F352137
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 239 | 139 | 478 | 424 |
Family's Representative Sequence
| Representative Sequence | 3300039062|Ga0400483_199265|Ga0400483_199265_83_1441 |
| Length | 452 |
| Sequence | MTELPKPPDLGCRDTPILKERGQHEVFCGLTGIIWLHRKIQDAFFLVIGSRTCAHLLQSAAGVMIFAEPRFGTAILEETDLAGLADAHAELDKVVGQLLERRPDIRQLFLVGSCPSEVIKLDLARAAERLTQEHAPHVRVLNFSGSGIETTFTQGEDACLASIVPVLPETNERQLLLAGALPDVVQDQALSLLQAMGITAKVLPAPRSDSDLAVGPNTLFALTQPFLGDTHAALTRRGATHIAAPFPFGEEGTTAWLRAIADQFDVSPQTFAAATDAPRARARKAIANASEALRGKRIFFFPDSQLEIPLARFLTRECGMEAVEVGAPFIHKGLVSPDLDLLPAGPVISEGQDVELQLDRCKAARPDLTVCGLGLANPLEAEGLPTKWAIELVFTPVHFYDQAGDLAGLFSRPVRRRDGLRLDAPPDASSLSKYGGGAPQARGQSPQSGAGS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 2 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 3 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 4 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 13 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 14 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 15 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 16 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 17 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 18 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 19 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 20 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 21 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 22 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 23 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 24 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 25 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 26 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 27 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 28 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 29 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 31 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 33 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 34 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 35 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 36 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 37 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 38 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 39 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 40 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 41 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 42 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 43 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 44 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 45 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 46 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 47 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 48 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 49 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 50 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 51 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 52 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 53 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 54 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 55 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 56 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 57 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 58 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 59 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 60 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 61 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 62 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 63 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 64 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 65 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 66 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 67 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 68 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 69 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 70 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 71 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 72 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 73 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 74 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 75 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 76 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 77 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 78 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 86 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 87 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 88 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 89 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 90 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 91 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 92 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 93 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 94 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 95 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 96 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 97 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 98 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 99 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 101 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 102 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 103 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 104 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 105 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 106 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 107 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 108 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 109 | 2595698237 | Methylobacterium sp. UNCCL125 | Isolate | Unclassified |
| 110 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 111 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 112 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 113 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 114 | 2738541281 | Methylobacterium sp. GV094 | Isolate | Unclassified |
| 115 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 116 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 117 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 118 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 119 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 120 | 2829745981 | Methylorubrum rhodinum DSM 2163 | Isolate | Rhizosphere |
| 121 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 122 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 123 | 2842698319 | Methylobacterium sp. R-72139 | Isolate | Unclassified |
| 124 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 125 | 2854681122 | Luteovulum sphaeroides SCJ | Isolate | Unclassified |
| 126 | 2861691609 | Methylorubrum thiocyanatum DSM 11490 | Isolate | Rhizosphere |
| 127 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 128 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 129 | 2894772417 | Roseomonas oryzicola KCTC 22478 | Isolate | Rhizosphere |
| 130 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 131 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 132 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 133 | 2919679072 | Pseudotabrizicola sp. 4114 | Isolate | Unclassified |
| 134 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 135 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 136 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 137 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 138 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 139 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.85 |
| Metatranscriptomes | 3.77 |
| Isolates | 13.39 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.69 |
| Nodule | 1.26 |
| Rhizoplane | 1.26 |
| Rhizosphere | 72.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0400483_199265 | 3300039062 | Bacteria | 3881 |
| 2 | JGI25153J46596_10002753 | 3300003215 | Bacteria | 10005 |
| 3 | JGI25160J50197_1004052 | 3300003354 | Bacteria | 6386 |
| 4 | Ga0065165_1000694 | 3300005262 | Bacteria | 48071 |
| 5 | Ga0065165_1007088 | 3300005262 | Bacteria | 5630 |
| 6 | Ga0070658_10006327 | 3300005327 | Bacteria | 9595 |
| 7 | Ga0070682_100102577 | 3300005337 | Bacteria | 1891 |
| 8 | Ga0070673_100081307 | 3300005364 | Bacteria | 2627 |
| 9 | Ga0070711_100024925 | 3300005439 | Bacteria | 3909 |
| 10 | Ga0070663_100024219 | 3300005455 | Bacteria | 4082 |
| 11 | Ga0070663_100228191 | 3300005455 | Bacteria | 1465 |
| 12 | Ga0070672_100060844 | 3300005543 | Bacteria | 2975 |
| 13 | Ga0070665_100008387 | 3300005548 | Bacteria | 10452 |
| 14 | Ga0070665_100053909 | 3300005548 | Bacteria | 4033 |
| 15 | Ga0070665_100196447 | 3300005548 | Bacteria | 2018 |
| 16 | Ga0070665_100271881 | 3300005548 | Bacteria | 1696 |
| 17 | Ga0068852_100060832 | 3300005616 | Bacteria | 3280 |
| 18 | Ga0081540_1000942 | 3300005983 | Bacteria | 26195 |
| 19 | Ga0105240_10063903 | 3300009093 | Bacteria | 4576 |
| 20 | Ga0163163_10116064 | 3300014325 | Bacteria | 2708 |
| 21 | Ga0213874_10010002 | 3300021377 | Bacteria | 2363 |
| 22 | Ga0213876_10003676 | 3300021384 | Bacteria | 8705 |
| 23 | Ga0213875_10012476 | 3300021388 | Bacteria | 4194 |
| 24 | Ga0213871_10004782 | 3300021441 | Bacteria | 2741 |
| 25 | Ga0209758_1000557 | 3300025297 | Bacteria | 58827 |
| 26 | Ga0207426_1000712 | 3300025302 | Bacteria | 38841 |
| 27 | Ga0207705_10016509 | 3300025909 | Bacteria | 5290 |
| 28 | Ga0207695_10058268 | 3300025913 | Bacteria | 4009 |
| 29 | Ga0207691_10051244 | 3300025940 | Bacteria | 3775 |
| 30 | Ga0207639_10249330 | 3300026041 | Bacteria | 1548 |
| 31 | Ga0207678_10020458 | 3300026067 | Bacteria | 5804 |
| 32 | Ga0207678_10117414 | 3300026067 | Bacteria | 2270 |
| 33 | Ga0207702_10183272 | 3300026078 | Bacteria | 1929 |
| 34 | Ga0207683_10141331 | 3300026121 | Bacteria | 2169 |
| 35 | Ga0207698_10144310 | 3300026142 | Bacteria | 2056 |
| 36 | Ga0209966_1000013 | 3300027695 | Bacteria | 83121 |
| 37 | Ga0268266_10025393 | 3300028379 | Bacteria | 5040 |
| 38 | Ga0268266_10239790 | 3300028379 | Bacteria | 1673 |
| 39 | Ga0265337_1008018 | 3300028556 | Bacteria | 3885 |
| 40 | Ga0265334_10000294 | 3300028573 | Bacteria | 27911 |
| 41 | Ga0265334_10001855 | 3300028573 | Bacteria | 10057 |
| 42 | Ga0265334_10029326 | 3300028573 | Bacteria | 2206 |
| 43 | Ga0265318_10001380 | 3300028577 | Bacteria | 14413 |
| 44 | Ga0265323_10005651 | 3300028653 | Bacteria | 5305 |
| 45 | Ga0265322_10011688 | 3300028654 | Bacteria | 2542 |
| 46 | Ga0265338_10000081 | 3300028800 | Bacteria | 176402 |
| 47 | Ga0265338_10026338 | 3300028800 | Bacteria | 5869 |
| 48 | Ga0265338_10031815 | 3300028800 | Bacteria | 5163 |
| 49 | Ga0265332_10006020 | 3300031238 | Bacteria | 5545 |
| 50 | Ga0265332_10028742 | 3300031238 | Bacteria | 2432 |
| 51 | Ga0265328_10014612 | 3300031239 | Bacteria | 3088 |
| 52 | Ga0265320_10017189 | 3300031240 | Bacteria | 4026 |
| 53 | Ga0265325_10000622 | 3300031241 | Bacteria | 25870 |
| 54 | Ga0265325_10046552 | 3300031241 | Bacteria | 2249 |
| 55 | Ga0265329_10004922 | 3300031242 | Bacteria | 5471 |
| 56 | Ga0265329_10027224 | 3300031242 | Bacteria | 1880 |
| 57 | Ga0265340_10018839 | 3300031247 | Bacteria | 3557 |
| 58 | Ga0265340_10067890 | 3300031247 | Bacteria | 1694 |
| 59 | Ga0265339_10001469 | 3300031249 | Bacteria | 17412 |
| 60 | Ga0265339_10011229 | 3300031249 | Bacteria | 5525 |
| 61 | Ga0265339_10030894 | 3300031249 | Bacteria | 3030 |
| 62 | Ga0265331_10004809 | 3300031250 | Bacteria | 8316 |
| 63 | Ga0265327_10008611 | 3300031251 | Bacteria | 7564 |
| 64 | Ga0265327_10011863 | 3300031251 | Bacteria | 5954 |
| 65 | Ga0265316_10009722 | 3300031344 | Bacteria | 8828 |
| 66 | Ga0265316_10037710 | 3300031344 | Bacteria | 3898 |
| 67 | Ga0265313_10001758 | 3300031595 | Bacteria | 19875 |
| 68 | Ga0265313_10004120 | 3300031595 | Bacteria | 11311 |
| 69 | Ga0316575_10020632 | 3300031665 | Bacteria | 2529 |
| 70 | Ga0316579_10005442 | 3300031691 | Bacteria | 5141 |
| 71 | Ga0316579_10008717 | 3300031691 | Bacteria | 4239 |
| 72 | Ga0316579_10010176 | 3300031691 | Bacteria | 3970 |
| 73 | Ga0316579_10049677 | 3300031691 | Bacteria | 1960 |
| 74 | Ga0265314_10012090 | 3300031711 | Bacteria | 7072 |
| 75 | Ga0265314_10022996 | 3300031711 | Bacteria | 4764 |
| 76 | Ga0265342_10000087 | 3300031712 | Bacteria | 100045 |
| 77 | Ga0265342_10006928 | 3300031712 | Bacteria | 8377 |
| 78 | Ga0265342_10012295 | 3300031712 | Bacteria | 5802 |
| 79 | Ga0316576_10000980 | 3300031727 | Bacteria | 14661 |
| 80 | Ga0316576_10001052 | 3300031727 | Bacteria | 14328 |
| 81 | Ga0316576_10002831 | 3300031727 | Bacteria | 9988 |
| 82 | Ga0316576_10003903 | 3300031727 | Bacteria | 8838 |
| 83 | Ga0316576_10004118 | 3300031727 | Bacteria | 8673 |
| 84 | Ga0316576_10007038 | 3300031727 | Bacteria | 7043 |
| 85 | Ga0316576_10013682 | 3300031727 | Bacteria | 5403 |
| 86 | Ga0316576_10014229 | 3300031727 | Bacteria | 5312 |
| 87 | Ga0316576_10021260 | 3300031727 | Bacteria | 4484 |
| 88 | Ga0316576_10037703 | 3300031727 | Bacteria | 3462 |
| 89 | Ga0316576_10047447 | 3300031727 | Bacteria | 3112 |
| 90 | Ga0316578_10000862 | 3300031728 | Bacteria | 11381 |
| 91 | Ga0316578_10001976 | 3300031728 | Bacteria | 8697 |
| 92 | Ga0316578_10009373 | 3300031728 | Bacteria | 5035 |
| 93 | Ga0316578_10021444 | 3300031728 | Bacteria | 3586 |
| 94 | Ga0316578_10035614 | 3300031728 | Bacteria | 2862 |
| 95 | Ga0316578_10036665 | 3300031728 | Bacteria | 2823 |
| 96 | Ga0316577_10000523 | 3300031733 | Bacteria | 15428 |
| 97 | Ga0316577_10003091 | 3300031733 | Bacteria | 8359 |
| 98 | Ga0316577_10003321 | 3300031733 | Bacteria | 8105 |
| 99 | Ga0316577_10099342 | 3300031733 | Bacteria | 1631 |
| 100 | Ga0316583_10004398 | 3300032133 | Bacteria | 5025 |
| 101 | Ga0316585_10000478 | 3300032137 | Bacteria | 9436 |
| 102 | Ga0316585_10011234 | 3300032137 | Bacteria | 2638 |
| 103 | Ga0316580_10000394 | 3300032139 | Bacteria | 9875 |
| 104 | Ga0316580_10000729 | 3300032139 | Bacteria | 7951 |
| 105 | Ga0316580_10001056 | 3300032139 | Bacteria | 6921 |
| 106 | Ga0316593_10015990 | 3300032168 | Bacteria | 2267 |
| 107 | Ga0316592_1007555 | 3300033524 | Bacteria | 2127 |
| 108 | Ga0316586_1000371 | 3300033527 | Bacteria | 4227 |
| 109 | Ga0316586_1007627 | 3300033527 | Bacteria | 1582 |
| 110 | Ga0316588_1000028 | 3300033528 | Bacteria | 10646 |
| 111 | Ga0316588_1000310 | 3300033528 | Bacteria | 6133 |
| 112 | Ga0316588_1000352 | 3300033528 | Bacteria | 5942 |
| 113 | Ga0316588_1000383 | 3300033528 | Bacteria | 5819 |
| 114 | Ga0316588_1002842 | 3300033528 | Bacteria | 3075 |
| 115 | Ga0373936_0033461 | 3300035113 | Bacteria | 2038 |
| 116 | Ga0316574_0000209 | 3300035398 | Bacteria | 20562 |
| 117 | Ga0316574_0000869 | 3300035398 | Bacteria | 13319 |
| 118 | Ga0316574_0003388 | 3300035398 | Bacteria | 8206 |
| 119 | Ga0316574_0007247 | 3300035398 | Bacteria | 6066 |
| 120 | Ga0316574_0015799 | 3300035398 | Bacteria | 4384 |
| 121 | Ga0316574_0022452 | 3300035398 | Bacteria | 3755 |
| 122 | Ga0316574_0081089 | 3300035398 | Bacteria | 2060 |
| 123 | Ga0316574_0233103 | 3300035398 | Bacteria | 1178 |
| 124 | Ga0373931_0048358 | 3300035691 | Bacteria | 2255 |
| 125 | Ga0316582_0001337 | 3300036647 | Bacteria | 10703 |
| 126 | Ga0316582_0004997 | 3300036647 | Bacteria | 6781 |
| 127 | Ga0316582_0016030 | 3300036647 | Bacteria | 4301 |
| 128 | Ga0316584_0000497 | 3300036712 | Bacteria | 20762 |
| 129 | Ga0316584_0001316 | 3300036712 | Bacteria | 14686 |
| 130 | Ga0316584_0002621 | 3300036712 | Bacteria | 11464 |
| 131 | Ga0316584_0007282 | 3300036712 | Bacteria | 7554 |
| 132 | Ga0316584_0022236 | 3300036712 | Bacteria | 4623 |
| 133 | Ga0316584_0024187 | 3300036712 | Bacteria | 4444 |
| 134 | Ga0316584_0027349 | 3300036712 | Bacteria | 4197 |
| 135 | Ga0316584_0030116 | 3300036712 | Bacteria | 4009 |
| 136 | Ga0316584_0077153 | 3300036712 | Bacteria | 2496 |
| 137 | Ga0316584_0117122 | 3300036712 | Bacteria | 1992 |
| 138 | Ga0395898_0101758 | 3300037466 | Bacteria | 2759 |
| 139 | Ga0436364_0328296 | 3300037853 | Bacteria | 143298 |
| 140 | Ga0400483_118393 | 3300039062 | Bacteria | 8960 |
| 141 | Ga0400483_124348 | 3300039062 | Bacteria | 2461 |
| 142 | Ga0400483_182099 | 3300039062 | Bacteria | 3225 |
| 143 | Ga0400483_191600 | 3300039062 | Bacteria | 2427 |
| 144 | Ga0400483_196022 | 3300039062 | Bacteria | 4088 |
| 145 | Ga0400483_212777 | 3300039062 | Bacteria | 18396 |
| 146 | Ga0400483_252150 | 3300039062 | Bacteria | 2842 |
| 147 | Ga0400483_274449 | 3300039062 | Bacteria | 4197 |
| 148 | Ga0436365_0046500 | 3300039437 | Bacteria | 4139 |
| 149 | Ga0436365_1138651 | 3300039437 | Bacteria | 6688 |
| 150 | Ga0436361_1177758 | 3300039447 | Bacteria | 2804 |
| 151 | Ga0436363_0830305 | 3300039450 | Bacteria | 3443 |
| 152 | Ga0451577_0000001 | 3300042876 | Bacteria | 2461803 |
| 153 | Ga0451577_0002497 | 3300042876 | Bacteria | 21820 |
| 154 | Ga0451577_0003534 | 3300042876 | Bacteria | 17289 |
| 155 | Ga0451577_0005404 | 3300042876 | Bacteria | 13106 |
| 156 | Ga0451577_0015632 | 3300042876 | Bacteria | 7052 |
| 157 | Ga0451577_0048625 | 3300042876 | Bacteria | 3788 |
| 158 | Ga0451577_0068057 | 3300042876 | Bacteria | 3176 |
| 159 | Ga0451577_0069020 | 3300042876 | Bacteria | 3152 |
| 160 | Ga0451577_0208882 | 3300042876 | Bacteria | 1763 |
| 161 | Ga0453684_0048775 | 3300044712 | Bacteria | 5593 |
| 162 | Ga0453684_0061002 | 3300044712 | Bacteria | 4844 |
| 163 | Ga0453684_0260405 | 3300044712 | Bacteria | 1987 |
| 164 | Ga0466968_0002455 | 3300044735 | Bacteria | 6801 |
| 165 | Ga0466960_0042831 | 3300044901 | Bacteria | 2151 |
| 166 | Ga0451576_0000122 | 3300045051 | Bacteria | 197797 |
| 167 | Ga0451576_0001261 | 3300045051 | Bacteria | 44384 |
| 168 | Ga0451576_0002473 | 3300045051 | Bacteria | 27484 |
| 169 | Ga0451576_0025907 | 3300045051 | Bacteria | 6315 |
| 170 | Ga0451576_0053936 | 3300045051 | Bacteria | 4209 |
| 171 | Ga0451576_0166918 | 3300045051 | Bacteria | 2297 |
| 172 | Ga0451576_0196713 | 3300045051 | Bacteria | 2106 |
| 173 | Ga0451576_0453698 | 3300045051 | Bacteria | 1346 |
| 174 | Ga0495629_0012579 | 3300046459 | Bacteria | 6128 |
| 175 | Ga0495650_0004238 | 3300046471 | Bacteria | 9924 |
| 176 | Ga0495607_0064773 | 3300046501 | Bacteria | 2063 |
| 177 | Ga0495606_0089945 | 3300046507 | Bacteria | 1890 |
| 178 | Ga0495640_0058217 | 3300046533 | Bacteria | 2636 |
| 179 | Ga0495684_0040828 | 3300047471 | Bacteria | 3556 |
| 180 | Ga0495686_0007202 | 3300047472 | Bacteria | 8376 |
| 181 | Ga0496102_0092768 | 3300048905 | Bacteria | 2797 |
| 182 | Ga0496108_0116058 | 3300048911 | Bacteria | 2293 |
| 183 | Ga0496112_0001652 | 3300048915 | Bacteria | 17324 |
| 184 | Ga0496121_0024321 | 3300048924 | Bacteria | 5798 |
| 185 | Ga0496124_0141998 | 3300048927 | Bacteria | 1894 |
| 186 | Ga0496126_0055532 | 3300048929 | Bacteria | 3583 |
| 187 | Ga0501032_0030017 | 3300049569 | Bacteria | 3729 |
| 188 | Ga0501032_0136070 | 3300049569 | Bacteria | 1619 |
| 189 | Ga0501037_0123453 | 3300049573 | Bacteria | 1860 |
| 190 | Ga0501038_0045134 | 3300049574 | Bacteria | 3826 |
| 191 | Ga0501039_0072577 | 3300049575 | Bacteria | 2674 |
| 192 | Ga0501076_0107089 | 3300049592 | Bacteria | 2257 |
| 193 | Ga0501280_000715 | 3300049776 | Bacteria | 7356 |
| 194 | Ga0501044_0002706 | 3300049823 | Bacteria | 20150 |
| 195 | Ga0501044_0103874 | 3300049823 | Bacteria | 2856 |
| 196 | Ga0501044_0376287 | 3300049823 | Bacteria | 1336 |
| 197 | Ga0500635_0000034 | 3300053080 | Bacteria | 96919 |
| 198 | Ga0495619_0283560 | 3300053085 | Bacteria | 1148 |
| 199 | Ga0500644_0001793 | 3300053088 | Bacteria | 5548 |
| 200 | Ga0500641_0000410 | 3300053096 | Bacteria | 15886 |
| 201 | Ga0500641_0001646 | 3300053096 | Bacteria | 7962 |
| 202 | Ga0500595_000084 | 3300053119 | Bacteria | 66292 |
| 203 | Ga0500614_001731 | 3300053123 | Bacteria | 5086 |
| 204 | Ga0500559_0003150 | 3300053136 | Bacteria | 8189 |
| 205 | Ga0500589_005708 | 3300053147 | Bacteria | 4885 |
| 206 | Ga0500620_031078 | 3300053155 | Bacteria | 1691 |
| 207 | Ga0500636_0119905 | 3300053177 | Bacteria | 1477 |
| 208 | 2545674134 | 2545555834 | Bacteria | 8130841 |
| 209 | 2596371372 | 2595698237 | Bacteria | 6712432 |
| 210 | 2643937303 | 2643221585 | Bacteria | 5812563 |
| 211 | 2644301494 | 2643221654 | Bacteria | 5273570 |
| 212 | 2644318468 | 2643221656 | Bacteria | 5809961 |
| 213 | 2738708958 | 2738541275 | Bacteria | 4830863 |
| 214 | 2738744041 | 2738541281 | Bacteria | 5112672 |
| 215 | 2738847383 | 2738541301 | Bacteria | 4834102 |
| 216 | 2738863112 | 2738541304 | Bacteria | 4833665 |
| 217 | 2739295630 | 2738543022 | Bacteria | 4835059 |
| 218 | 2739353271 | 2738543032 | Bacteria | 5115625 |
| 219 | 2739357308 | 2738543033 | Bacteria | 4833336 |
| 220 | 2829750140 | 2829745981 | Bacteria | 5406054 |
| 221 | 2837681409 | 2837678835 | Bacteria | 5252418 |
| 222 | 2842336636 | 2842333319 | Bacteria | 8899485 |
| 223 | 2842701512 | 2842698319 | Bacteria | 5190321 |
| 224 | 2844315629 | 2844315083 | Bacteria | 8138177 |
| 225 | 2854685481 | 2854681122 | Bacteria | 4548679 |
| 226 | 2861692886 | 2861691609 | Bacteria | 5628931 |
| 227 | 2888389541 | 2888388044 | Bacteria | 7304136 |
| 228 | 2889306710 | 2889306138 | Bacteria | 6358934 |
| 229 | 2894777052 | 2894772417 | Bacteria | 5305674 |
| 230 | 2902409642 | 2902405164 | Bacteria | 6784948 |
| 231 | 2903732677 | 2903727486 | Bacteria | 8281579 |
| 232 | 2906605445 | 2906602504 | Bacteria | 8295279 |
| 233 | 2919681540 | 2919679072 | Bacteria | 4629602 |
| 234 | 2928102284 | 2928100450 | Bacteria | 4837635 |
| 235 | 2928126306 | 2928125067 | Bacteria | 5937560 |
| 236 | 2928961214 | 2928959182 | Bacteria | 4725774 |
| 237 | 3003671103 | 3003665799 | Bacteria | 7279786 |
| 238 | 641643888 | 641522639 | Bacteria | 7737025 |
| 239 | 8045864961 | 8045864390 | Bacteria | 5043873 |
| 240 | Ga0400483_199265 | |||
| 241 | JGI25153J46596_10002753 | |||
| 242 | JGI25160J50197_1004052 | |||
| 243 | Ga0065165_1000694 | |||
| 244 | Ga0065165_1007088 | |||
| 245 | Ga0070658_10006327 | |||
| 246 | Ga0070682_100102577 | |||
| 247 | Ga0070673_100081307 | |||
| 248 | Ga0070711_100024925 | |||
| 249 | Ga0070663_100024219 | |||
| 250 | Ga0070663_100228191 | |||
| 251 | Ga0070672_100060844 | |||
| 252 | Ga0070665_100008387 | |||
| 253 | Ga0070665_100053909 | |||
| 254 | Ga0070665_100196447 | |||
| 255 | Ga0070665_100271881 | |||
| 256 | Ga0068852_100060832 | |||
| 257 | Ga0081540_1000942 | |||
| 258 | Ga0105240_10063903 | |||
| 259 | Ga0163163_10116064 | |||
| 260 | Ga0213874_10010002 | |||
| 261 | Ga0213876_10003676 | |||
| 262 | Ga0213875_10012476 | |||
| 263 | Ga0213871_10004782 | |||
| 264 | Ga0209758_1000557 | |||
| 265 | Ga0207426_1000712 | |||
| 266 | Ga0207705_10016509 | |||
| 267 | Ga0207695_10058268 | |||
| 268 | Ga0207691_10051244 | |||
| 269 | Ga0207639_10249330 | |||
| 270 | Ga0207678_10020458 | |||
| 271 | Ga0207678_10117414 | |||
| 272 | Ga0207702_10183272 | |||
| 273 | Ga0207683_10141331 | |||
| 274 | Ga0207698_10144310 | |||
| 275 | Ga0209966_1000013 | |||
| 276 | Ga0268266_10025393 | |||
| 277 | Ga0268266_10239790 | |||
| 278 | Ga0265337_1008018 | |||
| 279 | Ga0265334_10000294 | |||
| 280 | Ga0265334_10001855 | |||
| 281 | Ga0265334_10029326 | |||
| 282 | Ga0265318_10001380 | |||
| 283 | Ga0265323_10005651 | |||
| 284 | Ga0265322_10011688 | |||
| 285 | Ga0265338_10000081 | |||
| 286 | Ga0265338_10026338 | |||
| 287 | Ga0265338_10031815 | |||
| 288 | Ga0265332_10006020 | |||
| 289 | Ga0265332_10028742 | |||
| 290 | Ga0265328_10014612 | |||
| 291 | Ga0265320_10017189 | |||
| 292 | Ga0265325_10000622 | |||
| 293 | Ga0265325_10046552 | |||
| 294 | Ga0265329_10004922 | |||
| 295 | Ga0265329_10027224 | |||
| 296 | Ga0265340_10018839 | |||
| 297 | Ga0265340_10067890 | |||
| 298 | Ga0265339_10001469 | |||
| 299 | Ga0265339_10011229 | |||
| 300 | Ga0265339_10030894 | |||
| 301 | Ga0265331_10004809 | |||
| 302 | Ga0265327_10008611 | |||
| 303 | Ga0265327_10011863 | |||
| 304 | Ga0265316_10009722 | |||
| 305 | Ga0265316_10037710 | |||
| 306 | Ga0265313_10001758 | |||
| 307 | Ga0265313_10004120 | |||
| 308 | Ga0316575_10020632 | |||
| 309 | Ga0316579_10005442 | |||
| 310 | Ga0316579_10008717 | |||
| 311 | Ga0316579_10010176 | |||
| 312 | Ga0316579_10049677 | |||
| 313 | Ga0265314_10012090 | |||
| 314 | Ga0265314_10022996 | |||
| 315 | Ga0265342_10000087 | |||
| 316 | Ga0265342_10006928 | |||
| 317 | Ga0265342_10012295 | |||
| 318 | Ga0316576_10000980 | |||
| 319 | Ga0316576_10001052 | |||
| 320 | Ga0316576_10002831 | |||
| 321 | Ga0316576_10003903 | |||
| 322 | Ga0316576_10004118 | |||
| 323 | Ga0316576_10007038 | |||
| 324 | Ga0316576_10013682 | |||
| 325 | Ga0316576_10014229 | |||
| 326 | Ga0316576_10021260 | |||
| 327 | Ga0316576_10037703 | |||
| 328 | Ga0316576_10047447 | |||
| 329 | Ga0316578_10000862 | |||
| 330 | Ga0316578_10001976 | |||
| 331 | Ga0316578_10009373 | |||
| 332 | Ga0316578_10021444 | |||
| 333 | Ga0316578_10035614 | |||
| 334 | Ga0316578_10036665 | |||
| 335 | Ga0316577_10000523 | |||
| 336 | Ga0316577_10003091 | |||
| 337 | Ga0316577_10003321 | |||
| 338 | Ga0316577_10099342 | |||
| 339 | Ga0316583_10004398 | |||
| 340 | Ga0316585_10000478 | |||
| 341 | Ga0316585_10011234 | |||
| 342 | Ga0316580_10000394 | |||
| 343 | Ga0316580_10000729 | |||
| 344 | Ga0316580_10001056 | |||
| 345 | Ga0316593_10015990 | |||
| 346 | Ga0316592_1007555 | |||
| 347 | Ga0316586_1000371 | |||
| 348 | Ga0316586_1007627 | |||
| 349 | Ga0316588_1000028 | |||
| 350 | Ga0316588_1000310 | |||
| 351 | Ga0316588_1000352 | |||
| 352 | Ga0316588_1000383 | |||
| 353 | Ga0316588_1002842 | |||
| 354 | Ga0373936_0033461 | |||
| 355 | Ga0316574_0000209 | |||
| 356 | Ga0316574_0000869 | |||
| 357 | Ga0316574_0003388 | |||
| 358 | Ga0316574_0007247 | |||
| 359 | Ga0316574_0015799 | |||
| 360 | Ga0316574_0022452 | |||
| 361 | Ga0316574_0081089 | |||
| 362 | Ga0316574_0233103 | |||
| 363 | Ga0373931_0048358 | |||
| 364 | Ga0316582_0001337 | |||
| 365 | Ga0316582_0004997 | |||
| 366 | Ga0316582_0016030 | |||
| 367 | Ga0316584_0000497 | |||
| 368 | Ga0316584_0001316 | |||
| 369 | Ga0316584_0002621 | |||
| 370 | Ga0316584_0007282 | |||
| 371 | Ga0316584_0022236 | |||
| 372 | Ga0316584_0024187 | |||
| 373 | Ga0316584_0027349 | |||
| 374 | Ga0316584_0030116 | |||
| 375 | Ga0316584_0077153 | |||
| 376 | Ga0316584_0117122 | |||
| 377 | Ga0395898_0101758 | |||
| 378 | Ga0436364_0328296 | |||
| 379 | Ga0400483_118393 | |||
| 380 | Ga0400483_124348 | |||
| 381 | Ga0400483_182099 | |||
| 382 | Ga0400483_191600 | |||
| 383 | Ga0400483_196022 | |||
| 384 | Ga0400483_212777 | |||
| 385 | Ga0400483_252150 | |||
| 386 | Ga0400483_274449 | |||
| 387 | Ga0436365_0046500 | |||
| 388 | Ga0436365_1138651 | |||
| 389 | Ga0436361_1177758 | |||
| 390 | Ga0436363_0830305 | |||
| 391 | Ga0451577_0000001 | |||
| 392 | Ga0451577_0002497 | |||
| 393 | Ga0451577_0003534 | |||
| 394 | Ga0451577_0005404 | |||
| 395 | Ga0451577_0015632 | |||
| 396 | Ga0451577_0048625 | |||
| 397 | Ga0451577_0068057 | |||
| 398 | Ga0451577_0069020 | |||
| 399 | Ga0451577_0208882 | |||
| 400 | Ga0453684_0048775 | |||
| 401 | Ga0453684_0061002 | |||
| 402 | Ga0453684_0260405 | |||
| 403 | Ga0466968_0002455 | |||
| 404 | Ga0466960_0042831 | |||
| 405 | Ga0451576_0000122 | |||
| 406 | Ga0451576_0001261 | |||
| 407 | Ga0451576_0002473 | |||
| 408 | Ga0451576_0025907 | |||
| 409 | Ga0451576_0053936 | |||
| 410 | Ga0451576_0166918 | |||
| 411 | Ga0451576_0196713 | |||
| 412 | Ga0451576_0453698 | |||
| 413 | Ga0495629_0012579 | |||
| 414 | Ga0495650_0004238 | |||
| 415 | Ga0495607_0064773 | |||
| 416 | Ga0495606_0089945 | |||
| 417 | Ga0495640_0058217 | |||
| 418 | Ga0495684_0040828 | |||
| 419 | Ga0495686_0007202 | |||
| 420 | Ga0496102_0092768 | |||
| 421 | Ga0496108_0116058 | |||
| 422 | Ga0496112_0001652 | |||
| 423 | Ga0496121_0024321 | |||
| 424 | Ga0496124_0141998 | |||
| 425 | Ga0496126_0055532 | |||
| 426 | Ga0501032_0030017 | |||
| 427 | Ga0501032_0136070 | |||
| 428 | Ga0501037_0123453 | |||
| 429 | Ga0501038_0045134 | |||
| 430 | Ga0501039_0072577 | |||
| 431 | Ga0501076_0107089 | |||
| 432 | Ga0501280_000715 | |||
| 433 | Ga0501044_0002706 | |||
| 434 | Ga0501044_0103874 | |||
| 435 | Ga0501044_0376287 | |||
| 436 | Ga0500635_0000034 | |||
| 437 | Ga0495619_0283560 | |||
| 438 | Ga0500644_0001793 | |||
| 439 | Ga0500641_0000410 | |||
| 440 | Ga0500641_0001646 | |||
| 441 | Ga0500595_000084 | |||
| 442 | Ga0500614_001731 | |||
| 443 | Ga0500559_0003150 | |||
| 444 | Ga0500589_005708 | |||
| 445 | Ga0500620_031078 | |||
| 446 | Ga0500636_0119905 | |||
| 447 | 2545674134 | |||
| 448 | 2596371372 | |||
| 449 | 2643937303 | |||
| 450 | 2644301494 | |||
| 451 | 2644318468 | |||
| 452 | 2738708958 | |||
| 453 | 2738744041 | |||
| 454 | 2738847383 | |||
| 455 | 2738863112 | |||
| 456 | 2739295630 | |||
| 457 | 2739353271 | |||
| 458 | 2739357308 | |||
| 459 | 2829750140 | |||
| 460 | 2837681409 | |||
| 461 | 2842336636 | |||
| 462 | 2842701512 | |||
| 463 | 2844315629 | |||
| 464 | 2854685481 | |||
| 465 | 2861692886 | |||
| 466 | 2888389541 | |||
| 467 | 2889306710 | |||
| 468 | 2894777052 | |||
| 469 | 2902409642 | |||
| 470 | 2903732677 | |||
| 471 | 2906605445 | |||
| 472 | 2919681540 | |||
| 473 | 2928102284 | |||
| 474 | 2928126306 | |||
| 475 | 2928961214 | |||
| 476 | 3003671103 | |||
| 477 | 641643888 | |||
| 478 | 8045864961 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3aeq-assembly1.cif.gz_A | structure of the light-independent protochlorophyllide reductase catalyzing a key reduction for greening in the dark | 0.9628 | 18 | 427 |
| 2ynm-assembly1.cif.gz_C-2 | structure of the adpxalf3-stabilized transition state of the nitrogenase-like dark-operative protochlorophyllide oxidoreductase complex from prochlorococcus marinus with its substrate protochlorophyllide a | 0.9579 | 19 | 425 |
| 3aeq-assembly1.cif.gz_A | structure of the light-independent protochlorophyllide reductase catalyzing a key reduction for greening in the dark | 0.9447 | 18 | 427 |
| 2ynm-assembly1.cif.gz_C-2 | structure of the adpxalf3-stabilized transition state of the nitrogenase-like dark-operative protochlorophyllide oxidoreductase complex from prochlorococcus marinus with its substrate protochlorophyllide a | 0.9289 | 19 | 425 |
| 2xdq-assembly1.cif.gz_A-2 | dark operative protochlorophyllide oxidoreductase (chln-chlb)2 complex | 0.9111 | 16 | 427 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2ynmC03 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain | 0.9812 | 170 | 291 | 3.40.50.1980 |
| 3aekA03 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain | 0.9804 | 170 | 292 | 3.40.50.1980 |
| 3aesC01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain | 0.9619 | 295 | 425 | 3.40.50.1980 |
| 3aekA03 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain | 0.9569 | 170 | 292 | 3.40.50.1980 |
| 2ynmC03 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain | 0.95 | 170 | 291 | 3.40.50.1980 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N7XUC3-F1-model_v4 | Ferredoxin:protochlorophyllide reductase (ATP-dependent) subunit N | 1.002 | 195 | 286 |
GO:0015979
GO:0015995 |
| AF-A0A2S5MGW8-F1-model_v4 | Ferredoxin:protochlorophyllide reductase (ATP-dependent) subunit N | 0.9921 | 197 | 425 |
GO:0015979
GO:0015995 GO:0016491 |
| AF-A0A2P5ME58-F1-model_v4 | Ferredoxin:protochlorophyllide reductase (ATP-dependent) subunit N | 0.9906 | 239 | 425 |
GO:0015979
GO:0015995 GO:0016491 |
| AF-A0A4Q4D0C5-F1-model_v4 | Ferredoxin:protochlorophyllide reductase (ATP-dependent) subunit N | 0.9881 | 178 | 427 |
GO:0015979
GO:0015995 GO:0016491 |
| AF-A0A352CEM2-F1-model_v4 | Ferredoxin:protochlorophyllide reductase (ATP-dependent) subunit N | 0.9864 | 277 | 364 |
|