F352658

General Info

Members Datasets Scaffolds Average Seq Length
240 95 480 136

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_101216497|Ga0070698_1012164971
Length 157
Sequence MLDGSNSSAAALLHSWTTRRFIVHSVEKPSLYDRLGGIYSIATVVDDFIDRVMQDPRLNANPLVDEAHHRVPPAGFKYLVTEMVCWAAGGPQKYTGKSMADSHAHLKITGEEWEAFMDDFQQTLDKFAVPAEEQAELKAIVNSTRSDIVVAPGAAVA

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
23 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
26 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
29 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
30 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
31 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
32 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
42 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
43 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
45 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
63 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
64 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
65 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
66 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
67 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
68 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
69 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
70 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
71 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
72 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
73 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
74 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
75 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
76 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
77 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
78 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
79 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
80 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
81 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
82 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
83 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
84 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
85 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
86 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
87 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
89 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
90 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
91 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
92 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
93 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
94 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
95 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.17
Metatranscriptomes 0.83
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.5
Rhizosphere 97.5
Stem 0
Stem Tuber 0
Unclassified 49.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_101216497 3300005471 Unclassified 703
2 SwRhRL2b_contig_1918067 2162886007 Unclassified 1777
3 Ga0065715_10406602 3300005293 Unclassified 875
4 Ga0065707_10014466 3300005295 Bacteria 2500
5 Ga0070688_100079171 3300005365 Unclassified 2122
6 Ga0070709_10007221 3300005434 Bacteria 6087
7 Ga0070709_10171889 3300005434 Bacteria 1515
8 Ga0070709_11427575 3300005434 Bacteria 561
9 Ga0070714_100080024 3300005435 Unclassified 2842
10 Ga0070714_101426700 3300005435 Unclassified 676
11 Ga0070713_100192737 3300005436 Bacteria 1837
12 Ga0070710_10051303 3300005437 Bacteria 2315
13 Ga0070710_11074002 3300005437 Unclassified 590
14 Ga0070711_100000920 3300005439 Bacteria 15540
15 Ga0070711_100238104 3300005439 Bacteria 1422
16 Ga0070711_100563326 3300005439 Bacteria 947
17 Ga0070711_100655286 3300005439 Unclassified 881
18 Ga0070708_100000537 3300005445 Bacteria 28528
19 Ga0070708_100006067 3300005445 Bacteria 9611
20 Ga0070708_100013784 3300005445 Bacteria 6634
21 Ga0070708_100016339 3300005445 Bacteria 6158
22 Ga0070708_100021049 3300005445 Bacteria 5507
23 Ga0070708_100048842 3300005445 Unclassified 3743
24 Ga0070708_100103977 3300005445 Bacteria 2604
25 Ga0070708_100531309 3300005445 Bacteria 1110
26 Ga0070708_100704754 3300005445 Bacteria 950
27 Ga0070708_101628504 3300005445 Unclassified 601
28 Ga0070706_100041750 3300005467 Unclassified 4235
29 Ga0070706_100049842 3300005467 Bacteria 3863
30 Ga0070706_100145394 3300005467 Unclassified 2214
31 Ga0070706_100187725 3300005467 Bacteria 1931
32 Ga0070706_100206623 3300005467 Unclassified 1834
33 Ga0070706_100283948 3300005467 Unclassified 1545
34 Ga0070706_100320098 3300005467 Unclassified 1446
35 Ga0070706_100409634 3300005467 Unclassified 1262
36 Ga0070706_100540988 3300005467 Unclassified 1083
37 Ga0070706_100625746 3300005467 Unclassified 1000
38 Ga0070706_100741968 3300005467 Unclassified 910
39 Ga0070706_100885957 3300005467 Unclassified 825
40 Ga0070706_100995699 3300005467 Unclassified 773
41 Ga0070706_101263621 3300005467 Bacteria 677
42 Ga0070706_101578111 3300005467 Unclassified 599
43 Ga0070707_100001780 3300005468 Bacteria 20725
44 Ga0070707_100017305 3300005468 Bacteria 6777
45 Ga0070707_100054865 3300005468 Bacteria 3821
46 Ga0070707_100149705 3300005468 Bacteria 2272
47 Ga0070707_100178168 3300005468 Bacteria 2072
48 Ga0070707_100222039 3300005468 Unclassified 1840
49 Ga0070707_100234550 3300005468 Bacteria 1786
50 Ga0070707_100241627 3300005468 Unclassified 1757
51 Ga0070707_100320939 3300005468 Unclassified 1505
52 Ga0070707_100344063 3300005468 Unclassified 1449
53 Ga0070707_100415449 3300005468 Unclassified 1306
54 Ga0070707_100551455 3300005468 Unclassified 1115
55 Ga0070707_100582864 3300005468 Unclassified 1081
56 Ga0070707_100722507 3300005468 Unclassified 959
57 Ga0070707_100962024 3300005468 Unclassified 819
58 Ga0070707_101317548 3300005468 Unclassified 688
59 Ga0070707_101366870 3300005468 Bacteria 675
60 Ga0070698_100004546 3300005471 Bacteria 15246
61 Ga0070698_100082487 3300005471 Bacteria 3207
62 Ga0070698_100108545 3300005471 Bacteria 2742
63 Ga0070698_100243740 3300005471 Unclassified 1730
64 Ga0070698_100375221 3300005471 Bacteria 1355
65 Ga0070698_100434974 3300005471 Unclassified 1247
66 Ga0070698_100761039 3300005471 Unclassified 912
67 Ga0070698_100787821 3300005471 Unclassified 894
68 Ga0070699_100046922 3300005518 Bacteria 3738
69 Ga0070699_100167339 3300005518 Bacteria 1947
70 Ga0070699_100263670 3300005518 Unclassified 1541
71 Ga0070699_100270149 3300005518 Bacteria 1522
72 Ga0070699_100393848 3300005518 Unclassified 1252
73 Ga0070699_100430594 3300005518 Unclassified 1195
74 Ga0070699_100657662 3300005518 Unclassified 957
75 Ga0070699_101009199 3300005518 Unclassified 763
76 Ga0070699_101557410 3300005518 Unclassified 606
77 Ga0070697_100001280 3300005536 Bacteria 18967
78 Ga0070697_100003709 3300005536 Bacteria 11738
79 Ga0070697_100090741 3300005536 Unclassified 2526
80 Ga0070697_100100667 3300005536 Bacteria 2400
81 Ga0070697_100137524 3300005536 Bacteria 2052
82 Ga0070697_100207912 3300005536 Bacteria 1665
83 Ga0070697_100212128 3300005536 Bacteria 1649
84 Ga0070697_101066656 3300005536 Unclassified 719
85 Ga0070697_101501734 3300005536 Unclassified 602
86 Ga0070697_101599882 3300005536 Unclassified 583
87 Ga0070704_101857430 3300005549 Unclassified 558
88 Ga0068863_102185133 3300005841 Unclassified 563
89 Ga0068858_100460648 3300005842 Unclassified 1226
90 Ga0068860_101395629 3300005843 Unclassified 722
91 Ga0081538_10146737 3300005981 Unclassified 1077
92 Ga0070717_10005019 3300006028 Bacteria 9637
93 Ga0070717_10037209 3300006028 Unclassified 3951
94 Ga0070717_10239125 3300006028 Bacteria 1601
95 Ga0070717_10326963 3300006028 Bacteria 1367
96 Ga0070717_10534256 3300006028 Bacteria 1061
97 Ga0070715_10043390 3300006163 Bacteria 1896
98 Ga0070715_10136904 3300006163 Unclassified 1185
99 Ga0070715_10730960 3300006163 Bacteria 594
100 Ga0070715_10934065 3300006163 Unclassified 536
101 Ga0070716_100007616 3300006173 Bacteria 5339
102 Ga0070716_100066202 3300006173 Unclassified 2107
103 Ga0070716_100119627 3300006173 Bacteria 1647
104 Ga0070716_100174615 3300006173 Bacteria 1405
105 Ga0070716_100669785 3300006173 Unclassified 789
106 Ga0070716_101202246 3300006173 Unclassified 609
107 Ga0070712_100000543 3300006175 Bacteria 21789
108 Ga0070712_100003169 3300006175 Bacteria 10137
109 Ga0070712_100182261 3300006175 Bacteria 1637
110 Ga0070712_100326283 3300006175 Bacteria 1249
111 Ga0068871_100759278 3300006358 Unclassified 892
112 Ga0075433_10026815 3300006852 Bacteria 4882
113 Ga0075433_10065504 3300006852 Unclassified 3187
114 Ga0075434_100113371 3300006871 Bacteria 2723
115 Ga0075434_101398195 3300006871 Bacteria 710
116 Ga0075436_100052434 3300006914 Bacteria 2816
117 Ga0075435_100001718 3300007076 Bacteria 14239
118 Ga0075435_100165825 3300007076 Bacteria 1863
119 Ga0099794_10090500 3300007265 Unclassified 1518
120 Ga0099794_10130843 3300007265 Unclassified 1267
121 Ga0099794_10224883 3300007265 Unclassified 965
122 Ga0099794_10603089 3300007265 Unclassified 581
123 Ga0099794_10615961 3300007265 Unclassified 575
124 Ga0099795_10068087 3300007788 Bacteria 1337
125 Ga0099795_10215933 3300007788 Unclassified 814
126 Ga0105247_10208639 3300009101 Bacteria 1317
127 Ga0114129_10071067 3300009147 Unclassified 4853
128 Ga0114129_10130930 3300009147 Bacteria 3445
129 Ga0105241_10018794 3300009174 Bacteria 5092
130 Ga0105248_12353170 3300009177 Unclassified 607
131 Ga0099796_10096261 3300010159 Bacteria 1107
132 Ga0099796_10301558 3300010159 Unclassified 679
133 Ga0099796_10362491 3300010159 Bacteria 627
134 Ga0099796_10469447 3300010159 Unclassified 561
135 Ga0157369_10340037 3300013105 Unclassified 1559
136 Ga0157374_10074724 3300013296 Unclassified 3201
137 Ga0157378_10021762 3300013297 Bacteria 5639
138 Ga0157378_12443806 3300013297 Unclassified 574
139 Ga0157372_10254047 3300013307 Bacteria 2041
140 Ga0157379_10223937 3300014968 Bacteria 1705
141 Ga0157376_10397325 3300014969 Unclassified 1332
142 Ga0224712_10196325 3300022467 Unclassified 916
143 Ga0228598_1004085 3300024227 Unclassified 3102
144 Ga0228598_1030034 3300024227 Bacteria 1069
145 Ga0228598_1062136 3300024227 Unclassified 744
146 Ga0207692_10686020 3300025898 Unclassified 664
147 Ga0207685_10329538 3300025905 Unclassified 764
148 Ga0207699_10023177 3300025906 Unclassified 3376
149 Ga0207684_10002205 3300025910 Bacteria 19896
150 Ga0207684_10023211 3300025910 Bacteria 5298
151 Ga0207684_10036589 3300025910 Bacteria 4166
152 Ga0207684_10051607 3300025910 Bacteria 3490
153 Ga0207684_10110501 3300025910 Unclassified 2353
154 Ga0207684_10119101 3300025910 Unclassified 2263
155 Ga0207684_10131111 3300025910 Bacteria 2151
156 Ga0207684_10156168 3300025910 Bacteria 1964
157 Ga0207684_10180152 3300025910 Bacteria 1822
158 Ga0207684_10184348 3300025910 Bacteria 1800
159 Ga0207684_10497882 3300025910 Unclassified 1045
160 Ga0207684_10816058 3300025910 Unclassified 788
161 Ga0207684_11580209 3300025910 Unclassified 532
162 Ga0207654_10418611 3300025911 Bacteria 934
163 Ga0207693_10000793 3300025915 Bacteria 28228
164 Ga0207693_10424534 3300025915 Unclassified 1039
165 Ga0207663_10059658 3300025916 Bacteria 2415
166 Ga0207663_10133232 3300025916 Unclassified 1720
167 Ga0207663_10250195 3300025916 Bacteria 1304
168 Ga0207663_10576123 3300025916 Unclassified 882
169 Ga0207646_10000015 3300025922 Bacteria 337243
170 Ga0207646_10025229 3300025922 Bacteria 5439
171 Ga0207646_10042913 3300025922 Bacteria 4064
172 Ga0207646_10050417 3300025922 Bacteria 3725
173 Ga0207646_10082259 3300025922 Bacteria 2879
174 Ga0207646_10128061 3300025922 Bacteria 2284
175 Ga0207646_10131606 3300025922 Unclassified 2252
176 Ga0207646_10177171 3300025922 Bacteria 1926
177 Ga0207646_10235127 3300025922 Unclassified 1656
178 Ga0207646_10260637 3300025922 Bacteria 1567
179 Ga0207646_10469425 3300025922 Unclassified 1135
180 Ga0207646_10481932 3300025922 Unclassified 1118
181 Ga0207646_10586781 3300025922 Bacteria 1001
182 Ga0207646_11490518 3300025922 Unclassified 586
183 Ga0207700_10188002 3300025928 Unclassified 1734
184 Ga0207664_10172971 3300025929 Unclassified 1850
185 Ga0207665_10012730 3300025939 Bacteria 5532
186 Ga0207665_10014789 3300025939 Bacteria 5131
187 Ga0207665_10095072 3300025939 Unclassified 2070
188 Ga0207665_10141617 3300025939 Bacteria 1715
189 Ga0207665_10232035 3300025939 Bacteria 1357
190 Ga0207665_10527524 3300025939 Unclassified 915
191 Ga0207665_11199352 3300025939 Unclassified 605
192 Ga0207703_11338912 3300026035 Unclassified 689
193 Ga0207641_11708649 3300026088 Unclassified 631
194 Ga0207675_101447016 3300026118 Unclassified 708
195 Ga0209588_1132818 3300027671 Unclassified 794
196 Ga0268265_10421831 3300028380 Unclassified 1239
197 Ga0268264_10939280 3300028381 Unclassified 870
198 Ga0265760_10162110 3300031090 Unclassified 738
199 Ga0373932_0167270 3300035112 Unclassified 764
200 Ga0373927_0021644 3300035695 Bacteria 4215
201 Ga0373947_1023767 3300035725 Unclassified 563
202 Ga0373925_0574023 3300037068 Unclassified 928
203 Ga0395899_0059174 3300037312 Bacteria 2824
204 Ga0395900_0051002 3300037418 Bacteria 4262
205 Ga0395900_1190202 3300037418 Unclassified 678
206 Ga0395900_1863346 3300037418 Unclassified 512
207 Ga0395898_0017266 3300037466 Bacteria 7371
208 Ga0395898_0384371 3300037466 Bacteria 1339
209 Ga0395905_0007573 3300037471 Bacteria 10789
210 Ga0395905_0069755 3300037471 Bacteria 3292
211 Ga0395901_0016857 3300038443 Bacteria 7445
212 Ga0451577_0447866 3300042876 Bacteria 1172
213 Ga0453683_0020596 3300044673 Unclassified 4214
214 Ga0453684_0025761 3300044712 Bacteria 8527
215 Ga0453684_0071490 3300044712 Bacteria 4386
216 Ga0453684_0328935 3300044712 Bacteria 1729
217 Ga0451576_0053807 3300045051 Bacteria 4215
218 Ga0495592_0148251 3300046454 Unclassified 1625
219 Ga0495664_0152878 3300046477 Bacteria 1400
220 Ga0495665_0173303 3300046531 Unclassified 1123
221 Ga0495645_0031453 3300046543 Bacteria 3868
222 Ga0495602_0563042 3300048088 Unclassified 788
223 Ga0496100_0138512 3300048903 Bacteria 1722
224 Ga0496103_0040357 3300048906 Unclassified 2868
225 Ga0496104_0136869 3300048907 Bacteria 2353
226 Ga0496106_0365283 3300048909 Unclassified 1159
227 Ga0496107_0207318 3300048910 Bacteria 1457
228 Ga0496115_0772576 3300048918 Unclassified 750
229 Ga0501040_0808465 3300049576 Bacteria 678
230 Ga0501080_1288311 3300049742 Bacteria 626
231 nmdc:mga05p37_135607_c1 3300050507 Bacteria 3019
232 nmdc:mga05p37_30276_c1 3300050507 Bacteria 6603
233 nmdc:mga0n895_1519_c1 3300050512 Bacteria 17416
234 nmdc:mga0rr50_180467_c1 3300050513 Bacteria 1725
235 nmdc:mga0rr50_3852_c1 3300050513 Bacteria 8719
236 nmdc:mga08x19_133335_c1 3300050514 Bacteria 1673
237 nmdc:mga0a205_61251_c1 3300050515 Unclassified 3635
238 nmdc:mga0a205_9484_c1 3300050515 Bacteria 8905
239 Ga0495601_0415880 3300053077 Unclassified 871
240 Ga0501084_0036190 3300054114 Bacteria 4124
241 Ga0070698_101216497
242 SwRhRL2b_contig_1918067
243 Ga0065715_10406602
244 Ga0065707_10014466
245 Ga0070688_100079171
246 Ga0070709_10007221
247 Ga0070709_10171889
248 Ga0070709_11427575
249 Ga0070714_100080024
250 Ga0070714_101426700
251 Ga0070713_100192737
252 Ga0070710_10051303
253 Ga0070710_11074002
254 Ga0070711_100000920
255 Ga0070711_100238104
256 Ga0070711_100563326
257 Ga0070711_100655286
258 Ga0070708_100000537
259 Ga0070708_100006067
260 Ga0070708_100013784
261 Ga0070708_100016339
262 Ga0070708_100021049
263 Ga0070708_100048842
264 Ga0070708_100103977
265 Ga0070708_100531309
266 Ga0070708_100704754
267 Ga0070708_101628504
268 Ga0070706_100041750
269 Ga0070706_100049842
270 Ga0070706_100145394
271 Ga0070706_100187725
272 Ga0070706_100206623
273 Ga0070706_100283948
274 Ga0070706_100320098
275 Ga0070706_100409634
276 Ga0070706_100540988
277 Ga0070706_100625746
278 Ga0070706_100741968
279 Ga0070706_100885957
280 Ga0070706_100995699
281 Ga0070706_101263621
282 Ga0070706_101578111
283 Ga0070707_100001780
284 Ga0070707_100017305
285 Ga0070707_100054865
286 Ga0070707_100149705
287 Ga0070707_100178168
288 Ga0070707_100222039
289 Ga0070707_100234550
290 Ga0070707_100241627
291 Ga0070707_100320939
292 Ga0070707_100344063
293 Ga0070707_100415449
294 Ga0070707_100551455
295 Ga0070707_100582864
296 Ga0070707_100722507
297 Ga0070707_100962024
298 Ga0070707_101317548
299 Ga0070707_101366870
300 Ga0070698_100004546
301 Ga0070698_100082487
302 Ga0070698_100108545
303 Ga0070698_100243740
304 Ga0070698_100375221
305 Ga0070698_100434974
306 Ga0070698_100761039
307 Ga0070698_100787821
308 Ga0070699_100046922
309 Ga0070699_100167339
310 Ga0070699_100263670
311 Ga0070699_100270149
312 Ga0070699_100393848
313 Ga0070699_100430594
314 Ga0070699_100657662
315 Ga0070699_101009199
316 Ga0070699_101557410
317 Ga0070697_100001280
318 Ga0070697_100003709
319 Ga0070697_100090741
320 Ga0070697_100100667
321 Ga0070697_100137524
322 Ga0070697_100207912
323 Ga0070697_100212128
324 Ga0070697_101066656
325 Ga0070697_101501734
326 Ga0070697_101599882
327 Ga0070704_101857430
328 Ga0068863_102185133
329 Ga0068858_100460648
330 Ga0068860_101395629
331 Ga0081538_10146737
332 Ga0070717_10005019
333 Ga0070717_10037209
334 Ga0070717_10239125
335 Ga0070717_10326963
336 Ga0070717_10534256
337 Ga0070715_10043390
338 Ga0070715_10136904
339 Ga0070715_10730960
340 Ga0070715_10934065
341 Ga0070716_100007616
342 Ga0070716_100066202
343 Ga0070716_100119627
344 Ga0070716_100174615
345 Ga0070716_100669785
346 Ga0070716_101202246
347 Ga0070712_100000543
348 Ga0070712_100003169
349 Ga0070712_100182261
350 Ga0070712_100326283
351 Ga0068871_100759278
352 Ga0075433_10026815
353 Ga0075433_10065504
354 Ga0075434_100113371
355 Ga0075434_101398195
356 Ga0075436_100052434
357 Ga0075435_100001718
358 Ga0075435_100165825
359 Ga0099794_10090500
360 Ga0099794_10130843
361 Ga0099794_10224883
362 Ga0099794_10603089
363 Ga0099794_10615961
364 Ga0099795_10068087
365 Ga0099795_10215933
366 Ga0105247_10208639
367 Ga0114129_10071067
368 Ga0114129_10130930
369 Ga0105241_10018794
370 Ga0105248_12353170
371 Ga0099796_10096261
372 Ga0099796_10301558
373 Ga0099796_10362491
374 Ga0099796_10469447
375 Ga0157369_10340037
376 Ga0157374_10074724
377 Ga0157378_10021762
378 Ga0157378_12443806
379 Ga0157372_10254047
380 Ga0157379_10223937
381 Ga0157376_10397325
382 Ga0224712_10196325
383 Ga0228598_1004085
384 Ga0228598_1030034
385 Ga0228598_1062136
386 Ga0207692_10686020
387 Ga0207685_10329538
388 Ga0207699_10023177
389 Ga0207684_10002205
390 Ga0207684_10023211
391 Ga0207684_10036589
392 Ga0207684_10051607
393 Ga0207684_10110501
394 Ga0207684_10119101
395 Ga0207684_10131111
396 Ga0207684_10156168
397 Ga0207684_10180152
398 Ga0207684_10184348
399 Ga0207684_10497882
400 Ga0207684_10816058
401 Ga0207684_11580209
402 Ga0207654_10418611
403 Ga0207693_10000793
404 Ga0207693_10424534
405 Ga0207663_10059658
406 Ga0207663_10133232
407 Ga0207663_10250195
408 Ga0207663_10576123
409 Ga0207646_10000015
410 Ga0207646_10025229
411 Ga0207646_10042913
412 Ga0207646_10050417
413 Ga0207646_10082259
414 Ga0207646_10128061
415 Ga0207646_10131606
416 Ga0207646_10177171
417 Ga0207646_10235127
418 Ga0207646_10260637
419 Ga0207646_10469425
420 Ga0207646_10481932
421 Ga0207646_10586781
422 Ga0207646_11490518
423 Ga0207700_10188002
424 Ga0207664_10172971
425 Ga0207665_10012730
426 Ga0207665_10014789
427 Ga0207665_10095072
428 Ga0207665_10141617
429 Ga0207665_10232035
430 Ga0207665_10527524
431 Ga0207665_11199352
432 Ga0207703_11338912
433 Ga0207641_11708649
434 Ga0207675_101447016
435 Ga0209588_1132818
436 Ga0268265_10421831
437 Ga0268264_10939280
438 Ga0265760_10162110
439 Ga0373932_0167270
440 Ga0373927_0021644
441 Ga0373947_1023767
442 Ga0373925_0574023
443 Ga0395899_0059174
444 Ga0395900_0051002
445 Ga0395900_1190202
446 Ga0395900_1863346
447 Ga0395898_0017266
448 Ga0395898_0384371
449 Ga0395905_0007573
450 Ga0395905_0069755
451 Ga0395901_0016857
452 Ga0451577_0447866
453 Ga0453683_0020596
454 Ga0453684_0025761
455 Ga0453684_0071490
456 Ga0453684_0328935
457 Ga0451576_0053807
458 Ga0495592_0148251
459 Ga0495664_0152878
460 Ga0495665_0173303
461 Ga0495645_0031453
462 Ga0495602_0563042
463 Ga0496100_0138512
464 Ga0496103_0040357
465 Ga0496104_0136869
466 Ga0496106_0365283
467 Ga0496107_0207318
468 Ga0496115_0772576
469 Ga0501040_0808465
470 Ga0501080_1288311
471 nmdc:mga05p37_135607_c1
472 nmdc:mga05p37_30276_c1
473 nmdc:mga0n895_1519_c1
474 nmdc:mga0rr50_180467_c1
475 nmdc:mga0rr50_3852_c1
476 nmdc:mga08x19_133335_c1
477 nmdc:mga0a205_61251_c1
478 nmdc:mga0a205_9484_c1
479 Ga0495601_0415880
480 Ga0501084_0036190

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01152

Bac_globin

Bacterial-like globin

30

150

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gl3-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis trhbn, tyrb10phe glne11val mutant 0.9038 4 129
3aq8-assembly1.cif.gz_A crystal structure of truncated hemoglobin from tetrahymena pyriformis, q46e mutant, fe(iii) form 0.9011 8 128
3aq7-assembly1.cif.gz_A crystal structure of truncated hemoglobin from tetrahymena pyriformis, y25f mutant, fe(iii) form 0.9005 8 128
2gkm-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis trhbn tyrb10phe mutant 0.8978 4 129
3aq6-assembly2.cif.gz_B crystal structure of truncated hemoglobin from tetrahymena pyriformis, fe(iii) form 0.8952 8 128
ID Description Score Start End Superfamily
3aq5A00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.902 8 128 1.10.490.10
af_P9WN25_1_136_1.10.490.10 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.8849 2 132 1.10.490.10
3aq5A00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.8807 8 128 1.10.490.10
1uvxA00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.8589 9 128 1.10.490.10
6ciiA00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.8575 9 128 1.10.490.10
ID Description Score Start End GO Terms
AF-A0A4P5XQ10-F1-model_v4 Group 1 truncated hemoglobin 0.9938 6 128 GO:0019825
GO:0020037
GO:0046872
AF-A0A1Q7ZRS0-F1-model_v4 Group 1 truncated hemoglobin 0.99 3 123 GO:0019825
GO:0020037
GO:0046872
AF-A0A4U1GZH9-F1-model_v4 deleted 0.9875 1 129
AF-A0A2V5V4G4-F1-model_v4 Group 1 truncated hemoglobin 0.9832 1 112 GO:0019825
GO:0020037
GO:0046872
AF-A0A2V8F4K8-F1-model_v4 Group 1 truncated hemoglobin 0.9794 53 129 GO:0015671
GO:0019825
GO:0020037
GO:0046872

Map