F352044

General Info

Members Datasets Scaffolds Average Seq Length
239 159 478 188

Family's Representative Sequence

Representative Sequence 3300026121|Ga0207683_10006761|Ga0207683_100067618
Length 223
Sequence MRRFDSTGPGVASERRRRRHNFAAVDTARGRRYGSFDVRVVLDRIRVGDVELELLRPAAPDALIDEEAFADDEFLPYWAELWPAATALAEALPDVAGLRVIELGCGLGLPSLVAAARGADVTATDWAADAIDLVHENAARNGLQLRAERWDWREPRAERYDLALAADVLYERRNVEPLVARLRGLAPVAYVGLAGRPYEAEFLRSVGETERVADRVVVVRASG

Samples

Sample ID Description Type Environment
1 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
22 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
23 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
24 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
27 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
28 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
29 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
30 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
31 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
32 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
33 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
34 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
58 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
59 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
60 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
61 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
62 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
63 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
64 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
65 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
66 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
67 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
68 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
69 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
70 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
71 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
72 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
73 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
74 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
75 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
76 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
77 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
78 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
79 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
80 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
81 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
82 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
83 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
84 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
85 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
88 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
89 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
90 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
91 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
92 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
93 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
94 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
95 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
96 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
97 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
98 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
99 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
100 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
101 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
102 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
103 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
104 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
105 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
106 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
107 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
108 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
109 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
110 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
111 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
112 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
113 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
114 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
115 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
116 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
117 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
118 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
119 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
120 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
121 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
122 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
123 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
124 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
125 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
126 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
127 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
128 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
129 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
130 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
131 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
132 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
133 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
134 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
135 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
138 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
143 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
144 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
145 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
146 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
147 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
148 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
149 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
150 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
151 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
152 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
154 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
155 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
156 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
157 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
158 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
159 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.77
Rhizosphere 95.4
Stem 0
Stem Tuber 0
Unclassified 10.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207683_10006761 3300026121 Bacteria 9812
2 Ga0070680_100026837 3300005336 Bacteria 4607
3 Ga0070680_100188664 3300005336 Bacteria 1737
4 Ga0070660_100019994 3300005339 Bacteria 4914
5 Ga0070661_100018982 3300005344 Bacteria 4895
6 Ga0070661_100043802 3300005344 Bacteria 3269
7 Ga0070659_100054134 3300005366 Bacteria 3160
8 Ga0070659_100559185 3300005366 Bacteria 980
9 Ga0070714_100422499 3300005435 Bacteria 1263
10 Ga0070714_101225852 3300005435 Bacteria 732
11 Ga0070711_100357263 3300005439 Bacteria 1176
12 Ga0070663_100123841 3300005455 Bacteria 1956
13 Ga0070681_10008936 3300005458 Bacteria 9850
14 Ga0070681_10010999 3300005458 Bacteria 8945
15 Ga0070681_10244603 3300005458 Bacteria 1707
16 Ga0070707_101027322 3300005468 Bacteria 790
17 Ga0070698_100203504 3300005471 Bacteria 1915
18 Ga0070679_100004089 3300005530 Bacteria 13451
19 Ga0070679_100048578 3300005530 Bacteria 4227
20 Ga0070679_100251696 3300005530 Bacteria 1723
21 Ga0070684_100053182 3300005535 Bacteria 3524
22 Ga0070684_100546408 3300005535 Bacteria 1075
23 Ga0070696_100029605 3300005546 Bacteria 3743
24 Ga0070665_100023293 3300005548 Bacteria 6236
25 Ga0068855_100091681 3300005563 Bacteria 3505
26 Ga0068855_100108046 3300005563 Bacteria 3196
27 Ga0068855_100136626 3300005563 Bacteria 2797
28 Ga0068857_100038270 3300005577 Bacteria 4248
29 Ga0068852_100163101 3300005616 Bacteria 2083
30 Ga0068852_100724165 3300005616 Unclassified 1006
31 Ga0068866_10198148 3300005718 Unclassified 1198
32 Ga0070717_10252879 3300006028 Bacteria 1557
33 Ga0070715_10252685 3300006163 Bacteria 922
34 Ga0070712_100412219 3300006175 Bacteria 1118
35 Ga0075434_100643883 3300006871 Bacteria 1078
36 Ga0075435_100042319 3300007076 Bacteria 3644
37 Ga0105240_10042830 3300009093 Bacteria 5766
38 Ga0105240_10280451 3300009093 Bacteria 1914
39 Ga0105240_10726165 3300009093 Bacteria 1082
40 Ga0105245_12169842 3300009098 Bacteria 609
41 Ga0105241_10277710 3300009174 Bacteria 1429
42 Ga0105241_10794502 3300009174 Bacteria 871
43 Ga0105237_10021613 3300009545 Bacteria 6614
44 Ga0105238_10044201 3300009551 Bacteria 4504
45 Ga0105239_10335798 3300010375 Bacteria 1705
46 Ga0157373_10049379 3300013100 Bacteria 2998
47 Ga0157373_10322832 3300013100 Bacteria 1098
48 Ga0157370_10016160 3300013104 Bacteria 7565
49 Ga0157370_10102920 3300013104 Bacteria 2673
50 Ga0157369_10035825 3300013105 Bacteria 5441
51 Ga0157369_10296860 3300013105 Bacteria 1681
52 Ga0157369_10849409 3300013105 Unclassified 937
53 Ga0157369_11083154 3300013105 Bacteria 819
54 Ga0157374_10135738 3300013296 Bacteria 2385
55 Ga0157372_10050345 3300013307 Bacteria 4634
56 Ga0206356_11276624 3300020070 Bacteria 2187
57 Ga0207705_10182507 3300025909 Bacteria 1584
58 Ga0207705_10432747 3300025909 Unclassified 1019
59 Ga0207707_10002441 3300025912 Bacteria 16724
60 Ga0207707_10003694 3300025912 Bacteria 13568
61 Ga0207695_10574164 3300025913 Bacteria 1009
62 Ga0207671_10022504 3300025914 Bacteria 4765
63 Ga0207693_10425989 3300025915 Bacteria 1037
64 Ga0207660_10018402 3300025917 Bacteria 4657
65 Ga0207660_10173267 3300025917 Unclassified 1671
66 Ga0207657_10017458 3300025919 Bacteria 6878
67 Ga0207657_10092496 3300025919 Bacteria 2521
68 Ga0207649_10012569 3300025920 Bacteria 4702
69 Ga0207652_10029456 3300025921 Bacteria 4590
70 Ga0207652_10102513 3300025921 Bacteria 2529
71 Ga0207652_10320114 3300025921 Bacteria 1400
72 Ga0207694_10489465 3300025924 Bacteria 1029
73 Ga0207700_10448758 3300025928 Bacteria 1136
74 Ga0207664_10161774 3300025929 Bacteria 1910
75 Ga0207661_10279298 3300025944 Bacteria 1492
76 Ga0207667_10034462 3300025949 Bacteria 5435
77 Ga0207667_10089245 3300025949 Bacteria 3186
78 Ga0207667_10181941 3300025949 Bacteria 2158
79 Ga0207640_10167136 3300025981 Unclassified 1635
80 Ga0207639_10548599 3300026041 Unclassified 1061
81 Ga0207678_10139341 3300026067 Bacteria 2070
82 Ga0207702_10079665 3300026078 Bacteria 2840
83 Ga0207674_10030891 3300026116 Bacteria 5631
84 Ga0207698_10312263 3300026142 Bacteria 1468
85 Ga0265326_10043725 3300028558 Bacteria 1271
86 Ga0265334_10022280 3300028573 Bacteria 2583
87 Ga0265322_10001794 3300028654 Bacteria 6802
88 Ga0265336_10046979 3300028666 Bacteria 1311
89 Ga0265338_10004565 3300028800 Bacteria 18629
90 Ga0265330_10023028 3300031235 Bacteria 2831
91 Ga0265332_10040759 3300031238 Unclassified 2010
92 Ga0265328_10113441 3300031239 Unclassified 1008
93 Ga0265325_10057659 3300031241 Bacteria 1980
94 Ga0265329_10009882 3300031242 Bacteria 3532
95 Ga0265327_10017537 3300031251 Bacteria 4485
96 Ga0265327_10026532 3300031251 Bacteria 3352
97 Ga0265316_10002772 3300031344 Bacteria 17956
98 Ga0265316_10182903 3300031344 Bacteria 1560
99 Ga0307408_100115291 3300031548 Bacteria 2072
100 Ga0265313_10005712 3300031595 Bacteria 9065
101 Ga0265314_10003131 3300031711 Bacteria 16238
102 Ga0265314_10047037 3300031711 Bacteria 3040
103 Ga0265342_10005387 3300031712 Bacteria 9773
104 Ga0373945_0005136 3300035116 Bacteria 4179
105 Ga0373943_0002734 3300035170 Bacteria 8021
106 Ga0373961_0174415 3300035241 Bacteria 746
107 Ga0373924_0194308 3300035410 Bacteria 894
108 Ga0373935_0081219 3300035692 Bacteria 2107
109 Ga0373935_0326458 3300035692 Bacteria 1090
110 Ga0373947_0005295 3300035725 Bacteria 7542
111 Ga0373947_0009473 3300035725 Bacteria 5593
112 Ga0373937_0063968 3300036401 Bacteria 3383
113 Ga0373925_0002209 3300037068 Bacteria 15801
114 Ga0373925_0162734 3300037068 Bacteria 1758
115 Ga0395899_0083065 3300037312 Bacteria 2329
116 Ga0395900_0046400 3300037418 Bacteria 4474
117 Ga0395900_0092789 3300037418 Bacteria 3102
118 Ga0395900_0099042 3300037418 Bacteria 2995
119 Ga0395900_0166677 3300037418 Bacteria 2245
120 Ga0395900_0339254 3300037418 Bacteria 1479
121 Ga0395900_0984137 3300037418 Bacteria 764
122 Ga0395898_0010338 3300037466 Bacteria 9763
123 Ga0395898_0698391 3300037466 Bacteria 956
124 Ga0395898_0811635 3300037466 Unclassified 875
125 Ga0395905_0138433 3300037471 Bacteria 2290
126 Ga0395905_0163032 3300037471 Bacteria 2095
127 Ga0395905_0807288 3300037471 Unclassified 841
128 Ga0436364_1143248 3300037853 Bacteria 1204
129 Ga0395901_0004957 3300038443 Bacteria 13432
130 Ga0395901_0124076 3300038443 Bacteria 2714
131 Ga0395901_0234945 3300038443 Bacteria 1913
132 Ga0395901_0240654 3300038443 Bacteria 1888
133 Ga0395901_0253698 3300038443 Bacteria 1832
134 Ga0395901_0621718 3300038443 Bacteria 1087
135 Ga0395901_0952282 3300038443 Unclassified 837
136 Ga0436363_0902625 3300039450 Bacteria 3384
137 Ga0439448_0062780 3300042005 Unclassified 1230
138 Ga0439451_038811 3300042009 Bacteria 956
139 Ga0466969_0164694 3300044656 Unclassified 1018
140 Ga0466966_0053407 3300044684 Bacteria 2564
141 Ga0466961_0005219 3300044693 Bacteria 8176
142 Ga0466963_0027639 3300044694 Bacteria 3635
143 Ga0466963_0120062 3300044694 Bacteria 1808
144 Ga0466963_0134241 3300044694 Bacteria 1711
145 Ga0466963_0203783 3300044694 Unclassified 1384
146 Ga0466963_0321425 3300044694 Bacteria 1089
147 Ga0466964_0005451 3300044706 Bacteria 4723
148 Ga0466971_0000953 3300044719 Bacteria 11883
149 Ga0466971_0128321 3300044719 Bacteria 1176
150 Ga0466968_0155447 3300044735 Bacteria 1053
151 Ga0466968_0186454 3300044735 Unclassified 967
152 Ga0466970_0349009 3300044765 Bacteria 839
153 Ga0466957_0010313 3300044842 Bacteria 5357
154 Ga0466957_0102713 3300044842 Bacteria 1804
155 Ga0466960_0039443 3300044901 Bacteria 2228
156 Ga0466959_0025837 3300045049 Bacteria 4355
157 Ga0466959_0119237 3300045049 Bacteria 1877
158 Ga0466959_0405764 3300045049 Bacteria 926
159 Ga0451576_0046451 3300045051 Bacteria 4572
160 Ga0466958_0009459 3300045836 Bacteria 5431
161 Ga0466958_0012661 3300045836 Bacteria 4781
162 Ga0466958_0135748 3300045836 Unclassified 1547
163 Ga0466958_0232597 3300045836 Bacteria 1177
164 Ga0466967_0005187 3300045976 Bacteria 8972
165 Ga0466967_0056241 3300045976 Bacteria 3468
166 Ga0466967_0086429 3300045976 Bacteria 2841
167 Ga0466967_0174287 3300045976 Bacteria 2026
168 Ga0466967_0188500 3300045976 Bacteria 1948
169 Ga0466967_0485457 3300045976 Bacteria 1211
170 Ga0466967_0517224 3300045976 Bacteria 1172
171 Ga0466967_1642714 3300045976 Unclassified 640
172 Ga0495592_0018525 3300046454 Bacteria 5296
173 Ga0495603_0176739 3300046455 Bacteria 1236
174 Ga0495641_0150196 3300046461 Bacteria 1041
175 Ga0495651_0014861 3300046462 Bacteria 6019
176 Ga0495653_0216695 3300046463 Unclassified 1289
177 Ga0495582_0142120 3300046473 Bacteria 1361
178 Ga0495608_0001770 3300046511 Bacteria 15431
179 Ga0495618_0183503 3300046514 Unclassified 1329
180 Ga0495628_0201281 3300046516 Unclassified 1500
181 Ga0495630_0021703 3300046517 Bacteria 4742
182 Ga0495630_0308053 3300046517 Bacteria 1210
183 Ga0495652_0358019 3300046529 Bacteria 1043
184 Ga0495665_0139000 3300046531 Bacteria 1270
185 Ga0495640_0194677 3300046533 Bacteria 1287
186 Ga0495587_0009905 3300046536 Bacteria 6082
187 Ga0495587_0492540 3300046536 Unclassified 678
188 Ga0495667_0011818 3300046559 Bacteria 5913
189 Ga0495635_0009116 3300046663 Bacteria 6929
190 Ga0495657_0008759 3300046675 Bacteria 7716
191 Ga0495599_0208793 3300046678 Bacteria 1198
192 Ga0495658_0162929 3300046683 Bacteria 1376
193 Ga0495600_0015563 3300046809 Bacteria 4812
194 Ga0495604_0157508 3300047317 Bacteria 1607
195 Ga0495674_0122287 3300047319 Bacteria 2198
196 Ga0495676_0055967 3300047321 Bacteria 3123
197 Ga0495680_0016929 3300047322 Bacteria 6242
198 Ga0495675_0027008 3300047444 Bacteria 3659
199 Ga0495684_0023202 3300047471 Bacteria 4770
200 Ga0495593_0267822 3300047673 Bacteria 855
201 Ga0495602_0089840 3300048088 Bacteria 2553
202 Ga0496100_0008491 3300048903 Bacteria 5729
203 Ga0496101_0142863 3300048904 Bacteria 1825
204 Ga0496106_0011354 3300048909 Bacteria 6592
205 Ga0496107_0456978 3300048910 Bacteria 948
206 Ga0496112_0040105 3300048915 Bacteria 4578
207 Ga0496114_0030364 3300048917 Bacteria 4446
208 Ga0496114_0106414 3300048917 Bacteria 2400
209 Ga0496114_0294627 3300048917 Bacteria 1432
210 Ga0496114_0351536 3300048917 Bacteria 1304
211 Ga0501031_0253323 3300049568 Bacteria 1144
212 Ga0501034_0004498 3300049571 Bacteria 15496
213 Ga0501047_0065450 3300049581 Bacteria 3504
214 Ga0501048_0439169 3300049582 Bacteria 934
215 Ga0501067_0074233 3300049583 Bacteria 1884
216 Ga0501068_0053124 3300049584 Bacteria 2452
217 Ga0501069_0009961 3300049585 Bacteria 5024
218 Ga0501069_0104037 3300049585 Bacteria 1613
219 Ga0501070_0071142 3300049586 Bacteria 2880
220 Ga0501070_0613942 3300049586 Unclassified 866
221 Ga0501072_0125010 3300049588 Bacteria 2049
222 Ga0501073_0021751 3300049589 Bacteria 4621
223 Ga0501074_0027333 3300049590 Bacteria 4137
224 Ga0501074_0115657 3300049590 Bacteria 1919
225 Ga0501079_0213282 3300049741 Bacteria 1508
226 Ga0501079_0253697 3300049741 Bacteria 1375
227 Ga0501080_0098887 3300049742 Bacteria 2708
228 Ga0501080_0573203 3300049742 Bacteria 1004
229 Ga0501081_0246925 3300049743 Bacteria 1302
230 Ga0501035_0237604 3300049822 Bacteria 1551
231 Ga0501044_0106582 3300049823 Bacteria 2814
232 Ga0501044_0284304 3300049823 Bacteria 1587
233 nmdc:mga0n895_177445_c1 3300050512 Unclassified 2161
234 nmdc:mga0rr50_308365_c1 3300050513 Bacteria 1325
235 Ga0495612_0086504 3300053078 Bacteria 1322
236 Ga0495595_0036233 3300053084 Bacteria 2238
237 Ga0495619_0001720 3300053085 Bacteria 14525
238 Ga0466962_0002867 3300061719 Bacteria 8219
239 Ga0466962_0105126 3300061719 Bacteria 1357
240 Ga0207683_10006761
241 Ga0070680_100026837
242 Ga0070680_100188664
243 Ga0070660_100019994
244 Ga0070661_100018982
245 Ga0070661_100043802
246 Ga0070659_100054134
247 Ga0070659_100559185
248 Ga0070714_100422499
249 Ga0070714_101225852
250 Ga0070711_100357263
251 Ga0070663_100123841
252 Ga0070681_10008936
253 Ga0070681_10010999
254 Ga0070681_10244603
255 Ga0070707_101027322
256 Ga0070698_100203504
257 Ga0070679_100004089
258 Ga0070679_100048578
259 Ga0070679_100251696
260 Ga0070684_100053182
261 Ga0070684_100546408
262 Ga0070696_100029605
263 Ga0070665_100023293
264 Ga0068855_100091681
265 Ga0068855_100108046
266 Ga0068855_100136626
267 Ga0068857_100038270
268 Ga0068852_100163101
269 Ga0068852_100724165
270 Ga0068866_10198148
271 Ga0070717_10252879
272 Ga0070715_10252685
273 Ga0070712_100412219
274 Ga0075434_100643883
275 Ga0075435_100042319
276 Ga0105240_10042830
277 Ga0105240_10280451
278 Ga0105240_10726165
279 Ga0105245_12169842
280 Ga0105241_10277710
281 Ga0105241_10794502
282 Ga0105237_10021613
283 Ga0105238_10044201
284 Ga0105239_10335798
285 Ga0157373_10049379
286 Ga0157373_10322832
287 Ga0157370_10016160
288 Ga0157370_10102920
289 Ga0157369_10035825
290 Ga0157369_10296860
291 Ga0157369_10849409
292 Ga0157369_11083154
293 Ga0157374_10135738
294 Ga0157372_10050345
295 Ga0206356_11276624
296 Ga0207705_10182507
297 Ga0207705_10432747
298 Ga0207707_10002441
299 Ga0207707_10003694
300 Ga0207695_10574164
301 Ga0207671_10022504
302 Ga0207693_10425989
303 Ga0207660_10018402
304 Ga0207660_10173267
305 Ga0207657_10017458
306 Ga0207657_10092496
307 Ga0207649_10012569
308 Ga0207652_10029456
309 Ga0207652_10102513
310 Ga0207652_10320114
311 Ga0207694_10489465
312 Ga0207700_10448758
313 Ga0207664_10161774
314 Ga0207661_10279298
315 Ga0207667_10034462
316 Ga0207667_10089245
317 Ga0207667_10181941
318 Ga0207640_10167136
319 Ga0207639_10548599
320 Ga0207678_10139341
321 Ga0207702_10079665
322 Ga0207674_10030891
323 Ga0207698_10312263
324 Ga0265326_10043725
325 Ga0265334_10022280
326 Ga0265322_10001794
327 Ga0265336_10046979
328 Ga0265338_10004565
329 Ga0265330_10023028
330 Ga0265332_10040759
331 Ga0265328_10113441
332 Ga0265325_10057659
333 Ga0265329_10009882
334 Ga0265327_10017537
335 Ga0265327_10026532
336 Ga0265316_10002772
337 Ga0265316_10182903
338 Ga0307408_100115291
339 Ga0265313_10005712
340 Ga0265314_10003131
341 Ga0265314_10047037
342 Ga0265342_10005387
343 Ga0373945_0005136
344 Ga0373943_0002734
345 Ga0373961_0174415
346 Ga0373924_0194308
347 Ga0373935_0081219
348 Ga0373935_0326458
349 Ga0373947_0005295
350 Ga0373947_0009473
351 Ga0373937_0063968
352 Ga0373925_0002209
353 Ga0373925_0162734
354 Ga0395899_0083065
355 Ga0395900_0046400
356 Ga0395900_0092789
357 Ga0395900_0099042
358 Ga0395900_0166677
359 Ga0395900_0339254
360 Ga0395900_0984137
361 Ga0395898_0010338
362 Ga0395898_0698391
363 Ga0395898_0811635
364 Ga0395905_0138433
365 Ga0395905_0163032
366 Ga0395905_0807288
367 Ga0436364_1143248
368 Ga0395901_0004957
369 Ga0395901_0124076
370 Ga0395901_0234945
371 Ga0395901_0240654
372 Ga0395901_0253698
373 Ga0395901_0621718
374 Ga0395901_0952282
375 Ga0436363_0902625
376 Ga0439448_0062780
377 Ga0439451_038811
378 Ga0466969_0164694
379 Ga0466966_0053407
380 Ga0466961_0005219
381 Ga0466963_0027639
382 Ga0466963_0120062
383 Ga0466963_0134241
384 Ga0466963_0203783
385 Ga0466963_0321425
386 Ga0466964_0005451
387 Ga0466971_0000953
388 Ga0466971_0128321
389 Ga0466968_0155447
390 Ga0466968_0186454
391 Ga0466970_0349009
392 Ga0466957_0010313
393 Ga0466957_0102713
394 Ga0466960_0039443
395 Ga0466959_0025837
396 Ga0466959_0119237
397 Ga0466959_0405764
398 Ga0451576_0046451
399 Ga0466958_0009459
400 Ga0466958_0012661
401 Ga0466958_0135748
402 Ga0466958_0232597
403 Ga0466967_0005187
404 Ga0466967_0056241
405 Ga0466967_0086429
406 Ga0466967_0174287
407 Ga0466967_0188500
408 Ga0466967_0485457
409 Ga0466967_0517224
410 Ga0466967_1642714
411 Ga0495592_0018525
412 Ga0495603_0176739
413 Ga0495641_0150196
414 Ga0495651_0014861
415 Ga0495653_0216695
416 Ga0495582_0142120
417 Ga0495608_0001770
418 Ga0495618_0183503
419 Ga0495628_0201281
420 Ga0495630_0021703
421 Ga0495630_0308053
422 Ga0495652_0358019
423 Ga0495665_0139000
424 Ga0495640_0194677
425 Ga0495587_0009905
426 Ga0495587_0492540
427 Ga0495667_0011818
428 Ga0495635_0009116
429 Ga0495657_0008759
430 Ga0495599_0208793
431 Ga0495658_0162929
432 Ga0495600_0015563
433 Ga0495604_0157508
434 Ga0495674_0122287
435 Ga0495676_0055967
436 Ga0495680_0016929
437 Ga0495675_0027008
438 Ga0495684_0023202
439 Ga0495593_0267822
440 Ga0495602_0089840
441 Ga0496100_0008491
442 Ga0496101_0142863
443 Ga0496106_0011354
444 Ga0496107_0456978
445 Ga0496112_0040105
446 Ga0496114_0030364
447 Ga0496114_0106414
448 Ga0496114_0294627
449 Ga0496114_0351536
450 Ga0501031_0253323
451 Ga0501034_0004498
452 Ga0501047_0065450
453 Ga0501048_0439169
454 Ga0501067_0074233
455 Ga0501068_0053124
456 Ga0501069_0009961
457 Ga0501069_0104037
458 Ga0501070_0071142
459 Ga0501070_0613942
460 Ga0501072_0125010
461 Ga0501073_0021751
462 Ga0501074_0027333
463 Ga0501074_0115657
464 Ga0501079_0213282
465 Ga0501079_0253697
466 Ga0501080_0098887
467 Ga0501080_0573203
468 Ga0501081_0246925
469 Ga0501035_0237604
470 Ga0501044_0106582
471 Ga0501044_0284304
472 nmdc:mga0n895_177445_c1
473 nmdc:mga0rr50_308365_c1
474 Ga0495612_0086504
475 Ga0495595_0036233
476 Ga0495619_0001720
477 Ga0466962_0002867
478 Ga0466962_0105126

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05175

MTS

Methyltransferase small domain

77

166

0.89

PF03848

TehB

Tellurite resistance protein TehB

69

189

0.85

PF10294

Methyltransf_16

Lysine methyltransferase

77

203

0.84

PF13649

Methyltransf_25

Methyltransferase domain

100

187

0.84

PF08241

Methyltransf_11

Methyltransferase domain

101

186

0.81

PF13489

Methyltransf_23

Methyltransferase domain

77

192

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
6p3o-assembly1.cif.gz_A-2 tetrahydroprotoberberine n-methyltransferase in complex with (s)-cis-n-methylstylopine and s-adenosylhomocysteine 0.8768 59 154
6p3m-assembly1.cif.gz_A-2 tetrahydroprotoberberine n-methyltransferase in complex with s-adenosylhomocysteine 0.8692 59 154
5jdz-assembly1.cif.gz_B crystal structure of burkholderia glumae toxa with bound s-adenosylhomocysteine (sah) 0.8444 51 154
3mgg-assembly1.cif.gz_A crystal structure of methyl transferase from methanosarcina mazei 0.8396 50 154
5fcd-assembly1.cif.gz_A crystal structure of mccd protein 0.8359 61 154
ID Description Score Start End Superfamily
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9031 55 114 3.40.50.150
af_Q6YUS4_32_214_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8762 44 167 3.40.50.150
af_Q55DF6_53_245_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8657 47 120 3.40.50.150
af_B7ZXR6_266_358_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8572 46 114 3.40.50.150
af_Q4CX97_260_523_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8421 52 177 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A6J6Q940-F1-model_v4 Unannotated protein 0.9019 8 184
AF-X1AI74-F1-model_v4 Methyltransferase type 11 domain-containing protein 0.8979 56 149 GO:0008757
AF-A0A7W1NM91-F1-model_v4 Class I SAM-dependent methyltransferase 0.8955 57 154 GO:0008757
GO:0032259
AF-A0A3B8MCS8-F1-model_v4 Methyltransferase domain-containing protein 0.8878 55 149
AF-A0A7Y1UBJ6-F1-model_v4 Class I SAM-dependent methyltransferase 0.8869 57 154 GO:0008168
GO:0032259

Map