F352850

General Info

Members Datasets Scaffolds Average Seq Length
240 169 232 175

Family's Representative Sequence

Representative Sequence 3300011119|Ga0105246_10546656|Ga0105246_105466562
Length 205
Sequence LSDFSFAPFRVSRKNYNAQNRQHQEGGSNMRQIIFLLFAAATLAGVVGFTATASRHVDEEAAPIFVKEIPAGYRDWRLVSVAHEEGNLMDIRAILGNDIAINTYRAGKLPFPEGAIIGRIAWSHVPSEENNKIFGREQSFVPGAEPPWYLQFMVKDSKKYAATGGWGYAQFDKDGKPGPESDLKKCFPCHQAIKDRDFVFTRYTP

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
4 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
5 2791355265 Rhizobium sp. H4 Isolate Nodule
6 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
7 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
8 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
9 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
88 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
90 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
91 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
92 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
93 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
94 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
95 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
96 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
97 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
101 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
102 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
103 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
104 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
105 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
109 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
110 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
111 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
112 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
113 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
114 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
115 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
116 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
117 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
118 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
119 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
120 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
121 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
122 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
123 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
124 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
125 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
126 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
127 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
128 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
130 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
131 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
132 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
133 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
134 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
135 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
136 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
137 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
138 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
139 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
140 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
141 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
142 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
143 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
144 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
145 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
146 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
147 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
148 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
149 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
150 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
151 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
152 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
153 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
154 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
155 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
156 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
157 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
158 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
159 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
160 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
161 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
162 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
164 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
165 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
166 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
167 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
168 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
169 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.08
Metatranscriptomes 0
Isolates 2.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.67
Nodule 2.08
Rhizoplane 1.67
Rhizosphere 90.83
Stem 0
Stem Tuber 0
Unclassified 3.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_271530 2162886007 Unclassified 843
2 MBSR1b_contig_9262352 2162886012 Bacteria 1120
3 JGI25151J46595_10015912 3300003187 Bacteria 3301
4 rootH2_10104012 3300003320 Bacteria 2775
5 rootH2_10189632 3300003320 Bacteria 1408
6 Ga0065704_10149627 3300005289 Bacteria 1440
7 Ga0065715_10106933 3300005293 Bacteria 2800
8 Ga0065715_10225581 3300005293 Bacteria 1187
9 Ga0070690_100347472 3300005330 Bacteria 1076
10 Ga0070670_100014728 3300005331 Bacteria 6715
11 Ga0070670_100226609 3300005331 Bacteria 1626
12 Ga0068869_100210362 3300005334 Bacteria 1537
13 Ga0068868_100642321 3300005338 Unclassified 944
14 Ga0070689_100000373 3300005340 Bacteria 26382
15 Ga0070692_10638031 3300005345 Unclassified 709
16 Ga0070669_100118553 3300005353 Bacteria 2016
17 Ga0070671_100286690 3300005355 Bacteria 1401
18 Ga0070673_100183871 3300005364 Bacteria 1790
19 Ga0070673_100474713 3300005364 Bacteria 1128
20 Ga0070709_10000170 3300005434 Bacteria 41030
21 Ga0070700_100000056 3300005441 Bacteria 83455
22 Ga0070708_100019869 3300005445 Bacteria 5652
23 Ga0070707_100225549 3300005468 Bacteria 1824
24 Ga0070698_100010465 3300005471 Bacteria 9898
25 Ga0070699_100103764 3300005518 Bacteria 2493
26 Ga0070699_100131159 3300005518 Bacteria 2209
27 Ga0070697_100007529 3300005536 Bacteria 8474
28 Ga0070697_100050270 3300005536 Bacteria 3383
29 Ga0070697_100379504 3300005536 Bacteria 1224
30 Ga0070695_100505376 3300005545 Bacteria 935
31 Ga0068855_100420367 3300005563 Bacteria 1462
32 Ga0068857_100263461 3300005577 Bacteria 1582
33 Ga0068857_101190301 3300005577 Bacteria 738
34 Ga0068854_100602048 3300005578 Bacteria 938
35 Ga0068856_100234915 3300005614 Bacteria 1849
36 Ga0068859_100005324 3300005617 Bacteria 13085
37 Ga0068859_100316762 3300005617 Unclassified 1654
38 Ga0068859_100674766 3300005617 Bacteria 1125
39 Ga0068859_100965928 3300005617 Bacteria 935
40 Ga0068864_100034314 3300005618 Bacteria 4315
41 Ga0068864_100728286 3300005618 Unclassified 971
42 Ga0068864_101063930 3300005618 Unclassified 804
43 Ga0068864_101557695 3300005618 Unclassified 664
44 Ga0068870_10099685 3300005840 Bacteria 1639
45 Ga0068863_100013527 3300005841 Bacteria 7872
46 Ga0068863_100427596 3300005841 Bacteria 1298
47 Ga0068862_100084320 3300005844 Bacteria 2760
48 Ga0097621_100080849 3300006237 Bacteria 2704
49 Ga0097621_100122382 3300006237 Bacteria 2208
50 Ga0068871_100307617 3300006358 Bacteria 1393
51 Ga0068871_100577276 3300006358 Unclassified 1020
52 Ga0075428_100227103 3300006844 Bacteria 2015
53 Ga0075428_100920205 3300006844 Bacteria 927
54 Ga0075430_100052082 3300006846 Bacteria 3447
55 Ga0075431_100033301 3300006847 Bacteria 5310
56 Ga0075431_100060195 3300006847 Unclassified 3919
57 Ga0075431_100142952 3300006847 Bacteria 2466
58 Ga0075434_100127336 3300006871 Bacteria 2563
59 Ga0075434_100131269 3300006871 Bacteria 2524
60 Ga0075429_100225935 3300006880 Bacteria 1639
61 Ga0075429_100333963 3300006880 Bacteria 1327
62 Ga0075436_100397880 3300006914 Bacteria 998
63 Ga0097620_100005324 3300006931 Bacteria 13085
64 Ga0097620_100316771 3300006931 Unclassified 1654
65 Ga0097620_100674754 3300006931 Bacteria 1125
66 Ga0097620_100966017 3300006931 Bacteria 935
67 Ga0111539_10015321 3300009094 Bacteria 9549
68 Ga0105245_11717306 3300009098 Bacteria 680
69 Ga0105247_10088235 3300009101 Unclassified 1965
70 Ga0105247_10118277 3300009101 Bacteria 1714
71 Ga0114129_10002308 3300009147 Bacteria 26441
72 Ga0114129_10016240 3300009147 Bacteria 10594
73 Ga0114129_10089796 3300009147 Bacteria 4259
74 Ga0114129_10435695 3300009147 Bacteria 1721
75 Ga0105243_10121289 3300009148 Bacteria 2204
76 Ga0105241_10261846 3300009174 Unclassified 1470
77 Ga0105241_10334926 3300009174 Bacteria 1309
78 Ga0105248_10006886 3300009177 Bacteria 12458
79 Ga0105248_10061297 3300009177 Bacteria 4223
80 Ga0105238_11850597 3300009551 Unclassified 636
81 Ga0105249_10003449 3300009553 Bacteria 13698
82 Ga0105249_10035523 3300009553 Bacteria 4520
83 Ga0105249_10041287 3300009553 Bacteria 4193
84 Ga0105239_10748094 3300010375 Bacteria 1119
85 Ga0105246_10128349 3300011119 Bacteria 1890
86 Ga0105246_10546656 3300011119 Unclassified 992
87 Ga0163162_11277581 3300013306 Bacteria 834
88 Ga0163163_10588930 3300014325 Bacteria 1175
89 Ga0157380_10125680 3300014326 Bacteria 2179
90 Ga0157379_10397738 3300014968 Bacteria 1266
91 Ga0209675_1038794 3300025291 Bacteria 1059
92 Ga0207647_10163651 3300025904 Bacteria 1297
93 Ga0207643_10001057 3300025908 Bacteria 16287
94 Ga0207654_10632945 3300025911 Unclassified 765
95 Ga0207646_10028476 3300025922 Bacteria 5084
96 Ga0207650_10009811 3300025925 Bacteria 6548
97 Ga0207644_10025508 3300025931 Bacteria 4065
98 Ga0207709_10336210 3300025935 Bacteria 1135
99 Ga0207670_10000235 3300025936 Bacteria 35073
100 Ga0207711_10024788 3300025941 Bacteria 5032
101 Ga0207689_11189015 3300025942 Unclassified 642
102 Ga0207679_11636593 3300025945 Unclassified 590
103 Ga0207667_11394821 3300025949 Bacteria 674
104 Ga0207651_10296407 3300025960 Bacteria 1343
105 Ga0207640_10230929 3300025981 Bacteria 1423
106 Ga0207677_10454150 3300026023 Unclassified 1099
107 Ga0207708_10000089 3300026075 Bacteria 72013
108 Ga0207708_10256842 3300026075 Bacteria 1409
109 Ga0207702_10070626 3300026078 Bacteria 3004
110 Ga0207641_10079177 3300026088 Bacteria 2848
111 Ga0207641_10613617 3300026088 Bacteria 1066
112 Ga0207648_10616876 3300026089 Bacteria 1001
113 Ga0207676_10016989 3300026095 Bacteria 5269
114 Ga0207676_10332375 3300026095 Bacteria 1399
115 Ga0207676_10791374 3300026095 Bacteria 925
116 Ga0207674_10100568 3300026116 Bacteria 2873
117 Ga0207674_10868757 3300026116 Unclassified 869
118 Ga0207674_10978447 3300026116 Bacteria 815
119 Ga0207683_10789804 3300026121 Unclassified 881
120 Ga0207428_10101765 3300027907 Bacteria 2219
121 Ga0268265_10080806 3300028380 Bacteria 2565
122 Ga0307515_10161147 3300028794 Bacteria 2287
123 Ga0265338_10000707 3300028800 Bacteria 56945
124 Ga0307408_100007719 3300031548 Bacteria 7116
125 Ga0307408_100227076 3300031548 Bacteria 1527
126 Ga0307408_100293054 3300031548 Bacteria 1360
127 Ga0307408_100320808 3300031548 Bacteria 1305
128 Ga0307405_10017349 3300031731 Bacteria 3948
129 Ga0307413_10012612 3300031824 Bacteria 4212
130 Ga0307413_10049728 3300031824 Bacteria 2514
131 Ga0307410_10045718 3300031852 Bacteria 2917
132 Ga0307410_10319819 3300031852 Bacteria 1231
133 Ga0307406_10000928 3300031901 Bacteria 16346
134 Ga0307406_10339880 3300031901 Bacteria 1169
135 Ga0307407_10029108 3300031903 Bacteria 2963
136 Ga0307407_10051771 3300031903 Bacteria 2355
137 Ga0307412_10029624 3300031911 Bacteria 3437
138 Ga0307412_10205558 3300031911 Bacteria 1498
139 Ga0307409_100273103 3300031995 Bacteria 1558
140 Ga0307416_100051725 3300032002 Bacteria 3283
141 Ga0307416_100184681 3300032002 Bacteria 1958
142 Ga0307414_10003850 3300032004 Bacteria 8072
143 Ga0307414_10902382 3300032004 Bacteria 810
144 Ga0307414_11064788 3300032004 Bacteria 746
145 Ga0307411_10041172 3300032005 Bacteria 2937
146 Ga0307415_100001804 3300032126 Bacteria 10486
147 Ga0307415_100046357 3300032126 Bacteria 2919
148 Ga0307415_100608065 3300032126 Bacteria 974
149 Ga0373951_0047088 3300035091 Bacteria 1053
150 Ga0373952_0020619 3300035092 Bacteria 1383
151 Ga0373931_0505276 3300035691 Unclassified 780
152 Ga0373937_0196456 3300036401 Bacteria 1896
153 Ga0395900_0457433 3300037418 Bacteria 1232
154 Ga0395901_1153428 3300038443 Bacteria 743
155 Ga0495585_0407987 3300046492 Bacteria 654
156 Ga0495618_0205380 3300046514 Bacteria 1246
157 Ga0495587_0209811 3300046536 Bacteria 1100
158 Ga0495635_0030455 3300046663 Bacteria 3750
159 Ga0495646_0107919 3300046680 Bacteria 1588
160 Ga0495674_0641453 3300047319 Bacteria 838
161 Ga0495680_0464912 3300047322 Bacteria 864
162 Ga0496102_0429726 3300048905 Bacteria 1240
163 Ga0496110_0538185 3300048913 Bacteria 1062
164 Ga0496112_1041964 3300048915 Bacteria 737
165 Ga0496113_0059422 3300048916 Bacteria 2880
166 Ga0496120_0001160 3300048923 Bacteria 33739
167 Ga0496122_0000002 3300048925 Bacteria 905834
168 Ga0496123_0000002 3300048926 Bacteria 1811682
169 Ga0496125_0128925 3300048928 Bacteria 1785
170 Ga0496126_0042423 3300048929 Bacteria 4201
171 Ga0501297_000871 3300049520 Bacteria 2706
172 Ga0501298_014891 3300049521 Bacteria 1395
173 Ga0501299_008678 3300049522 Bacteria 1658
174 Ga0501038_0000563 3300049574 Bacteria 32838
175 Ga0501071_0190992 3300049587 Bacteria 1536
176 Ga0501075_1086298 3300049591 Unclassified 608
177 Ga0501198_000562 3300049649 Bacteria 4645
178 Ga0501207_000219 3300049654 Bacteria 5777
179 Ga0501207_064712 3300049654 Bacteria 676
180 Ga0501209_008567 3300049656 Bacteria 2023
181 Ga0501216_003917 3300049660 Bacteria 2190
182 Ga0501217_000071 3300049661 Bacteria 12083
183 Ga0501223_002450 3300049663 Bacteria 4118
184 Ga0501224_001176 3300049664 Bacteria 3429
185 Ga0501227_000178 3300049665 Bacteria 12467
186 Ga0501227_017401 3300049665 Bacteria 1623
187 Ga0501233_000689 3300049668 Bacteria 5567
188 Ga0501235_003137 3300049669 Bacteria 3563
189 Ga0501235_056477 3300049669 Bacteria 915
190 Ga0501235_065515 3300049669 Bacteria 855
191 Ga0501236_014471 3300049670 Unclassified 1093
192 Ga0501243_028496 3300049675 Bacteria 945
193 Ga0501249_020759 3300049679 Bacteria 1430
194 Ga0501253_085848 3300049683 Bacteria 717
195 Ga0501259_076567 3300049688 Bacteria 727
196 Ga0501259_077754 3300049688 Unclassified 724
197 Ga0501259_110905 3300049688 Bacteria 641
198 Ga0501221_025475 3300049704 Bacteria 1196
199 Ga0501221_058228 3300049704 Bacteria 887
200 Ga0501225_0001571 3300049705 Bacteria 7157
201 Ga0501225_0032388 3300049705 Bacteria 1438
202 Ga0501234_012166 3300049707 Bacteria 1347
203 Ga0501245_016774 3300049708 Bacteria 1113
204 Ga0501083_0789199 3300049744 Bacteria 618
205 Ga0501263_022779 3300049760 Bacteria 851
206 Ga0501265_048470 3300049762 Bacteria 662
207 Ga0501268_004231 3300049765 Bacteria 2014
208 Ga0501268_008637 3300049765 Bacteria 1548
209 Ga0501272_003060 3300049769 Bacteria 1682
210 Ga0501283_023139 3300049779 Bacteria 1006
211 Ga0501283_057637 3300049779 Unclassified 697
212 Ga0501212_004772 3300049851 Bacteria 1767
213 Ga0501226_000587 3300049853 Bacteria 5023
214 Ga0501226_012906 3300049853 Bacteria 924
215 nmdc:mga0k408_297260_c1 3300050493 Bacteria 964
216 nmdc:mga05p37_141831_c1 3300050507 Bacteria 2943
217 nmdc:mga05p37_1657_c2 3300050507 Bacteria 25223
218 nmdc:mga09592_474015_c1 3300050508 Bacteria 1079
219 nmdc:mga09592_58684_c1 3300050508 Bacteria 3254
220 nmdc:mga0qj67_204260_c1 3300050509 Bacteria 1605
221 nmdc:mga06r32_1312142_c1 3300050510 Bacteria 667
222 nmdc:mga06r32_670977_c1 3300050510 Bacteria 1004
223 nmdc:mga06r32_77571_c1 3300050510 Bacteria 3228
224 nmdc:mga08y16_12004_c1 3300050511 Bacteria 9098
225 nmdc:mga0n895_1298700_c1 3300050512 Bacteria 699
226 nmdc:mga0n895_164072_c1 3300050512 Bacteria 2253
227 nmdc:mga0n895_22570_c1 3300050512 Bacteria 5902
228 nmdc:mga08x19_357573_c1 3300050514 Bacteria 1020
229 nmdc:mga0a205_55842_c1 3300050515 Bacteria 3813
230 Ga0495595_0025356 3300053084 Bacteria 2627
231 Ga0495619_0028545 3300053085 Bacteria 3600
232 Ga0500644_0113856 3300053088 Bacteria 1045

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049591 Ga0501075_1086298 Ga0501075_1086298_129_593 154
2 3300009147 Ga0114129_10435695 Ga0114129_104356952 163
3 iso_pu_bacteria 2554235003 2554246071 163
4 iso_pu_bacteria 2558860242 2559296182 163
5 iso_pu_bacteria 2791355265 2793357006 163
6 iso_pu_bacteria 2842285085 2842285822 163
7 iso_pu_bacteria 2842402390 2842403182 163
8 iso_pu_bacteria 2842409023 2842409445 163
9 iso_pu_bacteria 2842415677 2842416098 163
10 3300003187 JGI25151J46595_10015912 JGI25151J46595_100159122 167
11 3300003320 rootH2_10104012 rootH2_101040122 167
12 3300005353 Ga0070669_100118553 Ga0070669_1001185532 167
13 3300005578 Ga0068854_100602048 Ga0068854_1006020481 167
14 3300009101 Ga0105247_10088235 Ga0105247_100882353 167
15 3300009177 Ga0105248_10061297 Ga0105248_100612972 167
16 3300009553 Ga0105249_10041287 Ga0105249_100412874 167
17 3300013306 Ga0163162_11277581 Ga0163162_112775811 167
18 3300046492 Ga0495585_0407987 Ga0495585_0407987_115_618 167
19 3300048915 Ga0496112_1041964 Ga0496112_1041964_47_556 167
20 3300048916 Ga0496113_0059422 Ga0496113_0059422_869_1378 167
21 3300048923 Ga0496120_0001160 Ga0496120_0001160_12308_12817 167
22 3300048925 Ga0496122_0000002 Ga0496122_0000002_866118_866627 167
23 3300048926 Ga0496123_0000002 Ga0496123_0000002_866118_866627 167
24 3300048926 Ga0496123_0000002 Ga0496123_0000002_945056_945565 167
25 3300048928 Ga0496125_0128925 Ga0496125_0128925_535_1044 167
26 3300048929 Ga0496126_0042423 Ga0496126_0042423_181_690 167
27 3300050493 nmdc:mga0k408_297260_c1 nmdc:mga0k408_297260_c1_356_865 167
28 3300050515 nmdc:mga0a205_55842_c1 nmdc:mga0a205_55842_c1_41_547 168
29 3300006871 Ga0075434_100131269 Ga0075434_1001312694 169
30 3300006914 Ga0075436_100397880 Ga0075436_1003978801 169
31 3300014968 Ga0157379_10397738 Ga0157379_103977382 169
32 3300050512 nmdc:mga0n895_164072_c1 nmdc:mga0n895_164072_c1_247_792 169
33 3300050514 nmdc:mga08x19_357573_c1 nmdc:mga08x19_357573_c1_446_991 169
34 3300003320 rootH2_10189632 rootH2_101896323 172
35 3300009553 Ga0105249_10003449 Ga0105249_1000344911 172
36 3300005330 Ga0070690_100347472 Ga0070690_1003474722 173
37 3300005355 Ga0070671_100286690 Ga0070671_1002866902 173
38 3300005434 Ga0070709_10000170 Ga0070709_1000017014 173
39 3300006237 Ga0097621_100080849 Ga0097621_1000808493 173
40 3300006358 Ga0068871_100577276 Ga0068871_1005772762 173
41 3300009147 Ga0114129_10002308 Ga0114129_1000230831 173
42 3300009551 Ga0105238_11850597 Ga0105238_118505971 173
43 3300025931 Ga0207644_10025508 Ga0207644_100255085 173
44 3300026075 Ga0207708_10256842 Ga0207708_102568422 173
45 3300026088 Ga0207641_10079177 Ga0207641_100791772 173
46 3300036401 Ga0373937_0196456 Ga0373937_0196456_738_1259 173
47 3300038443 Ga0395901_1153428 Ga0395901_1153428_118_639 173
48 3300046514 Ga0495618_0205380 Ga0495618_0205380_506_1027 173
49 3300046536 Ga0495587_0209811 Ga0495587_0209811_277_798 173
50 3300046663 Ga0495635_0030455 Ga0495635_0030455_426_947 173
51 3300046680 Ga0495646_0107919 Ga0495646_0107919_986_1507 173
52 3300047319 Ga0495674_0641453 Ga0495674_0641453_18_539 173
53 3300047322 Ga0495680_0464912 Ga0495680_0464912_101_622 173
54 3300050507 nmdc:mga05p37_1657_c2 nmdc:mga05p37_1657_c2_4117_4638 173
55 3300050512 nmdc:mga0n895_1298700_c1 nmdc:mga0n895_1298700_c1_53_574 173
56 3300053084 Ga0495595_0025356 Ga0495595_0025356_64_585 173
57 3300053085 Ga0495619_0028545 Ga0495619_0028545_2275_2796 173
58 3300014325 Ga0163163_10588930 Ga0163163_105889302 174
59 3300025291 Ga0209675_1038794 Ga0209675_10387942 174
60 3300028794 Ga0307515_10161147 Ga0307515_101611473 174
61 3300028800 Ga0265338_10000707 Ga0265338_1000070731 174
62 3300053088 Ga0500644_0113856 Ga0500644_0113856_419_949 174
63 3300005338 Ga0068868_100642321 Ga0068868_1006423211 175
64 3300005577 Ga0068857_100263461 Ga0068857_1002634613 175
65 3300005617 Ga0068859_100674766 Ga0068859_1006747662 175
66 3300005841 Ga0068863_100427596 Ga0068863_1004275961 175
67 3300006237 Ga0097621_100122382 Ga0097621_1001223822 175
68 3300006358 Ga0068871_100307617 Ga0068871_1003076171 175
69 3300006931 Ga0097620_100674754 Ga0097620_1006747542 175
70 3300025911 Ga0207654_10632945 Ga0207654_106329451 175
71 3300025942 Ga0207689_11189015 Ga0207689_111890151 175
72 3300025945 Ga0207679_11636593 Ga0207679_116365931 175
73 3300026023 Ga0207677_10454150 Ga0207677_104541501 175
74 3300026088 Ga0207641_10613617 Ga0207641_106136172 175
75 3300026095 Ga0207676_10332375 Ga0207676_103323752 175
76 3300026116 Ga0207674_10868757 Ga0207674_108687572 175
77 3300032004 Ga0307414_10902382 Ga0307414_109023821 175
78 3300032126 Ga0307415_100608065 Ga0307415_1006080652 175
79 3300049654 Ga0501207_064712 Ga0501207_064712_110_637 175
80 3300049669 Ga0501235_065515 Ga0501235_065515_229_756 175
81 3300049675 Ga0501243_028496 Ga0501243_028496_281_808 175
82 3300049679 Ga0501249_020759 Ga0501249_020759_792_1319 175
83 3300049688 Ga0501259_110905 Ga0501259_110905_56_583 175
84 3300049704 Ga0501221_025475 Ga0501221_025475_320_847 175
85 3300049705 Ga0501225_0032388 Ga0501225_0032388_577_1104 175
86 3300049760 Ga0501263_022779 Ga0501263_022779_249_776 175
87 3300049853 Ga0501226_012906 Ga0501226_012906_186_713 175
88 2162886007 SwRhRL2b_contig_271530 SwRhRL2b_0778.00008100 176
89 2162886012 MBSR1b_contig_9262352 MBSR1b_0389.00003080 176
90 3300005289 Ga0065704_10149627 Ga0065704_101496272 176
91 3300005293 Ga0065715_10106933 Ga0065715_101069332 176
92 3300005293 Ga0065715_10225581 Ga0065715_102255811 176
93 3300005331 Ga0070670_100014728 Ga0070670_1000147285 176
94 3300005331 Ga0070670_100226609 Ga0070670_1002266092 176
95 3300005334 Ga0068869_100210362 Ga0068869_1002103622 176
96 3300005340 Ga0070689_100000373 Ga0070689_1000003733 176
97 3300005345 Ga0070692_10638031 Ga0070692_106380311 176
98 3300005364 Ga0070673_100183871 Ga0070673_1001838711 176
99 3300005364 Ga0070673_100474713 Ga0070673_1004747132 176
100 3300005441 Ga0070700_100000056 Ga0070700_10000005649 176
101 3300005445 Ga0070708_100019869 Ga0070708_1000198695 176
102 3300005468 Ga0070707_100225549 Ga0070707_1002255492 176
103 3300005471 Ga0070698_100010465 Ga0070698_1000104657 176
104 3300005518 Ga0070699_100103764 Ga0070699_1001037642 176
105 3300005518 Ga0070699_100131159 Ga0070699_1001311592 176
106 3300005536 Ga0070697_100007529 Ga0070697_1000075292 176
107 3300005536 Ga0070697_100050270 Ga0070697_1000502702 176
108 3300005536 Ga0070697_100379504 Ga0070697_1003795043 176
109 3300005545 Ga0070695_100505376 Ga0070695_1005053761 176
110 3300005563 Ga0068855_100420367 Ga0068855_1004203672 176
111 3300005577 Ga0068857_101190301 Ga0068857_1011903011 176
112 3300005614 Ga0068856_100234915 Ga0068856_1002349152 176
113 3300005617 Ga0068859_100005324 Ga0068859_1000053248 176
114 3300005617 Ga0068859_100316762 Ga0068859_1003167622 176
115 3300005617 Ga0068859_100965928 Ga0068859_1009659282 176
116 3300005618 Ga0068864_100034314 Ga0068864_1000343143 176
117 3300005618 Ga0068864_100728286 Ga0068864_1007282861 176
118 3300005618 Ga0068864_101063930 Ga0068864_1010639301 176
119 3300005618 Ga0068864_101557695 Ga0068864_1015576951 176
120 3300005840 Ga0068870_10099685 Ga0068870_100996852 176
121 3300005841 Ga0068863_100013527 Ga0068863_1000135275 176
122 3300005844 Ga0068862_100084320 Ga0068862_1000843202 176
123 3300006844 Ga0075428_100227103 Ga0075428_1002271032 176
124 3300006844 Ga0075428_100920205 Ga0075428_1009202052 176
125 3300006846 Ga0075430_100052082 Ga0075430_1000520824 176
126 3300006847 Ga0075431_100033301 Ga0075431_1000333014 176
127 3300006847 Ga0075431_100060195 Ga0075431_1000601952 176
128 3300006847 Ga0075431_100142952 Ga0075431_1001429523 176
129 3300006871 Ga0075434_100127336 Ga0075434_1001273363 176
130 3300006880 Ga0075429_100225935 Ga0075429_1002259353 176
131 3300006880 Ga0075429_100333963 Ga0075429_1003339632 176
132 3300006931 Ga0097620_100005324 Ga0097620_1000053248 176
133 3300006931 Ga0097620_100316771 Ga0097620_1003167713 176
134 3300006931 Ga0097620_100966017 Ga0097620_1009660172 176
135 3300009094 Ga0111539_10015321 Ga0111539_100153217 176
136 3300009098 Ga0105245_11717306 Ga0105245_117173061 176
137 3300009101 Ga0105247_10118277 Ga0105247_101182772 176
138 3300009147 Ga0114129_10016240 Ga0114129_100162407 176
139 3300009147 Ga0114129_10089796 Ga0114129_100897963 176
140 3300009148 Ga0105243_10121289 Ga0105243_101212892 176
141 3300009174 Ga0105241_10261846 Ga0105241_102618462 176
142 3300009174 Ga0105241_10334926 Ga0105241_103349261 176
143 3300009177 Ga0105248_10006886 Ga0105248_100068868 176
144 3300009553 Ga0105249_10035523 Ga0105249_100355233 176
145 3300010375 Ga0105239_10748094 Ga0105239_107480941 176
146 3300011119 Ga0105246_10128349 Ga0105246_101283493 176
147 3300011119 Ga0105246_10546656 Ga0105246_105466562 176
148 3300014326 Ga0157380_10125680 Ga0157380_101256804 176
149 3300025904 Ga0207647_10163651 Ga0207647_101636512 176
150 3300025908 Ga0207643_10001057 Ga0207643_1000105710 176
151 3300025922 Ga0207646_10028476 Ga0207646_100284762 176
152 3300025925 Ga0207650_10009811 Ga0207650_100098116 176
153 3300025935 Ga0207709_10336210 Ga0207709_103362102 176
154 3300025936 Ga0207670_10000235 Ga0207670_100002356 176
155 3300025941 Ga0207711_10024788 Ga0207711_100247884 176
156 3300025949 Ga0207667_11394821 Ga0207667_113948211 176
157 3300025960 Ga0207651_10296407 Ga0207651_102964072 176
158 3300025981 Ga0207640_10230929 Ga0207640_102309292 176
159 3300026075 Ga0207708_10000089 Ga0207708_1000008937 176
160 3300026078 Ga0207702_10070626 Ga0207702_100706265 176
161 3300026089 Ga0207648_10616876 Ga0207648_106168762 176
162 3300026095 Ga0207676_10016989 Ga0207676_100169893 176
163 3300026095 Ga0207676_10791374 Ga0207676_107913742 176
164 3300026116 Ga0207674_10100568 Ga0207674_101005683 176
165 3300026116 Ga0207674_10978447 Ga0207674_109784472 176
166 3300026121 Ga0207683_10789804 Ga0207683_107898042 176
167 3300027907 Ga0207428_10101765 Ga0207428_101017652 176
168 3300028380 Ga0268265_10080806 Ga0268265_100808064 176
169 3300031548 Ga0307408_100007719 Ga0307408_1000077194 176
170 3300031548 Ga0307408_100227076 Ga0307408_1002270762 176
171 3300031548 Ga0307408_100293054 Ga0307408_1002930542 176
172 3300031548 Ga0307408_100320808 Ga0307408_1003208082 176
173 3300031731 Ga0307405_10017349 Ga0307405_100173492 176
174 3300031824 Ga0307413_10012612 Ga0307413_100126124 176
175 3300031824 Ga0307413_10049728 Ga0307413_100497282 176
176 3300031852 Ga0307410_10045718 Ga0307410_100457184 176
177 3300031852 Ga0307410_10319819 Ga0307410_103198191 176
178 3300031901 Ga0307406_10000928 Ga0307406_100009285 176
179 3300031901 Ga0307406_10339880 Ga0307406_103398801 176
180 3300031903 Ga0307407_10029108 Ga0307407_100291082 176
181 3300031903 Ga0307407_10051771 Ga0307407_100517712 176
182 3300031911 Ga0307412_10029624 Ga0307412_100296242 176
183 3300031911 Ga0307412_10205558 Ga0307412_102055582 176
184 3300031995 Ga0307409_100273103 Ga0307409_1002731032 176
185 3300032002 Ga0307416_100051725 Ga0307416_1000517252 176
186 3300032002 Ga0307416_100184681 Ga0307416_1001846812 176
187 3300032004 Ga0307414_10003850 Ga0307414_100038505 176
188 3300032004 Ga0307414_11064788 Ga0307414_110647882 176
189 3300032005 Ga0307411_10041172 Ga0307411_100411722 176
190 3300032126 Ga0307415_100001804 Ga0307415_1000018046 176
191 3300032126 Ga0307415_100046357 Ga0307415_1000463572 176
192 3300035091 Ga0373951_0047088 Ga0373951_0047088_202_732 176
193 3300035092 Ga0373952_0020619 Ga0373952_0020619_625_1242 176
194 3300035691 Ga0373931_0505276 Ga0373931_0505276_120_737 176
195 3300037418 Ga0395900_0457433 Ga0395900_0457433_64_597 176
196 3300048905 Ga0496102_0429726 Ga0496102_0429726_193_726 176
197 3300048913 Ga0496110_0538185 Ga0496110_0538185_60_629 176
198 3300049520 Ga0501297_000871 Ga0501297_000871_1203_1733 176
199 3300049521 Ga0501298_014891 Ga0501298_014891_190_723 176
200 3300049522 Ga0501299_008678 Ga0501299_008678_1038_1568 176
201 3300049574 Ga0501038_0000563 Ga0501038_0000563_794_1327 176
202 3300049587 Ga0501071_0190992 Ga0501071_0190992_924_1454 176
203 3300049649 Ga0501198_000562 Ga0501198_000562_3423_3956 176
204 3300049654 Ga0501207_000219 Ga0501207_000219_2931_3464 176
205 3300049656 Ga0501209_008567 Ga0501209_008567_953_1486 176
206 3300049660 Ga0501216_003917 Ga0501216_003917_424_954 176
207 3300049661 Ga0501217_000071 Ga0501217_000071_9051_9584 176
208 3300049663 Ga0501223_002450 Ga0501223_002450_2550_3083 176
209 3300049664 Ga0501224_001176 Ga0501224_001176_126_659 176
210 3300049665 Ga0501227_000178 Ga0501227_000178_10754_11287 176
211 3300049665 Ga0501227_017401 Ga0501227_017401_616_1146 176
212 3300049668 Ga0501233_000689 Ga0501233_000689_2590_3123 176
213 3300049669 Ga0501235_003137 Ga0501235_003137_2200_2733 176
214 3300049669 Ga0501235_056477 Ga0501235_056477_204_734 176
215 3300049670 Ga0501236_014471 Ga0501236_014471_28_561 176
216 3300049683 Ga0501253_085848 Ga0501253_085848_21_551 176
217 3300049688 Ga0501259_076567 Ga0501259_076567_98_628 176
218 3300049688 Ga0501259_077754 Ga0501259_077754_135_668 176
219 3300049704 Ga0501221_058228 Ga0501221_058228_341_871 176
220 3300049705 Ga0501225_0001571 Ga0501225_0001571_2568_3101 176
221 3300049707 Ga0501234_012166 Ga0501234_012166_340_870 176
222 3300049708 Ga0501245_016774 Ga0501245_016774_182_715 176
223 3300049744 Ga0501083_0789199 Ga0501083_0789199_59_589 176
224 3300049762 Ga0501265_048470 Ga0501265_048470_101_631 176
225 3300049765 Ga0501268_004231 Ga0501268_004231_1117_1650 176
226 3300049765 Ga0501268_008637 Ga0501268_008637_790_1320 176
227 3300049769 Ga0501272_003060 Ga0501272_003060_381_911 176
228 3300049779 Ga0501283_023139 Ga0501283_023139_293_823 176
229 3300049779 Ga0501283_057637 Ga0501283_057637_51_584 176
230 3300049851 Ga0501212_004772 Ga0501212_004772_393_926 176
231 3300049853 Ga0501226_000587 Ga0501226_000587_4131_4664 176
232 3300050507 nmdc:mga05p37_141831_c1 nmdc:mga05p37_141831_c1_1785_2315 176
233 3300050508 nmdc:mga09592_474015_c1 nmdc:mga09592_474015_c1_73_603 176
234 3300050508 nmdc:mga09592_58684_c1 nmdc:mga09592_58684_c1_741_1271 176
235 3300050509 nmdc:mga0qj67_204260_c1 nmdc:mga0qj67_204260_c1_193_723 176
236 3300050510 nmdc:mga06r32_1312142_c1 nmdc:mga06r32_1312142_c1_42_575 176
237 3300050510 nmdc:mga06r32_670977_c1 nmdc:mga06r32_670977_c1_167_697 176
238 3300050510 nmdc:mga06r32_77571_c1 nmdc:mga06r32_77571_c1_1762_2292 176
239 3300050511 nmdc:mga08y16_12004_c1 nmdc:mga08y16_12004_c1_7176_7706 176
240 3300050512 nmdc:mga0n895_22570_c1 nmdc:mga0n895_22570_c1_4702_5235 176

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16694

Cytochrome_P460

Cytochrome P460

70

201

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
8brk-assembly1.cif.gz_A room temperature crystal structure of cytochrome c' from thermus thermophilus 0.7736 41 176
6hiu-assembly1.cif.gz_A cytochrome p460 from methylococcus capsulatus (bath) 0.7701 34 172
7zps-assembly1.cif.gz_B cytochrome c prime beta from methylococcus capsulatus (bath): no complex 0.7611 36 173
8brk-assembly1.cif.gz_A room temperature crystal structure of cytochrome c' from thermus thermophilus 0.7494 41 176
7zps-assembly1.cif.gz_B cytochrome c prime beta from methylococcus capsulatus (bath): no complex 0.7368 36 173
ID Description Score Start End Superfamily
2je3A00 Alpha Beta;3-Layer(bba) Sandwich;Chalcone isomerase;Cytochrome P460 0.6723 39 171 3.50.70.20
2je3A00 Alpha Beta;3-Layer(bba) Sandwich;Chalcone isomerase;Cytochrome P460 0.5523 39 171 3.50.70.20
6i7aC00 Mainly Beta;Sandwich;Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A;Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A 0.4735 29 93 2.60.210.10
af_Q55GF5_794_1204_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.4673 47 127 2.60.40.10
af_I1MWI9_71_209_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.4569 47 123 2.40.128.20
ID Description Score Start End GO Terms
AF-A0A0M9GFX9-F1-model_v4 Cytochrome P460 domain-containing protein 0.8614 40 173
AF-A0A031JTP0-F1-model_v4 Cytochrome P460 0.8495 36 172
AF-A0A6F8V2M8-F1-model_v4 Cytochrome P460 domain-containing protein 0.8417 39 176
AF-A0A853QX88-F1-model_v4 deleted 0.8408 40 176
AF-A0A7G8QAZ0-F1-model_v4 Cytochrome P460 family protein 0.8397 33 176

Feature Viewer

pLDDT pTM Quality
79.57 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map