F352902

General Info

Members Datasets Scaffolds Average Seq Length
240 159 480 276

Family's Representative Sequence

Representative Sequence 3300021384|Ga0213876_10003245|Ga0213876_100032453
Length 310
Sequence MNVPRAKPPTGYKRHITTDVNPNQLVATTGGSMPKFRKAHELLIEPGRTEKNYWGDLWRYRELFYILAWRDISVRYKQTAIGVLWALLRPFLAMVIFVVVFGRIAKMPSNGIPYPILVFSAMLPWQFFSSSLSEASTSLVGNANLISKIYFPRLIIPAGAVITSLVDFLISAALLGVLMIWLRFVPDWRLITLPLFTLLAFLAALGPGLLLAALTVKFRDFRYVIPFIVQFGLFISPVGFSSDVIPENWRLVYSLNPIVGVIDGFRWAICRGEAHIYAPGFILSVGIVGLFLLIGIRYFRNTEKTFADVI

Samples

Sample ID Description Type Environment
1 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
50 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
51 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
52 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
70 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
72 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
73 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
74 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
75 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
76 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
77 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
78 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
79 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
80 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
81 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
82 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
83 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
84 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
85 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
86 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
87 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
88 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
89 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
90 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
91 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
92 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
96 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
97 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
98 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
99 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
100 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
101 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
102 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
103 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
104 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
105 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
106 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
107 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
108 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
109 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
110 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
111 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
112 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
113 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
114 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
115 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
116 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
117 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
118 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
119 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
120 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
121 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
122 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
131 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
132 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
133 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
134 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
135 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
136 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
137 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
138 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
139 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
140 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
141 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
142 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
143 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
145 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
146 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
147 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
148 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
149 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
150 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
151 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
152 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
153 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
154 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
155 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
156 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
157 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
158 2913912277 Desmonostoc muscorum LEGE 12446 Isolate Unclassified
159 2913939268 Nostoc sp. LEGE 12447 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.17
Metatranscriptomes 0
Isolates 0.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.5
Nodule 0
Rhizoplane 0.42
Rhizosphere 87.92
Stem 0
Stem Tuber 0
Unclassified 15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213876_10003245 3300021384 Bacteria 9330
2 rootH2_10038943 3300003320 Unclassified 2276
3 rootH2_10056441 3300003320 Bacteria 3163
4 rootH2_10175112 3300003320 Bacteria 2141
5 rootL2_10354980 3300003322 Unclassified 1935
6 rootH1_10064251 3300003323 Bacteria 29046
7 rootH1_10279533 3300003323 Bacteria 3974
8 rootH1_10336301 3300003323 Bacteria 1582
9 Ga0070680_100012303 3300005336 Bacteria 6646
10 Ga0070689_100005458 3300005340 Bacteria 8684
11 Ga0070689_100030569 3300005340 Bacteria 4089
12 Ga0070689_100067047 3300005340 Unclassified 2797
13 Ga0070674_100008778 3300005356 Bacteria 6031
14 Ga0070688_100066291 3300005365 Bacteria 2297
15 Ga0070713_100005673 3300005436 Bacteria 8568
16 Ga0070708_100028169 3300005445 Bacteria 4831
17 Ga0070708_100061790 3300005445 Bacteria 3348
18 Ga0070681_10042472 3300005458 Bacteria 4556
19 Ga0070681_10078311 3300005458 Bacteria 3262
20 Ga0070681_10125714 3300005458 Bacteria 2497
21 Ga0070681_10252356 3300005458 Bacteria 1676
22 Ga0070706_100325772 3300005467 Unclassified 1433
23 Ga0070707_100021657 3300005468 Bacteria 6077
24 Ga0070707_100253491 3300005468 Bacteria 1712
25 Ga0070707_100292829 3300005468 Bacteria 1582
26 Ga0070698_100017573 3300005471 Bacteria 7538
27 Ga0070698_100096660 3300005471 Bacteria 2930
28 Ga0070698_100324859 3300005471 Bacteria 1470
29 Ga0070699_100040736 3300005518 Bacteria 4021
30 Ga0070699_100387556 3300005518 Bacteria 1262
31 Ga0070679_100264829 3300005530 Bacteria 1674
32 Ga0070684_100167134 3300005535 Bacteria 1997
33 Ga0070697_100232316 3300005536 Bacteria 1573
34 Ga0068853_100000539 3300005539 Bacteria 25719
35 Ga0068855_100010383 3300005563 Bacteria 11234
36 Ga0068855_100025784 3300005563 Bacteria 7030
37 Ga0068855_100503939 3300005563 Bacteria 1315
38 Ga0068857_100131602 3300005577 Bacteria 2256
39 Ga0068857_100752819 3300005577 Bacteria 928
40 Ga0068856_100078489 3300005614 Bacteria 3273
41 Ga0068852_100280116 3300005616 Bacteria 1607
42 Ga0068859_100094821 3300005617 Bacteria 3037
43 Ga0068859_100604072 3300005617 Unclassified 1190
44 Ga0081455_10010393 3300005937 Bacteria 9455
45 Ga0081455_10036304 3300005937 Bacteria 4390
46 Ga0081539_10002218 3300005985 Bacteria 28319
47 Ga0070717_10015482 3300006028 Bacteria 5892
48 Ga0068871_100483203 3300006358 Bacteria 1114
49 Ga0075428_100196333 3300006844 Bacteria 2182
50 Ga0075430_100137009 3300006846 Bacteria 2039
51 Ga0075430_100242178 3300006846 Bacteria 1494
52 Ga0075431_100140613 3300006847 Bacteria 2488
53 Ga0097620_100094822 3300006931 Bacteria 3037
54 Ga0097620_100604030 3300006931 Unclassified 1190
55 Ga0075435_100366420 3300007076 Bacteria 1237
56 Ga0105240_10000226 3300009093 Bacteria 112655
57 Ga0105240_10024870 3300009093 Bacteria 7883
58 Ga0105240_10046590 3300009093 Bacteria 5493
59 Ga0105240_10072317 3300009093 Bacteria 4262
60 Ga0111539_10067107 3300009094 Bacteria 4237
61 Ga0114129_10146997 3300009147 Bacteria 3228
62 Ga0105241_10195472 3300009174 Unclassified 1686
63 Ga0105241_10435174 3300009174 Bacteria 1157
64 Ga0105237_10013668 3300009545 Bacteria 8502
65 Ga0105237_10102027 3300009545 Bacteria 2861
66 Ga0105238_10002776 3300009551 Bacteria 17473
67 Ga0105238_10006147 3300009551 Bacteria 11919
68 Ga0105238_10030315 3300009551 Bacteria 5505
69 Ga0105238_10134101 3300009551 Bacteria 2454
70 Ga0105249_10029392 3300009553 Unclassified 4963
71 Ga0105239_10029890 3300010375 Bacteria 5992
72 Ga0105239_10216471 3300010375 Unclassified 2148
73 Ga0105239_10549306 3300010375 Bacteria 1315
74 Ga0157370_10214454 3300013104 Bacteria 1784
75 Ga0157369_10005840 3300013105 Bacteria 14306
76 Ga0157369_10025761 3300013105 Bacteria 6525
77 Ga0157374_10202570 3300013296 Bacteria 1944
78 Ga0163162_10000151 3300013306 Bacteria 64454
79 Ga0163162_10000834 3300013306 Bacteria 28679
80 Ga0163162_10103036 3300013306 Bacteria 2948
81 Ga0163162_10186067 3300013306 Bacteria 2204
82 Ga0157375_10000006 3300013308 Bacteria 384086
83 Ga0163163_10000153 3300014325 Bacteria 71877
84 Ga0163163_10039701 3300014325 Bacteria 4595
85 Ga0157379_10073823 3300014968 Unclassified 3053
86 Ga0157379_10318385 3300014968 Bacteria 1420
87 Ga0163161_10052311 3300017792 Unclassified 2960
88 Ga0213872_10020123 3300021361 Bacteria 3075
89 Ga0213872_10113044 3300021361 Unclassified 1205
90 Ga0213876_10002530 3300021384 Bacteria 10702
91 Ga0213871_10024350 3300021441 Bacteria 1532
92 Ga0213871_10037798 3300021441 Unclassified 1286
93 Ga0207692_10069116 3300025898 Unclassified 1855
94 Ga0207695_10000313 3300025913 Bacteria 117072
95 Ga0207695_10033382 3300025913 Bacteria 5614
96 Ga0207695_10034626 3300025913 Bacteria 5488
97 Ga0207695_10276217 3300025913 Unclassified 1575
98 Ga0207695_10301431 3300025913 Unclassified 1494
99 Ga0207660_10058853 3300025917 Bacteria 2756
100 Ga0207657_10103310 3300025919 Bacteria 2362
101 Ga0207652_10030381 3300025921 Bacteria 4524
102 Ga0207652_10133271 3300025921 Bacteria 2217
103 Ga0207646_10004105 3300025922 Bacteria 16042
104 Ga0207646_10021970 3300025922 Bacteria 5886
105 Ga0207646_10496587 3300025922 Unclassified 1100
106 Ga0207694_10020388 3300025924 Bacteria 5016
107 Ga0207694_10034591 3300025924 Bacteria 3875
108 Ga0207694_10041939 3300025924 Bacteria 3528
109 Ga0207694_10099844 3300025924 Bacteria 2299
110 Ga0207700_10065071 3300025928 Bacteria 2780
111 Ga0207670_10049963 3300025936 Unclassified 2800
112 Ga0207670_10124292 3300025936 Bacteria 1880
113 Ga0207689_10282426 3300025942 Bacteria 1375
114 Ga0207667_10007796 3300025949 Bacteria 12797
115 Ga0207667_10030876 3300025949 Bacteria 5790
116 Ga0207667_10312278 3300025949 Bacteria 1606
117 Ga0207712_10025074 3300025961 Unclassified 3958
118 Ga0207639_10006585 3300026041 Bacteria 7898
119 Ga0207702_10274862 3300026078 Bacteria 1590
120 Ga0207674_10011071 3300026116 Bacteria 10143
121 Ga0207674_10767615 3300026116 Bacteria 930
122 Ga0207675_100256818 3300026118 Bacteria 1693
123 Ga0207698_10174981 3300026142 Bacteria 1894
124 Ga0207428_10004064 3300027907 Bacteria 14028
125 Ga0268266_10308496 3300028379 Bacteria 1478
126 Ga0307515_10001093 3300028794 Bacteria 62142
127 Ga0265338_10273310 3300028800 Unclassified 1238
128 Ga0265329_10085966 3300031242 Unclassified 997
129 Ga0265327_10000514 3300031251 Bacteria 66685
130 Ga0265327_10000735 3300031251 Bacteria 51211
131 Ga0265316_10000222 3300031344 Bacteria 66528
132 Ga0307408_100000810 3300031548 Bacteria 25013
133 Ga0307514_10186093 3300031649 Unclassified 1331
134 Ga0307405_10255406 3300031731 Bacteria 1306
135 Ga0307406_10147863 3300031901 Bacteria 1672
136 Ga0307412_10002488 3300031911 Bacteria 10259
137 Ga0307412_10014151 3300031911 Unclassified 4698
138 Ga0307409_100100915 3300031995 Bacteria 2393
139 Ga0307414_10542962 3300032004 Bacteria 1035
140 Ga0307415_100103750 3300032126 Bacteria 2093
141 Ga0307510_10002707 3300033180 Bacteria 20249
142 Ga0373923_0038936 3300035111 Bacteria 1950
143 Ga0373956_0058010 3300035119 Bacteria 1750
144 Ga0373955_0010804 3300035172 Bacteria 4329
145 Ga0373927_0021637 3300035695 Unclassified 4216
146 Ga0373933_0015632 3300035724 Bacteria 4233
147 Ga0373937_0004642 3300036401 Bacteria 11665
148 Ga0316582_0059325 3300036647 Bacteria 2450
149 Ga0373925_0063381 3300037068 Unclassified 2781
150 Ga0395899_0031262 3300037312 Bacteria 4002
151 Ga0395898_0068453 3300037466 Bacteria 3435
152 Ga0395898_0496260 3300037466 Unclassified 1161
153 Ga0436364_1354739 3300037853 Bacteria 3931
154 Ga0395901_0072869 3300038443 Bacteria 3581
155 Ga0436365_0397642 3300039437 Bacteria 11934
156 Ga0436365_1047973 3300039437 Bacteria 60576
157 Ga0436365_1718574 3300039437 Unclassified 1305
158 Ga0436360_0116530 3300039438 Bacteria 1482
159 Ga0436360_0443683 3300039438 Bacteria 1339
160 Ga0436360_0747772 3300039438 Unclassified 2690
161 Ga0436360_1343778 3300039438 Bacteria 2130
162 Ga0436361_0033945 3300039447 Bacteria 2377
163 Ga0436361_0039481 3300039447 Bacteria 11428
164 Ga0436361_0252506 3300039447 Bacteria 13984
165 Ga0436361_0975938 3300039447 Bacteria 4455
166 Ga0436361_0991173 3300039447 Bacteria 1328
167 Ga0436361_1045855 3300039447 Bacteria 1707
168 Ga0436363_1361073 3300039450 Unclassified 1185
169 Ga0436362_0032231 3300039453 Bacteria 1247
170 Ga0451577_0000134 3300042876 Bacteria 165856
171 Ga0451577_0299483 3300042876 Bacteria 1457
172 Ga0466964_0066942 3300044706 Unclassified 1509
173 Ga0453684_0000426 3300044712 Bacteria 172005
174 Ga0453684_0009353 3300044712 Bacteria 17175
175 Ga0453684_0031499 3300044712 Bacteria 7451
176 Ga0453684_0034702 3300044712 Bacteria 6992
177 Ga0453684_0088858 3300044712 Bacteria 3824
178 Ga0453684_0131332 3300044712 Bacteria 3004
179 Ga0453684_0379183 3300044712 Bacteria 1588
180 Ga0451576_0077822 3300045051 Bacteria 3452
181 Ga0495641_0110117 3300046461 Bacteria 1229
182 Ga0495653_0266575 3300046463 Unclassified 1130
183 Ga0495608_0365817 3300046511 Bacteria 886
184 Ga0495630_0000305 3300046517 Bacteria 39378
185 Ga0495586_0000271 3300046535 Bacteria 33410
186 Ga0495634_0070397 3300046642 Bacteria 2306
187 Ga0495623_0129577 3300046679 Bacteria 1512
188 Ga0495674_0000767 3300047319 Bacteria 30476
189 Ga0495672_0201027 3300047320 Bacteria 996
190 Ga0495676_0091065 3300047321 Bacteria 2281
191 Ga0495680_0139366 3300047322 Bacteria 1776
192 Ga0495602_0156923 3300048088 Bacteria 1781
193 Ga0496109_0000017 3300048912 Bacteria 200904
194 Ga0496122_0002799 3300048925 Bacteria 23967
195 Ga0496123_0000689 3300048926 Bacteria 55748
196 Ga0496124_0000385 3300048927 Bacteria 80586
197 Ga0501032_0047859 3300049569 Bacteria 2887
198 Ga0501034_0005603 3300049571 Bacteria 13677
199 Ga0501036_0003080 3300049572 Bacteria 13296
200 Ga0501038_0023546 3300049574 Bacteria 5504
201 Ga0501043_0000552 3300049579 Bacteria 33516
202 Ga0501046_0001254 3300049580 Bacteria 24556
203 Ga0501047_0001218 3300049581 Bacteria 25507
204 Ga0501048_0002570 3300049582 Bacteria 13892
205 Ga0501073_0000922 3300049589 Bacteria 21190
206 Ga0501074_0002261 3300049590 Bacteria 13392
207 Ga0501074_0368106 3300049590 Bacteria 1020
208 Ga0501217_008566 3300049661 Bacteria 2212
209 Ga0501235_002247 3300049669 Unclassified 4154
210 Ga0501243_017982 3300049675 Bacteria 1149
211 Ga0501249_023638 3300049679 Bacteria 1350
212 Ga0501257_040607 3300049686 Bacteria 1142
213 Ga0501258_002609 3300049687 Bacteria 1597
214 Ga0501259_017837 3300049688 Unclassified 1234
215 Ga0501221_008525 3300049704 Unclassified 1783
216 Ga0501080_0000977 3300049742 Bacteria 23417
217 Ga0501083_0025600 3300049744 Bacteria 4084
218 Ga0501274_001645 3300049771 Bacteria 1718
219 Ga0501035_0004468 3300049822 Bacteria 13275
220 Ga0501045_0060312 3300049824 Bacteria 2781
221 nmdc:mga05p37_111357_c1 3300050507 Bacteria 3367
222 nmdc:mga05p37_121615_c1 3300050507 Bacteria 3206
223 nmdc:mga0qj67_226797_c1 3300050509 Bacteria 1516
224 nmdc:mga06r32_137004_c1 3300050510 Bacteria 2423
225 nmdc:mga06r32_152358_c1 3300050510 Unclassified 2291
226 nmdc:mga06r32_201340_c1 3300050510 Bacteria 1979
227 nmdc:mga06r32_268736_c1 3300050510 Bacteria 1693
228 nmdc:mga08y16_14520_c1 3300050511 Bacteria 8287
229 nmdc:mga0rr50_291161_c1 3300050513 Bacteria 1364
230 nmdc:mga0a205_250532_c1 3300050515 Bacteria 1650
231 Ga0495601_0078483 3300053077 Unclassified 2116
232 Ga0500610_0131553 3300053079 Bacteria 1272
233 Ga0495619_0145569 3300053085 Bacteria 1633
234 Ga0500641_0002423 3300053096 Bacteria 6618
235 Ga0500641_0114393 3300053096 Bacteria 1162
236 Ga0500650_0127492 3300053098 Bacteria 1184
237 Ga0500562_036904 3300053108 Bacteria 1297
238 Ga0500616_0004434 3300053153 Bacteria 10007
239 2913916825 2913912277 Bacteria 9037797
240 2913940591 2913939268 Bacteria 8559644
241 Ga0213876_10003245
242 rootH2_10038943
243 rootH2_10056441
244 rootH2_10175112
245 rootL2_10354980
246 rootH1_10064251
247 rootH1_10279533
248 rootH1_10336301
249 Ga0070680_100012303
250 Ga0070689_100005458
251 Ga0070689_100030569
252 Ga0070689_100067047
253 Ga0070674_100008778
254 Ga0070688_100066291
255 Ga0070713_100005673
256 Ga0070708_100028169
257 Ga0070708_100061790
258 Ga0070681_10042472
259 Ga0070681_10078311
260 Ga0070681_10125714
261 Ga0070681_10252356
262 Ga0070706_100325772
263 Ga0070707_100021657
264 Ga0070707_100253491
265 Ga0070707_100292829
266 Ga0070698_100017573
267 Ga0070698_100096660
268 Ga0070698_100324859
269 Ga0070699_100040736
270 Ga0070699_100387556
271 Ga0070679_100264829
272 Ga0070684_100167134
273 Ga0070697_100232316
274 Ga0068853_100000539
275 Ga0068855_100010383
276 Ga0068855_100025784
277 Ga0068855_100503939
278 Ga0068857_100131602
279 Ga0068857_100752819
280 Ga0068856_100078489
281 Ga0068852_100280116
282 Ga0068859_100094821
283 Ga0068859_100604072
284 Ga0081455_10010393
285 Ga0081455_10036304
286 Ga0081539_10002218
287 Ga0070717_10015482
288 Ga0068871_100483203
289 Ga0075428_100196333
290 Ga0075430_100137009
291 Ga0075430_100242178
292 Ga0075431_100140613
293 Ga0097620_100094822
294 Ga0097620_100604030
295 Ga0075435_100366420
296 Ga0105240_10000226
297 Ga0105240_10024870
298 Ga0105240_10046590
299 Ga0105240_10072317
300 Ga0111539_10067107
301 Ga0114129_10146997
302 Ga0105241_10195472
303 Ga0105241_10435174
304 Ga0105237_10013668
305 Ga0105237_10102027
306 Ga0105238_10002776
307 Ga0105238_10006147
308 Ga0105238_10030315
309 Ga0105238_10134101
310 Ga0105249_10029392
311 Ga0105239_10029890
312 Ga0105239_10216471
313 Ga0105239_10549306
314 Ga0157370_10214454
315 Ga0157369_10005840
316 Ga0157369_10025761
317 Ga0157374_10202570
318 Ga0163162_10000151
319 Ga0163162_10000834
320 Ga0163162_10103036
321 Ga0163162_10186067
322 Ga0157375_10000006
323 Ga0163163_10000153
324 Ga0163163_10039701
325 Ga0157379_10073823
326 Ga0157379_10318385
327 Ga0163161_10052311
328 Ga0213872_10020123
329 Ga0213872_10113044
330 Ga0213876_10002530
331 Ga0213871_10024350
332 Ga0213871_10037798
333 Ga0207692_10069116
334 Ga0207695_10000313
335 Ga0207695_10033382
336 Ga0207695_10034626
337 Ga0207695_10276217
338 Ga0207695_10301431
339 Ga0207660_10058853
340 Ga0207657_10103310
341 Ga0207652_10030381
342 Ga0207652_10133271
343 Ga0207646_10004105
344 Ga0207646_10021970
345 Ga0207646_10496587
346 Ga0207694_10020388
347 Ga0207694_10034591
348 Ga0207694_10041939
349 Ga0207694_10099844
350 Ga0207700_10065071
351 Ga0207670_10049963
352 Ga0207670_10124292
353 Ga0207689_10282426
354 Ga0207667_10007796
355 Ga0207667_10030876
356 Ga0207667_10312278
357 Ga0207712_10025074
358 Ga0207639_10006585
359 Ga0207702_10274862
360 Ga0207674_10011071
361 Ga0207674_10767615
362 Ga0207675_100256818
363 Ga0207698_10174981
364 Ga0207428_10004064
365 Ga0268266_10308496
366 Ga0307515_10001093
367 Ga0265338_10273310
368 Ga0265329_10085966
369 Ga0265327_10000514
370 Ga0265327_10000735
371 Ga0265316_10000222
372 Ga0307408_100000810
373 Ga0307514_10186093
374 Ga0307405_10255406
375 Ga0307406_10147863
376 Ga0307412_10002488
377 Ga0307412_10014151
378 Ga0307409_100100915
379 Ga0307414_10542962
380 Ga0307415_100103750
381 Ga0307510_10002707
382 Ga0373923_0038936
383 Ga0373956_0058010
384 Ga0373955_0010804
385 Ga0373927_0021637
386 Ga0373933_0015632
387 Ga0373937_0004642
388 Ga0316582_0059325
389 Ga0373925_0063381
390 Ga0395899_0031262
391 Ga0395898_0068453
392 Ga0395898_0496260
393 Ga0436364_1354739
394 Ga0395901_0072869
395 Ga0436365_0397642
396 Ga0436365_1047973
397 Ga0436365_1718574
398 Ga0436360_0116530
399 Ga0436360_0443683
400 Ga0436360_0747772
401 Ga0436360_1343778
402 Ga0436361_0033945
403 Ga0436361_0039481
404 Ga0436361_0252506
405 Ga0436361_0975938
406 Ga0436361_0991173
407 Ga0436361_1045855
408 Ga0436363_1361073
409 Ga0436362_0032231
410 Ga0451577_0000134
411 Ga0451577_0299483
412 Ga0466964_0066942
413 Ga0453684_0000426
414 Ga0453684_0009353
415 Ga0453684_0031499
416 Ga0453684_0034702
417 Ga0453684_0088858
418 Ga0453684_0131332
419 Ga0453684_0379183
420 Ga0451576_0077822
421 Ga0495641_0110117
422 Ga0495653_0266575
423 Ga0495608_0365817
424 Ga0495630_0000305
425 Ga0495586_0000271
426 Ga0495634_0070397
427 Ga0495623_0129577
428 Ga0495674_0000767
429 Ga0495672_0201027
430 Ga0495676_0091065
431 Ga0495680_0139366
432 Ga0495602_0156923
433 Ga0496109_0000017
434 Ga0496122_0002799
435 Ga0496123_0000689
436 Ga0496124_0000385
437 Ga0501032_0047859
438 Ga0501034_0005603
439 Ga0501036_0003080
440 Ga0501038_0023546
441 Ga0501043_0000552
442 Ga0501046_0001254
443 Ga0501047_0001218
444 Ga0501048_0002570
445 Ga0501073_0000922
446 Ga0501074_0002261
447 Ga0501074_0368106
448 Ga0501217_008566
449 Ga0501235_002247
450 Ga0501243_017982
451 Ga0501249_023638
452 Ga0501257_040607
453 Ga0501258_002609
454 Ga0501259_017837
455 Ga0501221_008525
456 Ga0501080_0000977
457 Ga0501083_0025600
458 Ga0501274_001645
459 Ga0501035_0004468
460 Ga0501045_0060312
461 nmdc:mga05p37_111357_c1
462 nmdc:mga05p37_121615_c1
463 nmdc:mga0qj67_226797_c1
464 nmdc:mga06r32_137004_c1
465 nmdc:mga06r32_152358_c1
466 nmdc:mga06r32_201340_c1
467 nmdc:mga06r32_268736_c1
468 nmdc:mga08y16_14520_c1
469 nmdc:mga0rr50_291161_c1
470 nmdc:mga0a205_250532_c1
471 Ga0495601_0078483
472 Ga0500610_0131553
473 Ga0495619_0145569
474 Ga0500641_0002423
475 Ga0500641_0114393
476 Ga0500650_0127492
477 Ga0500562_036904
478 Ga0500616_0004434
479 2913916825
480 2913940591

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01061

ABC2_membrane

ABC-2 type transporter

62

270

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7k2t-assembly1.cif.gz_B mg2+/atp-bound structure of the full-length wzmwzt o antigen abc transporter in lipid nanodiscs 0.8982 29 277
8dku-assembly1.cif.gz_B cryoem structure of the a. aeolicus wzmwzt transporter bound to the native o antigen 0.8939 29 275
7k2t-assembly1.cif.gz_B mg2+/atp-bound structure of the full-length wzmwzt o antigen abc transporter in lipid nanodiscs 0.8882 29 277
8dku-assembly1.cif.gz_B cryoem structure of the a. aeolicus wzmwzt transporter bound to the native o antigen 0.8646 29 275
6m96-assembly1.cif.gz_B-2 atp-bound conformation of the wzmwzt o antigen abc transporter 0.8524 29 277
ID Description Score Start End Superfamily
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6702 74 265 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6652 74 265 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6061 74 263 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.4904 74 265 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.4899 74 265 3.40.1710.10
ID Description Score Start End GO Terms
AF-A0A1F2ZW44-F1-model_v4 Transport permease protein 0.9776 36 277 GO:0005886
GO:0015920
GO:0140359
AF-A0A017HNL4-F1-model_v4 O-antigen export system, permease protein 0.9767 55 277 GO:0015920
GO:0016020
GO:0140359
AF-A0A7C9BN38-F1-model_v4 Transport permease protein 0.9751 9 277 GO:0005886
GO:0015920
GO:0140359
AF-A0A2V9SZP2-F1-model_v4 Phosphate ABC transporter permease 0.9739 64 277 GO:0015920
GO:0016020
GO:0140359
AF-A0A2V8S0D6-F1-model_v4 Transport permease protein 0.972 22 277 GO:0015920
GO:0043190
GO:0140359

Map