 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
186 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
187 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
188 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
189 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere
190 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.5
Metatranscriptomes 1.67
Isolates 10.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.08
Nodule 0.42
Rhizoplane 2.5
Rhizosphere 70.42
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207647_10002247 3300025904 Bacteria 14716
2 JGI24740J21852_10047085 3300001979 Bacteria 1261
3 JGI24737J22298_10017381 3300001990 Bacteria 2318
4 JGI24737J22298_10057485 3300001990 Bacteria 1174
5 JGI24738J21930_10036061 3300002075 Bacteria 1007
6 JGI25406J46586_10010434 3300003203 Bacteria 4122
7 rootH1_10002558 3300003316 Bacteria 9464
8 rootH1_10101085 3300003316 Bacteria 1067
9 rootH1_10101085 3300003323 Bacteria 2129
10 rootH2_10016277 3300003320 Bacteria 2201
11 rootH2_10028913 3300003320 Bacteria 12140
12 rootL2_10047713 3300003322 Bacteria 1920
13 rootL2_10061958 3300003322 Bacteria 3628
14 rootL2_10204835 3300003322 Bacteria 3353
15 rootH1_10012326 3300003323 Bacteria 3964
16 rootH1_10137819 3300003323 Bacteria 1908
17 Ga0068869_100349199 3300005334 Bacteria 1205
18 Ga0070660_100444653 3300005339 Bacteria 1075
19 Ga0070668_100000304 3300005347 Bacteria 32300
20 Ga0070659_100380547 3300005366 Bacteria 1189
21 Ga0070667_100121244 3300005367 Bacteria 2275
22 Ga0070710_10000021 3300005437 Bacteria 77772
23 Ga0068855_100007791 3300005563 Bacteria 12935
24 Ga0068855_100122216 3300005563 Bacteria 2980
25 Ga0068852_100038716 3300005616 Bacteria 4009
26 Ga0068864_100467104 3300005618 Bacteria 1209
27 Ga0068858_100213942 3300005842 Bacteria 1824
28 Ga0068860_100659782 3300005843 Bacteria 1054
29 Ga0081455_10086997 3300005937 Bacteria 2544
30 Ga0081539_10001268 3300005985 Bacteria 44566
31 Ga0105240_10117231 3300009093 Bacteria 3211
32 Ga0105243_10732841 3300009148 Bacteria 967
33 Ga0105032_101452 3300009979 Bacteria 2167
34 Ga0105239_10319892 3300010375 Bacteria 1749
35 Ga0157372_10268467 3300013307 Bacteria 1982
36 Ga0182008_10000906 3300014497 Bacteria 20610
37 Ga0157376_10158529 3300014969 Bacteria 2049
38 Ga0182007_10000934 3300015262 Bacteria 16083
39 Ga0206351_10308767 3300020077 Bacteria 1256
40 Ga0206350_11061726 3300020080 Bacteria 1347
41 Ga0213875_10000083 3300021388 Bacteria 109856
42 Ga0224712_10010187 3300022467 Bacteria 2865
43 Ga0224712_10090182 3300022467 Bacteria 1283
44 Ga0207426_1005361 3300025302 Bacteria 5886
45 Ga0207692_10000259 3300025898 Bacteria 18240
46 Ga0207647_10048817 3300025904 Bacteria 2628
47 Ga0207664_10521506 3300025929 Bacteria 1065
48 Ga0207667_10181746 3300025949 Bacteria 2159
49 Ga0207712_10524968 3300025961 Bacteria 1015
50 Ga0207668_10001449 3300025972 Bacteria 13938
51 Ga0207677_10279872 3300026023 Bacteria 1369
52 Ga0268265_10291732 3300028380 Bacteria 1465
53 Ga0268264_10406980 3300028381 Bacteria 1309
54 Ga0307517_10018937 3300028786 Bacteria 8863
55 Ga0307515_10000547 3300028794 Bacteria 88787
56 Ga0307515_10025932 3300028794 Bacteria 10113
57 Ga0307515_10030416 3300028794 Bacteria 9065
58 Ga0307515_10116048 3300028794 Bacteria 3077
59 Ga0307511_10076459 3300030521 Bacteria 2393
60 Ga0307512_10006966 3300030522 Bacteria 11293
61 Ga0316177_1038782 3300030731 Bacteria 2786
62 Ga0316176_1147085 3300030732 Bacteria 3005
63 Ga0314311_1008091 3300030733 Bacteria 5285
64 Ga0316180_1029177 3300030736 Bacteria 1819
65 Ga0316180_1087387 3300030736 Bacteria 1109
66 Ga0316182_1067229 3300030745 Bacteria 1092
67 Ga0307513_10045710 3300031456 Bacteria 4782
68 Ga0307508_10011124 3300031616 Bacteria 8228
69 Ga0307508_10016947 3300031616 Bacteria 6630
70 Ga0307508_10022252 3300031616 Bacteria 5760
71 Ga0307508_10131901 3300031616 Bacteria 2102
72 Ga0307508_10381949 3300031616 Bacteria 999
73 Ga0307514_10016305 3300031649 Bacteria 6119
74 Ga0307516_10000089 3300031730 Bacteria 101721
75 Ga0307516_10006718 3300031730 Bacteria 13445
76 Ga0307516_10100017 3300031730 Bacteria 2716
77 Ga0307411_10000275 3300032005 Bacteria 17018
78 Ga0307507_10105757 3300033179 Bacteria 2328
79 Ga0307510_10094527 3300033180 Bacteria 2814
80 Ga0307510_10124817 3300033180 Bacteria 2267
81 Ga0373942_0000149 3300035207 Bacteria 16701
82 Ga0373962_0000555 3300035242 Bacteria 8411
83 Ga0373925_0119810 3300037068 Bacteria 2042
84 Ga0395898_0029314 3300037466 Bacteria 5514
85 Ga0436364_0079644 3300037853 Bacteria 315114
86 Ga0439436_0011200 3300041404 Bacteria 2725
87 Ga0439436_0015563 3300041404 Bacteria 2287
88 Ga0439439_0002027 3300041406 Bacteria 4217
89 Ga0439466_0055245 3300041411 Bacteria 1291
90 Ga0451787_223998 3300041441 Bacteria 2137
91 Ga0451789_0555202 3300041443 Bacteria 2676
92 Ga0451791_1202860 3300041451 Bacteria 7129
93 Ga0451793_0896790 3300041452 Bacteria 2378
94 Ga0451793_1494376 3300041452 Bacteria 1362
95 Ga0451837_0559940 3300041494 Bacteria 1981
96 Ga0451839_1204954 3300041496 Bacteria 2343
97 Ga0451841_0714541 3300041498 Bacteria 2494
98 Ga0451853_3674208 3300041512 Bacteria 5001
99 Ga0439433_0012088 3300041999 Bacteria 1892
100 Ga0439449_0016105 3300042007 Bacteria 2811
101 Ga0439449_0079814 3300042007 Bacteria 1206
102 Ga0439449_0089122 3300042007 Bacteria 1139
103 Ga0439457_004702 3300042014 Bacteria 3528
104 Ga0439457_005923 3300042014 Bacteria 3026
105 Ga0450920_012995 3300042122 Bacteria 1566
106 Ga0450897_003921 3300042128 Bacteria 1218
107 Ga0450894_000485 3300042131 Bacteria 6787
108 Ga0450896_008410 3300042133 Bacteria 1431
109 Ga0450898_000093 3300042134 Bacteria 8273
110 Ga0450898_007726 3300042134 Bacteria 1680
111 Ga0450906_013008 3300042145 Bacteria 1538
112 Ga0439458_0023036 3300042157 Bacteria 1450
113 Ga0466969_0020318 3300044656 Bacteria 3441
114 Ga0466969_0042007 3300044656 Bacteria 2285
115 Ga0466969_0042953 3300044656 Bacteria 2254
116 Ga0466969_0043197 3300044656 Bacteria 2246
117 Ga0466972_0001544 3300044658 Bacteria 11213
118 Ga0466972_0009095 3300044658 Bacteria 4990
119 Ga0466965_0003089 3300044683 Bacteria 7255
120 Ga0466965_0007738 3300044683 Bacteria 4944
121 Ga0466965_0010194 3300044683 Bacteria 4377
122 Ga0466965_0021531 3300044683 Bacteria 3104
123 Ga0466965_0046767 3300044683 Bacteria 2142
124 Ga0466966_0003426 3300044684 Bacteria 10463
125 Ga0466961_0006091 3300044693 Bacteria 7651
126 Ga0466971_0000148 3300044719 Bacteria 26247
127 Ga0466968_0016270 3300044735 Bacteria 2960
128 Ga0466970_0007089 3300044765 Bacteria 5607
129 Ga0466970_0199440 3300044765 Bacteria 1113
130 Ga0466970_0233656 3300044765 Bacteria 1028
131 Ga0466960_0001693 3300044901 Bacteria 8075
132 Ga0466959_0000406 3300045049 Bacteria 25196
133 Ga0466958_0117466 3300045836 Bacteria 1663
134 Ga0466967_0126293 3300045976 Bacteria 2370
135 Ga0495627_015383 3300046453 Bacteria 2643
136 Ga0495592_0145494 3300046454 Bacteria 1644
137 Ga0495603_0008620 3300046455 Bacteria 6162
138 Ga0495603_0011803 3300046455 Bacteria 5287
139 Ga0495651_0000044 3300046462 Bacteria 91242
140 Ga0495651_0039690 3300046462 Bacteria 3664
141 Ga0495653_0056285 3300046463 Bacteria 2998
142 Ga0495664_0254991 3300046477 Bacteria 1061
143 Ga0495585_0122275 3300046492 Bacteria 1376
144 Ga0495594_0019277 3300046499 Bacteria 3624
145 Ga0495594_0109732 3300046499 Bacteria 1555
146 Ga0495618_0006589 3300046514 Bacteria 7044
147 Ga0495628_0001427 3300046516 Bacteria 21937
148 Ga0495628_0012323 3300046516 Bacteria 7207
149 Ga0495628_0413255 3300046516 Bacteria 984
150 Ga0495643_0067313 3300046522 Bacteria 1887
151 Ga0495652_0004386 3300046529 Bacteria 13497
152 Ga0495652_0006810 3300046529 Bacteria 10593
153 Ga0495652_0083994 3300046529 Bacteria 2620
154 Ga0495586_0081433 3300046535 Bacteria 1779
155 Ga0495645_0087549 3300046543 Bacteria 2228
156 Ga0495645_0111784 3300046543 Bacteria 1932
157 Ga0495645_0133676 3300046543 Bacteria 1736
158 Ga0495611_0002873 3300046648 Bacteria 7691
159 Ga0495635_0001576 3300046663 Bacteria 15320
160 Ga0495623_0020006 3300046679 Bacteria 4327
161 Ga0495658_0078651 3300046683 Bacteria 1931
162 Ga0495613_0077567 3300046689 Bacteria 2417
163 Ga0495670_0038856 3300046691 Bacteria 2373
164 Ga0495589_0043634 3300046794 Bacteria 2231
165 Ga0495600_0012212 3300046809 Bacteria 5365
166 Ga0495600_0013576 3300046809 Bacteria 5122
167 Ga0495676_0002064 3300047321 Bacteria 17677
168 Ga0495676_0015455 3300047321 Bacteria 6794
169 Ga0495675_0164645 3300047444 Bacteria 1364
170 Ga0495685_000465 3300047447 Bacteria 12651
171 Ga0496108_0365935 3300048911 Bacteria 1259
172 Ga0501031_0000521 3300049568 Bacteria 22504
173 Ga0501032_0000558 3300049569 Bacteria 30209
174 Ga0501033_0007752 3300049570 Bacteria 8323
175 Ga0501034_0002738 3300049571 Bacteria 20741
176 Ga0501036_0001514 3300049572 Bacteria 17928
177 Ga0501037_0000606 3300049573 Bacteria 27863
178 Ga0501038_0000586 3300049574 Bacteria 32346
179 Ga0501039_0000805 3300049575 Bacteria 22594
180 Ga0501042_0020588 3300049578 Bacteria 4593
181 Ga0501043_0001867 3300049579 Bacteria 18042
182 Ga0501046_0001324 3300049580 Bacteria 23992
183 Ga0501047_0001582 3300049581 Bacteria 22218
184 Ga0501048_0001213 3300049582 Bacteria 19528
185 Ga0501068_0007333 3300049584 Bacteria 6107
186 Ga0501069_0003505 3300049585 Bacteria 8079
187 Ga0501070_0001896 3300049586 Bacteria 18498
188 Ga0501071_0009667 3300049587 Bacteria 6437
189 Ga0501074_0216925 3300049590 Bacteria 1363
190 Ga0501080_0001770 3300049742 Bacteria 18507
191 Ga0501083_0024929 3300049744 Bacteria 4142
192 Ga0501044_0005269 3300049823 Bacteria 14382
193 Ga0501045_0022968 3300049824 Bacteria 4470
194 Ga0495601_0000140 3300053077 Bacteria 40912
195 Ga0495601_0057833 3300053077 Bacteria 2456
196 Ga0495612_0000916 3300053078 Bacteria 12059
197 Ga0495619_0045181 3300053085 Bacteria 2894
198 Ga0500578_0141043 3300053086 Bacteria 1507
199 Ga0500566_0043863 3300053094 Bacteria 2576
200 Ga0500560_009858 3300053107 Bacteria 2366
201 Ga0500569_002185 3300053109 Bacteria 3818
202 Ga0500628_003113 3300053129 Bacteria 2730
203 Ga0500652_022176 3300053131 Bacteria 2401
204 Ga0500658_0051290 3300053134 Bacteria 1686
205 Ga0500573_0037021 3300053140 Bacteria 2818
206 Ga0500573_0143627 3300053140 Bacteria 1312
207 Ga0500579_049164 3300053143 Bacteria 2591
208 Ga0500600_0036077 3300053149 Bacteria 2876
209 Ga0500600_0106054 3300053149 Bacteria 1473
210 Ga0500616_0010520 3300053153 Bacteria 5531
211 Ga0500634_0004617 3300053161 Bacteria 6401
212 Ga0500656_000810 3300053732 Bacteria 2488
213 Ga0500587_003391 3300053739 Bacteria 2230
214 Ga0501084_0010518 3300054114 Bacteria 7650
215 Ga0466962_0046988 3300061719 Bacteria 2062
216 2515852979 2515154155 Bacteria 7985436
217 2643762570 2643221548 Bacteria 8053412
218 2644015441 2643221601 Bacteria 7493239
219 2644177960 2643221631 Bacteria 8168043
220 2644460479 2643221682 Bacteria 6743283
221 2644627613 2643221714 Bacteria 9015452
222 2676477611 2675903058 Bacteria 6822861
223 2729906376 2728369276 Bacteria 5610032
224 2785339945 2784746763 Bacteria 9783172
225 2816421270 2816332119 Bacteria 8120218
226 2816508318 2816332139 Bacteria 9138787
227 2819745931 2818991472 Bacteria 10089953
228 2827634473 2827628540 Bacteria 6858585
229 2861524187 2861520306 Bacteria 8348283
230 2862575619 2862574272 Bacteria 10567477
231 2863410015 2863404153 Bacteria 9672205
232 2867350144 2867346516 Bacteria 7608576
233 2870723282 2870721527 Bacteria 9689237
234 2877683873 2877676314 Bacteria 9512378
235 2883824375 2883821847 Bacteria 5121194
236 2912723045 2912715099 Bacteria 9460473
237 2947230845 2947224130 Bacteria 9938529
238 2966599031 2966598605 Bacteria 7676064
239 8048410908 8048406513 Bacteria 8936924
240 8056059062 8056054917 Bacteria 5736694
241 8057570924 8057568493 Bacteria 7221719
242 Ga0207647_10002247
243 JGI24740J21852_10047085
244 JGI24737J22298_10017381
245 JGI24737J22298_10057485
246 JGI24738J21930_10036061
247 JGI25406J46586_10010434
248 rootH1_10002558
249 rootH1_10101085
250 rootH2_10016277
251 rootH2_10028913
252 rootL2_10047713
253 rootL2_10061958
254 rootL2_10204835
255 rootH1_10012326
256 rootH1_10137819
257 Ga0068869_100349199
258 Ga0070660_100444653
259 Ga0070668_100000304
260 Ga0070659_100380547
261 Ga0070667_100121244
262 Ga0070710_10000021
263 Ga0068855_100007791
264 Ga0068855_100122216
265 Ga0068852_100038716
266 Ga0068864_100467104
267 Ga0068858_100213942
268 Ga0068860_100659782
269 Ga0081455_10086997
270 Ga0081539_10001268
271 Ga0105240_10117231
272 Ga0105243_10732841
273 Ga0105032_101452
274 Ga0105239_10319892
275 Ga0157372_10268467
276 Ga0182008_10000906
277 Ga0157376_10158529
278 Ga0182007_10000934
279 Ga0206351_10308767
280 Ga0206350_11061726
281 Ga0213875_10000083
282 Ga0224712_10010187
283 Ga0224712_10090182
284 Ga0207426_1005361
285 Ga0207692_10000259
286 Ga0207647_10048817
287 Ga0207664_10521506
288 Ga0207667_10181746
289 Ga0207712_10524968
290 Ga0207668_10001449
291 Ga0207677_10279872
292 Ga0268265_10291732
293 Ga0268264_10406980
294 Ga0307517_10018937
295 Ga0307515_10000547
296 Ga0307515_10025932
297 Ga0307515_10030416
298 Ga0307515_10116048
299 Ga0307511_10076459
300 Ga0307512_10006966
301 Ga0316177_1038782
302 Ga0316176_1147085
303 Ga0314311_1008091
304 Ga0316180_1029177
305 Ga0316180_1087387
306 Ga0316182_1067229
307 Ga0307513_10045710
308 Ga0307508_10011124
309 Ga0307508_10016947
310 Ga0307508_10022252
311 Ga0307508_10131901
312 Ga0307508_10381949
313 Ga0307514_10016305
314 Ga0307516_10000089
315 Ga0307516_10006718
316 Ga0307516_10100017
317 Ga0307411_10000275
318 Ga0307507_10105757
319 Ga0307510_10094527
320 Ga0307510_10124817
321 Ga0373942_0000149
322 Ga0373962_0000555
323 Ga0373925_0119810
324 Ga0395898_0029314
325 Ga0436364_0079644
326 Ga0439436_0011200
327 Ga0439436_0015563
328 Ga0439439_0002027
329 Ga0439466_0055245
330 Ga0451787_223998
331 Ga0451789_0555202
332 Ga0451791_1202860
333 Ga0451793_0896790
334 Ga0451793_1494376
335 Ga0451837_0559940
336 Ga0451839_1204954
337 Ga0451841_0714541
338 Ga0451853_3674208
339 Ga0439433_0012088
340 Ga0439449_0016105
341 Ga0439449_0079814
342 Ga0439449_0089122
343 Ga0439457_004702
344 Ga0439457_005923
345 Ga0450920_012995
346 Ga0450897_003921
347 Ga0450894_000485
348 Ga0450896_008410
349 Ga0450898_000093
350 Ga0450898_007726
351 Ga0450906_013008
352 Ga0439458_0023036
353 Ga0466969_0020318
354 Ga0466969_0042007
355 Ga0466969_0042953
356 Ga0466969_0043197
357 Ga0466972_0001544
358 Ga0466972_0009095
359 Ga0466965_0003089
360 Ga0466965_0007738
361 Ga0466965_0010194
362 Ga0466965_0021531
363 Ga0466965_0046767
364 Ga0466966_0003426
365 Ga0466961_0006091
366 Ga0466971_0000148
367 Ga0466968_0016270
368 Ga0466970_0007089
369 Ga0466970_0199440
370 Ga0466970_0233656
371 Ga0466960_0001693
372 Ga0466959_0000406
373 Ga0466958_0117466
374 Ga0466967_0126293
375 Ga0495627_015383
376 Ga0495592_0145494
377 Ga0495603_0008620
378 Ga0495603_0011803
379 Ga0495651_0000044
380 Ga0495651_0039690
381 Ga0495653_0056285
382 Ga0495664_0254991
383 Ga0495585_0122275
384 Ga0495594_0019277
385 Ga0495594_0109732
386 Ga0495618_0006589
387 Ga0495628_0001427
388 Ga0495628_0012323
389 Ga0495628_0413255
390 Ga0495643_0067313
391 Ga0495652_0004386
392 Ga0495652_0006810
393 Ga0495652_0083994
394 Ga0495586_0081433
395 Ga0495645_0087549
396 Ga0495645_0111784
397 Ga0495645_0133676
398 Ga0495611_0002873
399 Ga0495635_0001576
400 Ga0495623_0020006
401 Ga0495658_0078651
402 Ga0495613_0077567
403 Ga0495670_0038856
404 Ga0495589_0043634
405 Ga0495600_0012212
406 Ga0495600_0013576
407 Ga0495676_0002064
408 Ga0495676_0015455
409 Ga0495675_0164645
410 Ga0495685_000465
411 Ga0496108_0365935
412 Ga0501031_0000521
413 Ga0501032_0000558
414 Ga0501033_0007752
415 Ga0501034_0002738
416 Ga0501036_0001514
417 Ga0501037_0000606
418 Ga0501038_0000586
419 Ga0501039_0000805
420 Ga0501042_0020588
421 Ga0501043_0001867
422 Ga0501046_0001324
423 Ga0501047_0001582
424 Ga0501048_0001213
425 Ga0501068_0007333
426 Ga0501069_0003505
427 Ga0501070_0001896
428 Ga0501071_0009667
429 Ga0501074_0216925
430 Ga0501080_0001770
431 Ga0501083_0024929
432 Ga0501044_0005269
433 Ga0501045_0022968
434 Ga0495601_0000140
435 Ga0495601_0057833
436 Ga0495612_0000916
437 Ga0495619_0045181
438 Ga0500578_0141043
439 Ga0500566_0043863
440 Ga0500560_009858
441 Ga0500569_002185
442 Ga0500628_003113
443 Ga0500652_022176
444 Ga0500658_0051290
445 Ga0500573_0037021
446 Ga0500573_0143627
447 Ga0500579_049164
448 Ga0500600_0036077
449 Ga0500600_0106054
450 Ga0500616_0010520
451 Ga0500634_0004617
452 Ga0500656_000810
453 Ga0500587_003391
454 Ga0501084_0010518
455 Ga0466962_0046988
456 2515852979
457 2643762570
458 2644015441
459 2644177960
460 2644460479
461 2644627613
462 2676477611
463 2729906376
464 2785339945
465 2816421270
466 2816508318
467 2819745931
468 2827634473
469 2861524187
470 2862575619
471 2863410015
472 2867350144
473 2870723282
474 2877683873
475 2883824375
476 2912723045
477 2947230845
478 2966599031
479 8048410908
480 8056059062
481 8057570924

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05721

PhyH

Phytanoyl-CoA dioxygenase (PhyH)

55

229

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5erl-assembly1.cif.gz_A crystal structure of the epimerase snon in complex with ni2+, succinate and nogalamycin ro 0.7818 14 201
5nch-assembly1.cif.gz_A grie apo form 0.7786 9 201
4xca-assembly1.cif.gz_D crystal structure of hygx from streptomyces hygroscopicus with nickel and 2-oxoglutarate bound 0.7776 10 202
5ep9-assembly4.cif.gz_D crystal structure of the non-heme alpha ketoglutarate dependent epimerase snon from nogalamycin biosynthesis 0.7746 14 201
6s0r-assembly2.cif.gz_B the crystal structure of kanamycin b dioxygenase (kanj) from streptomyces kanamyceticus complex with nickel, sulfate and chloride 0.7731 15 200
ID Description Score Start End Superfamily
af_C7FZX0_9_206_2.60.120.620 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.7938 64 200 2.60.120.620
af_Q9DB26_1_291_2.60.120.620 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.7901 8 202 2.60.120.620
af_Q4D4M7_1_169_2.60.120.620 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.7746 96 198 2.60.120.620
4mhuB00 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.7712 14 211 2.60.120.620
af_A0A1D6Q4J3_1_128_2.60.120.620 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.7686 92 203 2.60.120.620
ID Description Score Start End GO Terms
AF-A0A7T7L2U3-F1-model_v4 Phytanoyl-CoA dioxygenase family protein 0.9495 9 273 GO:0051213
AF-A0A1H7Z4L5-F1-model_v4 Phytanoyl-CoA dioxygenase (PhyH) 0.9478 9 273 GO:0051213
AF-A0A2S4YV31-F1-model_v4 Phytanoyl-CoA dioxygenase 0.9467 9 273 GO:0051213
AF-A0A2E6SIS3-F1-model_v4 Phytanoyl-CoA dioxygenase 0.9449 3 265 GO:0005506
GO:0016706
AF-A0A2S4YV31-F1-model_v4 Phytanoyl-CoA dioxygenase 0.9433 9 273 GO:0051213

Map