F352746

General Info

Members Datasets Scaffolds Average Seq Length
240 174 480 272

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100423463|Ga0075428_1004234632
Length 297
Sequence MNPVLTIAGLTLREAQRRWLLVVGVLLGGAFVLVYTTGLWFIVQHSPCGPRARPCATPFQALEFRAGLNMGAILGLYVANFLTVITAVLLPIDTLSGEIASGVTQTLASKPIRRAEIVIGKWLAYWLLVAFYIMLTAGGVILSVWAVSAIVSGGSGFVPPSAARGLALILLEATVMLTISIAGGTRFSTVTNGMVALGVFGLGFLGGYVEQFGVMLVAGEAGRTVMRNIGTIISLLVPADALWRLAAYYMMPAIVRDLEVTPFNSMYPPSGAMVLWAIGYIVVVGAIAVRQFNNRAL

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
124 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
125 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
126 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
130 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
131 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
132 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
136 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
137 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
138 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
139 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
140 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
141 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
142 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
143 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
144 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
145 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
146 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
149 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
150 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
151 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
154 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
159 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
160 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
161 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
162 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
163 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
164 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
165 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
166 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
167 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
168 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
169 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
170 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
171 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
172 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
173 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
174 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.33
Nodule 0
Rhizoplane 4.58
Rhizosphere 90.83
Stem 0
Stem Tuber 0
Unclassified 11.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100423463 3300006844 Bacteria 1426
2 JGI25406J46586_10015635 3300003203 Bacteria 3193
3 rootL2_10370616 3300003322 Unclassified 1035
4 rootH1_10323462 3300003323 Bacteria 1322
5 Ga0065707_10093943 3300005295 Bacteria 3559
6 Ga0070676_10019007 3300005328 Bacteria 3817
7 Ga0070690_100151535 3300005330 Unclassified 1583
8 Ga0070690_100208678 3300005330 Bacteria 1362
9 Ga0070670_100009144 3300005331 Bacteria 8468
10 Ga0070670_100024699 3300005331 Bacteria 5168
11 Ga0070670_100145684 3300005331 Bacteria 2049
12 Ga0070670_100263192 3300005331 Bacteria 1503
13 Ga0068869_100105249 3300005334 Bacteria 2140
14 Ga0068869_100172391 3300005334 Bacteria 1691
15 Ga0070666_10009561 3300005335 Bacteria 6049
16 Ga0068868_100008767 3300005338 Bacteria 7245
17 Ga0070689_100026272 3300005340 Bacteria 4382
18 Ga0070689_100334620 3300005340 Bacteria 1267
19 Ga0070691_10003622 3300005341 Bacteria 6975
20 Ga0070687_100150283 3300005343 Bacteria 1366
21 Ga0070687_100177791 3300005343 Bacteria 1272
22 Ga0070661_100159162 3300005344 Bacteria 1710
23 Ga0070692_10136193 3300005345 Bacteria 1385
24 Ga0070692_10271590 3300005345 Bacteria 1024
25 Ga0070669_100019138 3300005353 Bacteria 4894
26 Ga0070674_100135006 3300005356 Bacteria 1844
27 Ga0070673_100081868 3300005364 Bacteria 2619
28 Ga0070688_100033027 3300005365 Bacteria 3126
29 Ga0070688_100036195 3300005365 Bacteria 3001
30 Ga0070667_100011109 3300005367 Bacteria 7450
31 Ga0070667_100049782 3300005367 Bacteria 3530
32 Ga0070713_100013861 3300005436 Bacteria 5965
33 Ga0070701_10012656 3300005438 Bacteria 3811
34 Ga0070700_100012215 3300005441 Bacteria 4784
35 Ga0070700_100024083 3300005441 Bacteria 3570
36 Ga0070700_100092764 3300005441 Unclassified 1974
37 Ga0070694_100016368 3300005444 Bacteria 4666
38 Ga0070662_100195774 3300005457 Bacteria 1601
39 Ga0070662_100289445 3300005457 Bacteria 1328
40 Ga0068867_100010677 3300005459 Bacteria 6478
41 Ga0070706_100244883 3300005467 Unclassified 1674
42 Ga0070699_100475957 3300005518 Unclassified 1133
43 Ga0070684_100006668 3300005535 Bacteria 8947
44 Ga0070672_100286565 3300005543 Bacteria 1394
45 Ga0070686_100005146 3300005544 Bacteria 7218
46 Ga0070686_100170207 3300005544 Bacteria 1540
47 Ga0070695_100006492 3300005545 Bacteria 6913
48 Ga0070696_100001403 3300005546 Bacteria 15746
49 Ga0070693_100013303 3300005547 Bacteria 4189
50 Ga0070665_100029725 3300005548 Bacteria 5499
51 Ga0070665_100203211 3300005548 Bacteria 1982
52 Ga0070704_100018535 3300005549 Bacteria 4453
53 Ga0070704_100091136 3300005549 Bacteria 2272
54 Ga0070704_100356277 3300005549 Bacteria 1237
55 Ga0068855_100159351 3300005563 Bacteria 2563
56 Ga0070664_100020826 3300005564 Bacteria 5402
57 Ga0070702_100022470 3300005615 Bacteria 3336
58 Ga0068852_100132133 3300005616 Bacteria 2300
59 Ga0068852_100281402 3300005616 Bacteria 1604
60 Ga0068859_100037057 3300005617 Bacteria 4895
61 Ga0068864_100007913 3300005618 Bacteria 8759
62 Ga0068861_100004318 3300005719 Bacteria 9535
63 Ga0068861_100211757 3300005719 Bacteria 1633
64 Ga0068870_10031253 3300005840 Bacteria 2697
65 Ga0068863_100028605 3300005841 Bacteria 5321
66 Ga0068858_100015442 3300005842 Bacteria 7181
67 Ga0068860_100032835 3300005843 Bacteria 4986
68 Ga0068862_100469543 3300005844 Bacteria 1189
69 Ga0081455_10000296 3300005937 Bacteria 65970
70 Ga0081539_10000163 3300005985 Bacteria 156102
71 Ga0081539_10037272 3300005985 Bacteria 2898
72 Ga0075368_10011067 3300006042 Bacteria 3277
73 Ga0075364_10052601 3300006051 Bacteria 2662
74 Ga0075367_10005182 3300006178 Bacteria 6443
75 Ga0097621_100039965 3300006237 Bacteria 3769
76 Ga0097621_100053148 3300006237 Bacteria 3301
77 Ga0097621_100090764 3300006237 Bacteria 2557
78 Ga0068871_100039682 3300006358 Bacteria 3769
79 Ga0068871_100303568 3300006358 Bacteria 1402
80 Ga0075428_100033968 3300006844 Bacteria 5627
81 Ga0075433_10004519 3300006852 Bacteria 10845
82 Ga0075433_10251037 3300006852 Bacteria 1570
83 Ga0075429_100137300 3300006880 Unclassified 2140
84 Ga0068865_100177066 3300006881 Bacteria 1640
85 Ga0097620_100037057 3300006931 Bacteria 4895
86 Ga0075435_100349652 3300007076 Bacteria 1267
87 Ga0105240_10067651 3300009093 Bacteria 4428
88 Ga0105240_10204947 3300009093 Bacteria 2309
89 Ga0105240_10571379 3300009093 Bacteria 1248
90 Ga0111539_10005766 3300009094 Bacteria 16006
91 Ga0111539_10014770 3300009094 Bacteria 9739
92 Ga0111539_10026001 3300009094 Bacteria 7163
93 Ga0111539_10072343 3300009094 Bacteria 4066
94 Ga0105245_10003316 3300009098 Bacteria 14458
95 Ga0105247_10005667 3300009101 Bacteria 7826
96 Ga0114129_10013943 3300009147 Bacteria 11450
97 Ga0105243_10069349 3300009148 Bacteria 2844
98 Ga0105242_10154177 3300009176 Bacteria 2005
99 Ga0105248_10046813 3300009177 Bacteria 4849
100 Ga0105248_10056478 3300009177 Bacteria 4404
101 Ga0105248_10420680 3300009177 Unclassified 1505
102 Ga0105237_10187632 3300009545 Unclassified 2067
103 Ga0105237_10497676 3300009545 Viruses 1225
104 Ga0105238_10356895 3300009551 Unclassified 1451
105 Ga0105249_10387087 3300009553 Bacteria 1425
106 Ga0105239_10212901 3300010375 Bacteria 2166
107 Ga0105246_10002401 3300011119 Bacteria 11311
108 Ga0157369_10107333 3300013105 Bacteria 2970
109 Ga0157374_10005855 3300013296 Bacteria 10385
110 Ga0157374_10307071 3300013296 Bacteria 1570
111 Ga0157378_10141040 3300013297 Bacteria 2238
112 Ga0157378_10158611 3300013297 Bacteria 2114
113 Ga0163162_10004704 3300013306 Bacteria 13165
114 Ga0163162_10647179 3300013306 Bacteria 1181
115 Ga0157372_10322510 3300013307 Bacteria 1799
116 Ga0157375_10004860 3300013308 Bacteria 11676
117 Ga0157375_10085957 3300013308 Bacteria 3195
118 Ga0157375_10168472 3300013308 Bacteria 2337
119 Ga0163163_10000001 3300014325 Bacteria 622185
120 Ga0163163_10024480 3300014325 Bacteria 5746
121 Ga0157377_10481188 3300014745 Bacteria 864
122 Ga0157379_10074322 3300014968 Bacteria 3043
123 Ga0157376_10077363 3300014969 Bacteria 2846
124 Ga0157376_10163384 3300014969 Unclassified 2021
125 Ga0157376_10280833 3300014969 Unclassified 1568
126 Ga0157376_10331352 3300014969 Bacteria 1450
127 Ga0157376_10845363 3300014969 Bacteria 930
128 Ga0163161_10064829 3300017792 Bacteria 2666
129 Ga0207682_10115917 3300025893 Bacteria 1184
130 Ga0207710_10130522 3300025900 Bacteria 1207
131 Ga0207688_10207765 3300025901 Bacteria 1176
132 Ga0207645_10002823 3300025907 Bacteria 13494
133 Ga0207645_10043124 3300025907 Bacteria 2886
134 Ga0207643_10048170 3300025908 Bacteria 2413
135 Ga0207705_10097649 3300025909 Bacteria 2158
136 Ga0207654_10074823 3300025911 Bacteria 2022
137 Ga0207695_10361729 3300025913 Bacteria 1337
138 Ga0207662_10218375 3300025918 Bacteria 1240
139 Ga0207681_10009807 3300025923 Bacteria 5858
140 Ga0207694_10471082 3300025924 Bacteria 1050
141 Ga0207650_10055576 3300025925 Bacteria 2939
142 Ga0207650_10088509 3300025925 Bacteria 2361
143 Ga0207650_10547542 3300025925 Unclassified 970
144 Ga0207644_10019260 3300025931 Bacteria 4627
145 Ga0207706_10044300 3300025933 Bacteria 3944
146 Ga0207706_10297696 3300025933 Bacteria 1406
147 Ga0207686_10051101 3300025934 Bacteria 2574
148 Ga0207670_10153844 3300025936 Bacteria 1709
149 Ga0207669_10447186 3300025937 Unclassified 1023
150 Ga0207704_10075951 3300025938 Bacteria 2151
151 Ga0207711_10007213 3300025941 Bacteria 9315
152 Ga0207711_10074358 3300025941 Bacteria 2955
153 Ga0207711_10201691 3300025941 Unclassified 1815
154 Ga0207711_10409255 3300025941 Bacteria 1261
155 Ga0207689_10138098 3300025942 Unclassified 2007
156 Ga0207661_10225666 3300025944 Bacteria 1657
157 Ga0207667_10245348 3300025949 Bacteria 1832
158 Ga0207651_10306237 3300025960 Bacteria 1323
159 Ga0207658_10126615 3300025986 Bacteria 2045
160 Ga0207677_10072824 3300026023 Bacteria 2431
161 Ga0207703_10112980 3300026035 Bacteria 2321
162 Ga0207678_10477159 3300026067 Bacteria 1086
163 Ga0207708_10021702 3300026075 Bacteria 4844
164 Ga0207708_10035552 3300026075 Bacteria 3791
165 Ga0207708_10046025 3300026075 Bacteria 3323
166 Ga0207702_10294590 3300026078 Bacteria 1538
167 Ga0207641_10028419 3300026088 Bacteria 4621
168 Ga0207648_10007559 3300026089 Bacteria 10666
169 Ga0207648_10082276 3300026089 Bacteria 2808
170 Ga0207648_10162113 3300026089 Bacteria 1975
171 Ga0207674_10121446 3300026116 Bacteria 2580
172 Ga0207675_100003313 3300026118 Bacteria 15760
173 Ga0207675_100213387 3300026118 Bacteria 1857
174 Ga0207428_10005669 3300027907 Bacteria 11599
175 Ga0207428_10053803 3300027907 Bacteria 3209
176 Ga0207428_10468163 3300027907 Bacteria 918
177 Ga0268266_10040451 3300028379 Bacteria 3974
178 Ga0268265_10369575 3300028380 Bacteria 1316
179 Ga0268264_10049231 3300028381 Bacteria 3506
180 Ga0265338_10131095 3300028800 Bacteria 1979
181 Ga0265332_10094190 3300031238 Bacteria 1265
182 Ga0265340_10059241 3300031247 Bacteria 1837
183 Ga0307413_10290724 3300031824 Bacteria 1234
184 Ga0307409_100591579 3300031995 Unclassified 1095
185 Ga0307411_10321585 3300032005 Bacteria 1250
186 Ga0373956_0034048 3300035119 Bacteria 2243
187 Ga0373946_0066901 3300035171 Bacteria 1542
188 Ga0373961_0070664 3300035241 Bacteria 1079
189 Ga0373933_0326899 3300035724 Unclassified 995
190 Ga0373937_0164193 3300036401 Bacteria 2082
191 Ga0373937_0281970 3300036401 Unclassified 1569
192 Ga0436365_1418541 3300039437 Bacteria 3031
193 Ga0439435_0040991 3300042436 Archaea 1296
194 Ga0439460_0028600 3300042461 Unclassified 1574
195 Ga0466969_0019718 3300044656 Bacteria 3500
196 Ga0466972_0041823 3300044658 Bacteria 2230
197 Ga0466966_0004225 3300044684 Bacteria 9480
198 Ga0466961_0000693 3300044693 Bacteria 21312
199 Ga0466964_0001117 3300044706 Bacteria 9018
200 Ga0466971_0094602 3300044719 Bacteria 1369
201 Ga0466968_0017771 3300044735 Bacteria 2847
202 Ga0466970_0001854 3300044765 Bacteria 10215
203 Ga0466957_0036721 3300044842 Bacteria 2947
204 Ga0466959_0017562 3300045049 Bacteria 5246
205 Ga0466959_0076960 3300045049 Bacteria 2408
206 Ga0451576_0019468 3300045051 Bacteria 7407
207 Ga0495629_0284949 3300046459 Bacteria 1133
208 Ga0495608_0101585 3300046511 Bacteria 1854
209 Ga0495647_0056334 3300046681 Unclassified 1541
210 Ga0496100_0082200 3300048903 Bacteria 2178
211 Ga0496104_0274737 3300048907 Unclassified 1598
212 Ga0496107_0108038 3300048910 Unclassified 2043
213 Ga0496108_0024281 3300048911 Bacteria 4991
214 Ga0496108_0054435 3300048911 Bacteria 3358
215 Ga0496109_0275432 3300048912 Bacteria 1585
216 Ga0496110_0047008 3300048913 Bacteria 3777
217 Ga0496112_0022317 3300048915 Bacteria 6031
218 Ga0496114_0063752 3300048917 Bacteria 3085
219 Ga0496114_0114140 3300048917 Bacteria 2316
220 Ga0496114_0309763 3300048917 Bacteria 1394
221 Ga0501069_0070754 3300049585 Unclassified 1955
222 Ga0501076_0534187 3300049592 Unclassified 967
223 nmdc:mga00v17_97688_c1 3300050491 Bacteria 1851
224 nmdc:mga0yw44_189672_c1 3300050492 Bacteria 1355
225 nmdc:mga06z11_121812_c1 3300050494 Bacteria 1456
226 nmdc:mga05p37_5983_c1 3300050507 Bacteria 14320
227 nmdc:mga09592_124840_c1 3300050508 Unclassified 2212
228 nmdc:mga0qj67_199819_c1 3300050509 Bacteria 1624
229 nmdc:mga08y16_176168_c1 3300050511 Bacteria 2221
230 nmdc:mga08y16_49708_c1 3300050511 Bacteria 4388
231 nmdc:mga08y16_52485_c1 3300050511 Bacteria 4266
232 nmdc:mga08y16_7976_c1 3300050511 Bacteria 11083
233 nmdc:mga0rr50_460567_c1 3300050513 Archaea 1078
234 nmdc:mga0a205_449176_c1 3300050515 Bacteria 1149
235 nmdc:mga0a205_494960_c1 3300050515 Unclassified 1080
236 Ga0495601_0010346 3300053077 Bacteria 5549
237 Ga0500651_0254965 3300053093 Unclassified 1019
238 Ga0500641_0005374 3300053096 Bacteria 4538
239 Ga0501084_0398663 3300054114 Bacteria 1163
240 Ga0466962_0016052 3300061719 Bacteria 3612
241 Ga0075428_100423463
242 JGI25406J46586_10015635
243 rootL2_10370616
244 rootH1_10323462
245 Ga0065707_10093943
246 Ga0070676_10019007
247 Ga0070690_100151535
248 Ga0070690_100208678
249 Ga0070670_100009144
250 Ga0070670_100024699
251 Ga0070670_100145684
252 Ga0070670_100263192
253 Ga0068869_100105249
254 Ga0068869_100172391
255 Ga0070666_10009561
256 Ga0068868_100008767
257 Ga0070689_100026272
258 Ga0070689_100334620
259 Ga0070691_10003622
260 Ga0070687_100150283
261 Ga0070687_100177791
262 Ga0070661_100159162
263 Ga0070692_10136193
264 Ga0070692_10271590
265 Ga0070669_100019138
266 Ga0070674_100135006
267 Ga0070673_100081868
268 Ga0070688_100033027
269 Ga0070688_100036195
270 Ga0070667_100011109
271 Ga0070667_100049782
272 Ga0070713_100013861
273 Ga0070701_10012656
274 Ga0070700_100012215
275 Ga0070700_100024083
276 Ga0070700_100092764
277 Ga0070694_100016368
278 Ga0070662_100195774
279 Ga0070662_100289445
280 Ga0068867_100010677
281 Ga0070706_100244883
282 Ga0070699_100475957
283 Ga0070684_100006668
284 Ga0070672_100286565
285 Ga0070686_100005146
286 Ga0070686_100170207
287 Ga0070695_100006492
288 Ga0070696_100001403
289 Ga0070693_100013303
290 Ga0070665_100029725
291 Ga0070665_100203211
292 Ga0070704_100018535
293 Ga0070704_100091136
294 Ga0070704_100356277
295 Ga0068855_100159351
296 Ga0070664_100020826
297 Ga0070702_100022470
298 Ga0068852_100132133
299 Ga0068852_100281402
300 Ga0068859_100037057
301 Ga0068864_100007913
302 Ga0068861_100004318
303 Ga0068861_100211757
304 Ga0068870_10031253
305 Ga0068863_100028605
306 Ga0068858_100015442
307 Ga0068860_100032835
308 Ga0068862_100469543
309 Ga0081455_10000296
310 Ga0081539_10000163
311 Ga0081539_10037272
312 Ga0075368_10011067
313 Ga0075364_10052601
314 Ga0075367_10005182
315 Ga0097621_100039965
316 Ga0097621_100053148
317 Ga0097621_100090764
318 Ga0068871_100039682
319 Ga0068871_100303568
320 Ga0075428_100033968
321 Ga0075433_10004519
322 Ga0075433_10251037
323 Ga0075429_100137300
324 Ga0068865_100177066
325 Ga0097620_100037057
326 Ga0075435_100349652
327 Ga0105240_10067651
328 Ga0105240_10204947
329 Ga0105240_10571379
330 Ga0111539_10005766
331 Ga0111539_10014770
332 Ga0111539_10026001
333 Ga0111539_10072343
334 Ga0105245_10003316
335 Ga0105247_10005667
336 Ga0114129_10013943
337 Ga0105243_10069349
338 Ga0105242_10154177
339 Ga0105248_10046813
340 Ga0105248_10056478
341 Ga0105248_10420680
342 Ga0105237_10187632
343 Ga0105237_10497676
344 Ga0105238_10356895
345 Ga0105249_10387087
346 Ga0105239_10212901
347 Ga0105246_10002401
348 Ga0157369_10107333
349 Ga0157374_10005855
350 Ga0157374_10307071
351 Ga0157378_10141040
352 Ga0157378_10158611
353 Ga0163162_10004704
354 Ga0163162_10647179
355 Ga0157372_10322510
356 Ga0157375_10004860
357 Ga0157375_10085957
358 Ga0157375_10168472
359 Ga0163163_10000001
360 Ga0163163_10024480
361 Ga0157377_10481188
362 Ga0157379_10074322
363 Ga0157376_10077363
364 Ga0157376_10163384
365 Ga0157376_10280833
366 Ga0157376_10331352
367 Ga0157376_10845363
368 Ga0163161_10064829
369 Ga0207682_10115917
370 Ga0207710_10130522
371 Ga0207688_10207765
372 Ga0207645_10002823
373 Ga0207645_10043124
374 Ga0207643_10048170
375 Ga0207705_10097649
376 Ga0207654_10074823
377 Ga0207695_10361729
378 Ga0207662_10218375
379 Ga0207681_10009807
380 Ga0207694_10471082
381 Ga0207650_10055576
382 Ga0207650_10088509
383 Ga0207650_10547542
384 Ga0207644_10019260
385 Ga0207706_10044300
386 Ga0207706_10297696
387 Ga0207686_10051101
388 Ga0207670_10153844
389 Ga0207669_10447186
390 Ga0207704_10075951
391 Ga0207711_10007213
392 Ga0207711_10074358
393 Ga0207711_10201691
394 Ga0207711_10409255
395 Ga0207689_10138098
396 Ga0207661_10225666
397 Ga0207667_10245348
398 Ga0207651_10306237
399 Ga0207658_10126615
400 Ga0207677_10072824
401 Ga0207703_10112980
402 Ga0207678_10477159
403 Ga0207708_10021702
404 Ga0207708_10035552
405 Ga0207708_10046025
406 Ga0207702_10294590
407 Ga0207641_10028419
408 Ga0207648_10007559
409 Ga0207648_10082276
410 Ga0207648_10162113
411 Ga0207674_10121446
412 Ga0207675_100003313
413 Ga0207675_100213387
414 Ga0207428_10005669
415 Ga0207428_10053803
416 Ga0207428_10468163
417 Ga0268266_10040451
418 Ga0268265_10369575
419 Ga0268264_10049231
420 Ga0265338_10131095
421 Ga0265332_10094190
422 Ga0265340_10059241
423 Ga0307413_10290724
424 Ga0307409_100591579
425 Ga0307411_10321585
426 Ga0373956_0034048
427 Ga0373946_0066901
428 Ga0373961_0070664
429 Ga0373933_0326899
430 Ga0373937_0164193
431 Ga0373937_0281970
432 Ga0436365_1418541
433 Ga0439435_0040991
434 Ga0439460_0028600
435 Ga0466969_0019718
436 Ga0466972_0041823
437 Ga0466966_0004225
438 Ga0466961_0000693
439 Ga0466964_0001117
440 Ga0466971_0094602
441 Ga0466968_0017771
442 Ga0466970_0001854
443 Ga0466957_0036721
444 Ga0466959_0017562
445 Ga0466959_0076960
446 Ga0451576_0019468
447 Ga0495629_0284949
448 Ga0495608_0101585
449 Ga0495647_0056334
450 Ga0496100_0082200
451 Ga0496104_0274737
452 Ga0496107_0108038
453 Ga0496108_0024281
454 Ga0496108_0054435
455 Ga0496109_0275432
456 Ga0496110_0047008
457 Ga0496112_0022317
458 Ga0496114_0063752
459 Ga0496114_0114140
460 Ga0496114_0309763
461 Ga0501069_0070754
462 Ga0501076_0534187
463 nmdc:mga00v17_97688_c1
464 nmdc:mga0yw44_189672_c1
465 nmdc:mga06z11_121812_c1
466 nmdc:mga05p37_5983_c1
467 nmdc:mga09592_124840_c1
468 nmdc:mga0qj67_199819_c1
469 nmdc:mga08y16_176168_c1
470 nmdc:mga08y16_49708_c1
471 nmdc:mga08y16_52485_c1
472 nmdc:mga08y16_7976_c1
473 nmdc:mga0rr50_460567_c1
474 nmdc:mga0a205_449176_c1
475 nmdc:mga0a205_494960_c1
476 Ga0495601_0010346
477 Ga0500651_0254965
478 Ga0500641_0005374
479 Ga0501084_0398663
480 Ga0466962_0016052

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12679

ABC2_membrane_2

ABC-2 family transporter protein

12

297

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
7o16-assembly1.cif.gz_D abc transporter nosdfy, nucleotide-free in lipid nanodisc, r-domain 3 0.6553 4 263
7fdv-assembly1.cif.gz_D cryo-em structure of the human cholesterol transporter abcg1 in complex with cholesterol 0.6505 9 260
7o0z-assembly1.cif.gz_D abc transporter nosfy, nucleotide-free in gdn 0.6487 3 263
7znq-assembly1.cif.gz_Y abc transporter complex nosdfyl in gdn 0.6443 4 264
7o16-assembly1.cif.gz_D abc transporter nosdfy, nucleotide-free in lipid nanodisc, r-domain 3 0.6426 4 263
ID Description Score Start End Superfamily
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6958 51 259 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.583 50 259 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5247 51 259 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.4413 50 259 3.40.1710.10
af_Q2G1V6_3_205_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.369 22 260 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A2V9G1Q9-F1-model_v4 ABC transporter domain-containing protein 0.9687 8 265 GO:0005524
GO:0005886
GO:0016887
GO:0140359
AF-A0A1F8R1S0-F1-model_v4 ABC transporter permease 0.967 47 255 GO:0005886
GO:0140359
AF-A0A2V9CZK5-F1-model_v4 ABC transporter permease 0.9641 6 265 GO:0005886
GO:0140359
AF-A0A7C2J592-F1-model_v4 ABC transporter permease 0.9637 44 260 GO:0005886
GO:0140359
AF-A0A2V9H136-F1-model_v4 ABC transporter permease 0.9621 99 258 GO:0016020

Map