F352137

General Info

Members Datasets Scaffolds Average Seq Length
239 139 478 424

Family's Representative Sequence

Representative Sequence 3300039062|Ga0400483_199265|Ga0400483_199265_83_1441
Length 452
Sequence MTELPKPPDLGCRDTPILKERGQHEVFCGLTGIIWLHRKIQDAFFLVIGSRTCAHLLQSAAGVMIFAEPRFGTAILEETDLAGLADAHAELDKVVGQLLERRPDIRQLFLVGSCPSEVIKLDLARAAERLTQEHAPHVRVLNFSGSGIETTFTQGEDACLASIVPVLPETNERQLLLAGALPDVVQDQALSLLQAMGITAKVLPAPRSDSDLAVGPNTLFALTQPFLGDTHAALTRRGATHIAAPFPFGEEGTTAWLRAIADQFDVSPQTFAAATDAPRARARKAIANASEALRGKRIFFFPDSQLEIPLARFLTRECGMEAVEVGAPFIHKGLVSPDLDLLPAGPVISEGQDVELQLDRCKAARPDLTVCGLGLANPLEAEGLPTKWAIELVFTPVHFYDQAGDLAGLFSRPVRRRDGLRLDAPPDASSLSKYGGGAPQARGQSPQSGAGS

Samples

Sample ID Description Type Environment
1 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
11 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
12 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
13 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
14 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
15 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
16 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
17 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
18 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
19 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
20 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
21 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
22 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
31 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
33 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
34 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
35 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
36 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
37 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
38 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
39 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
40 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
41 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
42 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
43 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
44 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
45 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
46 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
47 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
48 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
49 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
50 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
51 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
52 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
53 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
54 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
55 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
56 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
57 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
58 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
59 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
60 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
61 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
62 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
63 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
64 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
65 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
66 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
67 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
68 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
69 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
70 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
71 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
72 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
73 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
74 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
75 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
76 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
77 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
78 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
79 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
80 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
81 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
82 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
83 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
84 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
85 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
86 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
87 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
88 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
89 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
90 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
91 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
96 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
97 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
98 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
99 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
100 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
101 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
102 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
103 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
104 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
105 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
106 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
107 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
108 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
109 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
110 2643221585 Pelomonas sp. Root662 Isolate Unclassified
111 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
112 2643221656 Pelomonas sp. Root405 Isolate Unclassified
113 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
114 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
115 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
116 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
117 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
118 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
119 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
120 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
121 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
122 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
123 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
124 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
125 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
126 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
127 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
128 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
129 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
130 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
131 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
132 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
133 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
134 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
135 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
136 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
137 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
138 641522639 Methylobacterium sp. 4-46 Isolate Nodule
139 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 82.85
Metatranscriptomes 3.77
Isolates 13.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.69
Nodule 1.26
Rhizoplane 1.26
Rhizosphere 72.8
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0400483_199265 3300039062 Bacteria 3881
2 JGI25153J46596_10002753 3300003215 Bacteria 10005
3 JGI25160J50197_1004052 3300003354 Bacteria 6386
4 Ga0065165_1000694 3300005262 Bacteria 48071
5 Ga0065165_1007088 3300005262 Bacteria 5630
6 Ga0070658_10006327 3300005327 Bacteria 9595
7 Ga0070682_100102577 3300005337 Bacteria 1891
8 Ga0070673_100081307 3300005364 Bacteria 2627
9 Ga0070711_100024925 3300005439 Bacteria 3909
10 Ga0070663_100024219 3300005455 Bacteria 4082
11 Ga0070663_100228191 3300005455 Bacteria 1465
12 Ga0070672_100060844 3300005543 Bacteria 2975
13 Ga0070665_100008387 3300005548 Bacteria 10452
14 Ga0070665_100053909 3300005548 Bacteria 4033
15 Ga0070665_100196447 3300005548 Bacteria 2018
16 Ga0070665_100271881 3300005548 Bacteria 1696
17 Ga0068852_100060832 3300005616 Bacteria 3280
18 Ga0081540_1000942 3300005983 Bacteria 26195
19 Ga0105240_10063903 3300009093 Bacteria 4576
20 Ga0163163_10116064 3300014325 Bacteria 2708
21 Ga0213874_10010002 3300021377 Bacteria 2363
22 Ga0213876_10003676 3300021384 Bacteria 8705
23 Ga0213875_10012476 3300021388 Bacteria 4194
24 Ga0213871_10004782 3300021441 Bacteria 2741
25 Ga0209758_1000557 3300025297 Bacteria 58827
26 Ga0207426_1000712 3300025302 Bacteria 38841
27 Ga0207705_10016509 3300025909 Bacteria 5290
28 Ga0207695_10058268 3300025913 Bacteria 4009
29 Ga0207691_10051244 3300025940 Bacteria 3775
30 Ga0207639_10249330 3300026041 Bacteria 1548
31 Ga0207678_10020458 3300026067 Bacteria 5804
32 Ga0207678_10117414 3300026067 Bacteria 2270
33 Ga0207702_10183272 3300026078 Bacteria 1929
34 Ga0207683_10141331 3300026121 Bacteria 2169
35 Ga0207698_10144310 3300026142 Bacteria 2056
36 Ga0209966_1000013 3300027695 Bacteria 83121
37 Ga0268266_10025393 3300028379 Bacteria 5040
38 Ga0268266_10239790 3300028379 Bacteria 1673
39 Ga0265337_1008018 3300028556 Bacteria 3885
40 Ga0265334_10000294 3300028573 Bacteria 27911
41 Ga0265334_10001855 3300028573 Bacteria 10057
42 Ga0265334_10029326 3300028573 Bacteria 2206
43 Ga0265318_10001380 3300028577 Bacteria 14413
44 Ga0265323_10005651 3300028653 Bacteria 5305
45 Ga0265322_10011688 3300028654 Bacteria 2542
46 Ga0265338_10000081 3300028800 Bacteria 176402
47 Ga0265338_10026338 3300028800 Bacteria 5869
48 Ga0265338_10031815 3300028800 Bacteria 5163
49 Ga0265332_10006020 3300031238 Bacteria 5545
50 Ga0265332_10028742 3300031238 Bacteria 2432
51 Ga0265328_10014612 3300031239 Bacteria 3088
52 Ga0265320_10017189 3300031240 Bacteria 4026
53 Ga0265325_10000622 3300031241 Bacteria 25870
54 Ga0265325_10046552 3300031241 Bacteria 2249
55 Ga0265329_10004922 3300031242 Bacteria 5471
56 Ga0265329_10027224 3300031242 Bacteria 1880
57 Ga0265340_10018839 3300031247 Bacteria 3557
58 Ga0265340_10067890 3300031247 Bacteria 1694
59 Ga0265339_10001469 3300031249 Bacteria 17412
60 Ga0265339_10011229 3300031249 Bacteria 5525
61 Ga0265339_10030894 3300031249 Bacteria 3030
62 Ga0265331_10004809 3300031250 Bacteria 8316
63 Ga0265327_10008611 3300031251 Bacteria 7564
64 Ga0265327_10011863 3300031251 Bacteria 5954
65 Ga0265316_10009722 3300031344 Bacteria 8828
66 Ga0265316_10037710 3300031344 Bacteria 3898
67 Ga0265313_10001758 3300031595 Bacteria 19875
68 Ga0265313_10004120 3300031595 Bacteria 11311
69 Ga0316575_10020632 3300031665 Bacteria 2529
70 Ga0316579_10005442 3300031691 Bacteria 5141
71 Ga0316579_10008717 3300031691 Bacteria 4239
72 Ga0316579_10010176 3300031691 Bacteria 3970
73 Ga0316579_10049677 3300031691 Bacteria 1960
74 Ga0265314_10012090 3300031711 Bacteria 7072
75 Ga0265314_10022996 3300031711 Bacteria 4764
76 Ga0265342_10000087 3300031712 Bacteria 100045
77 Ga0265342_10006928 3300031712 Bacteria 8377
78 Ga0265342_10012295 3300031712 Bacteria 5802
79 Ga0316576_10000980 3300031727 Bacteria 14661
80 Ga0316576_10001052 3300031727 Bacteria 14328
81 Ga0316576_10002831 3300031727 Bacteria 9988
82 Ga0316576_10003903 3300031727 Bacteria 8838
83 Ga0316576_10004118 3300031727 Bacteria 8673
84 Ga0316576_10007038 3300031727 Bacteria 7043
85 Ga0316576_10013682 3300031727 Bacteria 5403
86 Ga0316576_10014229 3300031727 Bacteria 5312
87 Ga0316576_10021260 3300031727 Bacteria 4484
88 Ga0316576_10037703 3300031727 Bacteria 3462
89 Ga0316576_10047447 3300031727 Bacteria 3112
90 Ga0316578_10000862 3300031728 Bacteria 11381
91 Ga0316578_10001976 3300031728 Bacteria 8697
92 Ga0316578_10009373 3300031728 Bacteria 5035
93 Ga0316578_10021444 3300031728 Bacteria 3586
94 Ga0316578_10035614 3300031728 Bacteria 2862
95 Ga0316578_10036665 3300031728 Bacteria 2823
96 Ga0316577_10000523 3300031733 Bacteria 15428
97 Ga0316577_10003091 3300031733 Bacteria 8359
98 Ga0316577_10003321 3300031733 Bacteria 8105
99 Ga0316577_10099342 3300031733 Bacteria 1631
100 Ga0316583_10004398 3300032133 Bacteria 5025
101 Ga0316585_10000478 3300032137 Bacteria 9436
102 Ga0316585_10011234 3300032137 Bacteria 2638
103 Ga0316580_10000394 3300032139 Bacteria 9875
104 Ga0316580_10000729 3300032139 Bacteria 7951
105 Ga0316580_10001056 3300032139 Bacteria 6921
106 Ga0316593_10015990 3300032168 Bacteria 2267
107 Ga0316592_1007555 3300033524 Bacteria 2127
108 Ga0316586_1000371 3300033527 Bacteria 4227
109 Ga0316586_1007627 3300033527 Bacteria 1582
110 Ga0316588_1000028 3300033528 Bacteria 10646
111 Ga0316588_1000310 3300033528 Bacteria 6133
112 Ga0316588_1000352 3300033528 Bacteria 5942
113 Ga0316588_1000383 3300033528 Bacteria 5819
114 Ga0316588_1002842 3300033528 Bacteria 3075
115 Ga0373936_0033461 3300035113 Bacteria 2038
116 Ga0316574_0000209 3300035398 Bacteria 20562
117 Ga0316574_0000869 3300035398 Bacteria 13319
118 Ga0316574_0003388 3300035398 Bacteria 8206
119 Ga0316574_0007247 3300035398 Bacteria 6066
120 Ga0316574_0015799 3300035398 Bacteria 4384
121 Ga0316574_0022452 3300035398 Bacteria 3755
122 Ga0316574_0081089 3300035398 Bacteria 2060
123 Ga0316574_0233103 3300035398 Bacteria 1178
124 Ga0373931_0048358 3300035691 Bacteria 2255
125 Ga0316582_0001337 3300036647 Bacteria 10703
126 Ga0316582_0004997 3300036647 Bacteria 6781
127 Ga0316582_0016030 3300036647 Bacteria 4301
128 Ga0316584_0000497 3300036712 Bacteria 20762
129 Ga0316584_0001316 3300036712 Bacteria 14686
130 Ga0316584_0002621 3300036712 Bacteria 11464
131 Ga0316584_0007282 3300036712 Bacteria 7554
132 Ga0316584_0022236 3300036712 Bacteria 4623
133 Ga0316584_0024187 3300036712 Bacteria 4444
134 Ga0316584_0027349 3300036712 Bacteria 4197
135 Ga0316584_0030116 3300036712 Bacteria 4009
136 Ga0316584_0077153 3300036712 Bacteria 2496
137 Ga0316584_0117122 3300036712 Bacteria 1992
138 Ga0395898_0101758 3300037466 Bacteria 2759
139 Ga0436364_0328296 3300037853 Bacteria 143298
140 Ga0400483_118393 3300039062 Bacteria 8960
141 Ga0400483_124348 3300039062 Bacteria 2461
142 Ga0400483_182099 3300039062 Bacteria 3225
143 Ga0400483_191600 3300039062 Bacteria 2427
144 Ga0400483_196022 3300039062 Bacteria 4088
145 Ga0400483_212777 3300039062 Bacteria 18396
146 Ga0400483_252150 3300039062 Bacteria 2842
147 Ga0400483_274449 3300039062 Bacteria 4197
148 Ga0436365_0046500 3300039437 Bacteria 4139
149 Ga0436365_1138651 3300039437 Bacteria 6688
150 Ga0436361_1177758 3300039447 Bacteria 2804
151 Ga0436363_0830305 3300039450 Bacteria 3443
152 Ga0451577_0000001 3300042876 Bacteria 2461803
153 Ga0451577_0002497 3300042876 Bacteria 21820
154 Ga0451577_0003534 3300042876 Bacteria 17289
155 Ga0451577_0005404 3300042876 Bacteria 13106
156 Ga0451577_0015632 3300042876 Bacteria 7052
157 Ga0451577_0048625 3300042876 Bacteria 3788
158 Ga0451577_0068057 3300042876 Bacteria 3176
159 Ga0451577_0069020 3300042876 Bacteria 3152
160 Ga0451577_0208882 3300042876 Bacteria 1763
161 Ga0453684_0048775 3300044712 Bacteria 5593
162 Ga0453684_0061002 3300044712 Bacteria 4844
163 Ga0453684_0260405 3300044712 Bacteria 1987
164 Ga0466968_0002455 3300044735 Bacteria 6801
165 Ga0466960_0042831 3300044901 Bacteria 2151
166 Ga0451576_0000122 3300045051 Bacteria 197797
167 Ga0451576_0001261 3300045051 Bacteria 44384
168 Ga0451576_0002473 3300045051 Bacteria 27484
169 Ga0451576_0025907 3300045051 Bacteria 6315
170 Ga0451576_0053936 3300045051 Bacteria 4209
171 Ga0451576_0166918 3300045051 Bacteria 2297
172 Ga0451576_0196713 3300045051 Bacteria 2106
173 Ga0451576_0453698 3300045051 Bacteria 1346
174 Ga0495629_0012579 3300046459 Bacteria 6128
175 Ga0495650_0004238 3300046471 Bacteria 9924
176 Ga0495607_0064773 3300046501 Bacteria 2063
177 Ga0495606_0089945 3300046507 Bacteria 1890
178 Ga0495640_0058217 3300046533 Bacteria 2636
179 Ga0495684_0040828 3300047471 Bacteria 3556
180 Ga0495686_0007202 3300047472 Bacteria 8376
181 Ga0496102_0092768 3300048905 Bacteria 2797
182 Ga0496108_0116058 3300048911 Bacteria 2293
183 Ga0496112_0001652 3300048915 Bacteria 17324
184 Ga0496121_0024321 3300048924 Bacteria 5798
185 Ga0496124_0141998 3300048927 Bacteria 1894
186 Ga0496126_0055532 3300048929 Bacteria 3583
187 Ga0501032_0030017 3300049569 Bacteria 3729
188 Ga0501032_0136070 3300049569 Bacteria 1619
189 Ga0501037_0123453 3300049573 Bacteria 1860
190 Ga0501038_0045134 3300049574 Bacteria 3826
191 Ga0501039_0072577 3300049575 Bacteria 2674
192 Ga0501076_0107089 3300049592 Bacteria 2257
193 Ga0501280_000715 3300049776 Bacteria 7356
194 Ga0501044_0002706 3300049823 Bacteria 20150
195 Ga0501044_0103874 3300049823 Bacteria 2856
196 Ga0501044_0376287 3300049823 Bacteria 1336
197 Ga0500635_0000034 3300053080 Bacteria 96919
198 Ga0495619_0283560 3300053085 Bacteria 1148
199 Ga0500644_0001793 3300053088 Bacteria 5548
200 Ga0500641_0000410 3300053096 Bacteria 15886
201 Ga0500641_0001646 3300053096 Bacteria 7962
202 Ga0500595_000084 3300053119 Bacteria 66292
203 Ga0500614_001731 3300053123 Bacteria 5086
204 Ga0500559_0003150 3300053136 Bacteria 8189
205 Ga0500589_005708 3300053147 Bacteria 4885
206 Ga0500620_031078 3300053155 Bacteria 1691
207 Ga0500636_0119905 3300053177 Bacteria 1477
208 2545674134 2545555834 Bacteria 8130841
209 2596371372 2595698237 Bacteria 6712432
210 2643937303 2643221585 Bacteria 5812563
211 2644301494 2643221654 Bacteria 5273570
212 2644318468 2643221656 Bacteria 5809961
213 2738708958 2738541275 Bacteria 4830863
214 2738744041 2738541281 Bacteria 5112672
215 2738847383 2738541301 Bacteria 4834102
216 2738863112 2738541304 Bacteria 4833665
217 2739295630 2738543022 Bacteria 4835059
218 2739353271 2738543032 Bacteria 5115625
219 2739357308 2738543033 Bacteria 4833336
220 2829750140 2829745981 Bacteria 5406054
221 2837681409 2837678835 Bacteria 5252418
222 2842336636 2842333319 Bacteria 8899485
223 2842701512 2842698319 Bacteria 5190321
224 2844315629 2844315083 Bacteria 8138177
225 2854685481 2854681122 Bacteria 4548679
226 2861692886 2861691609 Bacteria 5628931
227 2888389541 2888388044 Bacteria 7304136
228 2889306710 2889306138 Bacteria 6358934
229 2894777052 2894772417 Bacteria 5305674
230 2902409642 2902405164 Bacteria 6784948
231 2903732677 2903727486 Bacteria 8281579
232 2906605445 2906602504 Bacteria 8295279
233 2919681540 2919679072 Bacteria 4629602
234 2928102284 2928100450 Bacteria 4837635
235 2928126306 2928125067 Bacteria 5937560
236 2928961214 2928959182 Bacteria 4725774
237 3003671103 3003665799 Bacteria 7279786
238 641643888 641522639 Bacteria 7737025
239 8045864961 8045864390 Bacteria 5043873
240 Ga0400483_199265
241 JGI25153J46596_10002753
242 JGI25160J50197_1004052
243 Ga0065165_1000694
244 Ga0065165_1007088
245 Ga0070658_10006327
246 Ga0070682_100102577
247 Ga0070673_100081307
248 Ga0070711_100024925
249 Ga0070663_100024219
250 Ga0070663_100228191
251 Ga0070672_100060844
252 Ga0070665_100008387
253 Ga0070665_100053909
254 Ga0070665_100196447
255 Ga0070665_100271881
256 Ga0068852_100060832
257 Ga0081540_1000942
258 Ga0105240_10063903
259 Ga0163163_10116064
260 Ga0213874_10010002
261 Ga0213876_10003676
262 Ga0213875_10012476
263 Ga0213871_10004782
264 Ga0209758_1000557
265 Ga0207426_1000712
266 Ga0207705_10016509
267 Ga0207695_10058268
268 Ga0207691_10051244
269 Ga0207639_10249330
270 Ga0207678_10020458
271 Ga0207678_10117414
272 Ga0207702_10183272
273 Ga0207683_10141331
274 Ga0207698_10144310
275 Ga0209966_1000013
276 Ga0268266_10025393
277 Ga0268266_10239790
278 Ga0265337_1008018
279 Ga0265334_10000294
280 Ga0265334_10001855
281 Ga0265334_10029326
282 Ga0265318_10001380
283 Ga0265323_10005651
284 Ga0265322_10011688
285 Ga0265338_10000081
286 Ga0265338_10026338
287 Ga0265338_10031815
288 Ga0265332_10006020
289 Ga0265332_10028742
290 Ga0265328_10014612
291 Ga0265320_10017189
292 Ga0265325_10000622
293 Ga0265325_10046552
294 Ga0265329_10004922
295 Ga0265329_10027224
296 Ga0265340_10018839
297 Ga0265340_10067890
298 Ga0265339_10001469
299 Ga0265339_10011229
300 Ga0265339_10030894
301 Ga0265331_10004809
302 Ga0265327_10008611
303 Ga0265327_10011863
304 Ga0265316_10009722
305 Ga0265316_10037710
306 Ga0265313_10001758
307 Ga0265313_10004120
308 Ga0316575_10020632
309 Ga0316579_10005442
310 Ga0316579_10008717
311 Ga0316579_10010176
312 Ga0316579_10049677
313 Ga0265314_10012090
314 Ga0265314_10022996
315 Ga0265342_10000087
316 Ga0265342_10006928
317 Ga0265342_10012295
318 Ga0316576_10000980
319 Ga0316576_10001052
320 Ga0316576_10002831
321 Ga0316576_10003903
322 Ga0316576_10004118
323 Ga0316576_10007038
324 Ga0316576_10013682
325 Ga0316576_10014229
326 Ga0316576_10021260
327 Ga0316576_10037703
328 Ga0316576_10047447
329 Ga0316578_10000862
330 Ga0316578_10001976
331 Ga0316578_10009373
332 Ga0316578_10021444
333 Ga0316578_10035614
334 Ga0316578_10036665
335 Ga0316577_10000523
336 Ga0316577_10003091
337 Ga0316577_10003321
338 Ga0316577_10099342
339 Ga0316583_10004398
340 Ga0316585_10000478
341 Ga0316585_10011234
342 Ga0316580_10000394
343 Ga0316580_10000729
344 Ga0316580_10001056
345 Ga0316593_10015990
346 Ga0316592_1007555
347 Ga0316586_1000371
348 Ga0316586_1007627
349 Ga0316588_1000028
350 Ga0316588_1000310
351 Ga0316588_1000352
352 Ga0316588_1000383
353 Ga0316588_1002842
354 Ga0373936_0033461
355 Ga0316574_0000209
356 Ga0316574_0000869
357 Ga0316574_0003388
358 Ga0316574_0007247
359 Ga0316574_0015799
360 Ga0316574_0022452
361 Ga0316574_0081089
362 Ga0316574_0233103
363 Ga0373931_0048358
364 Ga0316582_0001337
365 Ga0316582_0004997
366 Ga0316582_0016030
367 Ga0316584_0000497
368 Ga0316584_0001316
369 Ga0316584_0002621
370 Ga0316584_0007282
371 Ga0316584_0022236
372 Ga0316584_0024187
373 Ga0316584_0027349
374 Ga0316584_0030116
375 Ga0316584_0077153
376 Ga0316584_0117122
377 Ga0395898_0101758
378 Ga0436364_0328296
379 Ga0400483_118393
380 Ga0400483_124348
381 Ga0400483_182099
382 Ga0400483_191600
383 Ga0400483_196022
384 Ga0400483_212777
385 Ga0400483_252150
386 Ga0400483_274449
387 Ga0436365_0046500
388 Ga0436365_1138651
389 Ga0436361_1177758
390 Ga0436363_0830305
391 Ga0451577_0000001
392 Ga0451577_0002497
393 Ga0451577_0003534
394 Ga0451577_0005404
395 Ga0451577_0015632
396 Ga0451577_0048625
397 Ga0451577_0068057
398 Ga0451577_0069020
399 Ga0451577_0208882
400 Ga0453684_0048775
401 Ga0453684_0061002
402 Ga0453684_0260405
403 Ga0466968_0002455
404 Ga0466960_0042831
405 Ga0451576_0000122
406 Ga0451576_0001261
407 Ga0451576_0002473
408 Ga0451576_0025907
409 Ga0451576_0053936
410 Ga0451576_0166918
411 Ga0451576_0196713
412 Ga0451576_0453698
413 Ga0495629_0012579
414 Ga0495650_0004238
415 Ga0495607_0064773
416 Ga0495606_0089945
417 Ga0495640_0058217
418 Ga0495684_0040828
419 Ga0495686_0007202
420 Ga0496102_0092768
421 Ga0496108_0116058
422 Ga0496112_0001652
423 Ga0496121_0024321
424 Ga0496124_0141998
425 Ga0496126_0055532
426 Ga0501032_0030017
427 Ga0501032_0136070
428 Ga0501037_0123453
429 Ga0501038_0045134
430 Ga0501039_0072577
431 Ga0501076_0107089
432 Ga0501280_000715
433 Ga0501044_0002706
434 Ga0501044_0103874
435 Ga0501044_0376287
436 Ga0500635_0000034
437 Ga0495619_0283560
438 Ga0500644_0001793
439 Ga0500641_0000410
440 Ga0500641_0001646
441 Ga0500595_000084
442 Ga0500614_001731
443 Ga0500559_0003150
444 Ga0500589_005708
445 Ga0500620_031078
446 Ga0500636_0119905
447 2545674134
448 2596371372
449 2643937303
450 2644301494
451 2644318468
452 2738708958
453 2738744041
454 2738847383
455 2738863112
456 2739295630
457 2739353271
458 2739357308
459 2829750140
460 2837681409
461 2842336636
462 2842701512
463 2844315629
464 2854685481
465 2861692886
466 2888389541
467 2889306710
468 2894777052
469 2902409642
470 2903732677
471 2906605445
472 2919681540
473 2928102284
474 2928126306
475 2928961214
476 3003671103
477 641643888
478 8045864961

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00148

Oxidored_nitro

Nitrogenase component 1 type Oxidoreductase

28

410

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3aeq-assembly1.cif.gz_A structure of the light-independent protochlorophyllide reductase catalyzing a key reduction for greening in the dark 0.9628 18 427
2ynm-assembly1.cif.gz_C-2 structure of the adpxalf3-stabilized transition state of the nitrogenase-like dark-operative protochlorophyllide oxidoreductase complex from prochlorococcus marinus with its substrate protochlorophyllide a 0.9579 19 425
3aeq-assembly1.cif.gz_A structure of the light-independent protochlorophyllide reductase catalyzing a key reduction for greening in the dark 0.9447 18 427
2ynm-assembly1.cif.gz_C-2 structure of the adpxalf3-stabilized transition state of the nitrogenase-like dark-operative protochlorophyllide oxidoreductase complex from prochlorococcus marinus with its substrate protochlorophyllide a 0.9289 19 425
2xdq-assembly1.cif.gz_A-2 dark operative protochlorophyllide oxidoreductase (chln-chlb)2 complex 0.9111 16 427
ID Description Score Start End Superfamily
2ynmC03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9812 170 291 3.40.50.1980
3aekA03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9804 170 292 3.40.50.1980
3aesC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9619 295 425 3.40.50.1980
3aekA03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9569 170 292 3.40.50.1980
2ynmC03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.95 170 291 3.40.50.1980
ID Description Score Start End GO Terms
AF-A0A2N7XUC3-F1-model_v4 Ferredoxin:protochlorophyllide reductase (ATP-dependent) subunit N 1.002 195 286 GO:0015979
GO:0015995
AF-A0A2S5MGW8-F1-model_v4 Ferredoxin:protochlorophyllide reductase (ATP-dependent) subunit N 0.9921 197 425 GO:0015979
GO:0015995
GO:0016491
AF-A0A2P5ME58-F1-model_v4 Ferredoxin:protochlorophyllide reductase (ATP-dependent) subunit N 0.9906 239 425 GO:0015979
GO:0015995
GO:0016491
AF-A0A4Q4D0C5-F1-model_v4 Ferredoxin:protochlorophyllide reductase (ATP-dependent) subunit N 0.9881 178 427 GO:0015979
GO:0015995
GO:0016491
AF-A0A352CEM2-F1-model_v4 Ferredoxin:protochlorophyllide reductase (ATP-dependent) subunit N 0.9864 277 364

Map